KIR2DL3 (killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 3804
Gene name Killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 3
Gene symbol KIR2DL3
Synonyms (NCBI Gene)
CD158B2CD158bGL183KIR-023GBKIR-K7bKIR-K7cKIR2DLKIR2DS5KIRCL23NKATNKAT2NKAT2ANKAT2Bp58
Chromosome 19
Chromosome location 19q13.42
Summary Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Download as csvDownload as pdf
Transcription factor Regulation Reference
DNMT1 Unknown 19628706
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002764 Process Immune response-regulating signaling pathway IBA
GO:0003823 Function Antigen binding TAS 9059894
GO:0005515 Function Protein binding IPI 8574854, 8648092, 8691154, 9148918, 18322206, 18604210, 19858347, 32296183
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604938 6331 ENSG00000243772
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P43628
Protein name Killer cell immunoglobulin-like receptor 2DL3 (CD158 antigen-like family member B2) (KIR-023GB) (Killer inhibitory receptor cl 2-3) (NKAT2a) (NKAT2b) (Natural killer-associated transcript 2) (NKAT-2) (p58 natural killer cell receptor clone CL-6) (p58 NK r
Protein function Receptor on natural killer (NK) cells for HLA-C alleles (HLA-Cw1, HLA-Cw3 and HLA-Cw7). Inhibits the activity of NK cells thus preventing cell lysis.
PDB 1B6U , 6PAG , 8TUI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00047 ig 32 → 115 Immunoglobulin domain Domain
PF00047 ig 132 → 213 Immunoglobulin domain Domain
Sequence 
MSLMVVSMVCVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLL
HREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGT
FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGN
PRHLHVLIGTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDPQE
VTYAQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAEP
Sequence length 341
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Antigen processing and presentation Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Natural killer cell mediated cytotoxicity  
Graft-versus-host disease  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Prostate cancer Uncertain significance ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (49)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Arthritis Psoriatic Psoriatic arthritis Pubtator 12218090 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 22960345, 26658904 Inhibit
★★★★★
★☆☆☆☆
Found in Text Mining only
Brachydactyly type C Brachydactyly BEFREE 31229495
★★★★★
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 18559534
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 11499809, 35279104 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Celiac Disease Celiac disease Pubtator 10784586 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Chronic Disease Chronic disease Pubtator 24935928 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Collecting Duct Carcinoma of the Kidney Renal Carcinoma BEFREE 31229495
★★★★★
★☆☆☆☆
Found in Text Mining only
Complete atrioventricular block Complete Atrioventricular Block BEFREE 20643584, 28211154, 31613998
★★★★★
★☆☆☆☆
Found in Text Mining only
Crohn Disease Crohn disease Pubtator 19789864, 24935928 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
KIR2DL1 4 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, Graft-versus-host disease, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 4 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR2DL2 4 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, Graft-versus-host disease, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 4 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR3DL1 4 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, Graft-versus-host disease, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 4 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR3DL2 4 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, Graft-versus-host disease, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 4 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KLRC1 4 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, Graft-versus-host disease, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 4 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity.
Keratoconus Linked via 2 of 5 related genesKIR2DL1, KIR3DL1 Autoimmune hepatitis Linked via 1 of 5 related genesKIR2DL2 Hydatidiform mole Linked via 1 of 5 related genesKIR3DL1 Alzheimer disease Linked via 1 of 5 related genesKIR3DL2 Crohn disease Linked via 1 of 5 related genesKIR3DL2