KIR2DL5A (killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 5A)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 57292
Gene name Killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 5A
Gene symbol KIR2DL5A
Synonyms (NCBI Gene)
CD158FKIR2DL5KIR2DL5.1KIR2DL5.3
Chromosome 19
Chromosome location 19p13.3
Summary Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002764 Process Immune response-regulating signaling pathway IBA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
605305 16345 HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N109
Protein name Killer cell immunoglobulin-like receptor 2DL5A (CD antigen CD158f1)
Protein function Receptor on natural killer (NK) cells for HLA-C alleles. Inhibits the activity of NK cells thus preventing cell lysis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00047 ig 32 → 110 Immunoglobulin domain Domain
PF00047 ig 127 → 207 Immunoglobulin domain Domain
Sequence 
MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSL
YKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGL
FGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADF
PLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH
ILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQ
LDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTAL
SQNRVASSHVPAAGI
Sequence length 375
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Graft-versus-host disease
Sort by:
KIR2DL1 3 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, Graft-versus-host disease Related via 3 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR2DL2 3 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, Graft-versus-host disease Related via 3 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR2DL3 3 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, Graft-versus-host disease Related via 3 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR3DL1 3 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, Graft-versus-host disease Related via 3 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR3DL2 3 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, Graft-versus-host disease Related via 3 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity.
Keratoconus Linked via 2 of 5 related genesKIR2DL1, KIR3DL1 Autoimmune hepatitis Linked via 1 of 5 related genesKIR2DL2 Hydatidiform mole Linked via 1 of 5 related genesKIR3DL1 Alzheimer disease Linked via 1 of 5 related genesKIR3DL2 Crohn disease Linked via 1 of 5 related genesKIR3DL2