KIR2DS5 (killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 3810
Gene name Killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 5
Gene symbol KIR2DS5
Synonyms (NCBI Gene)
CD158GNKAT9
Chromosome 19
Chromosome location 19q13.4
Summary Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the
miRNA miRNA information provided by mirtarbase database.
7 Show/Hide all (7)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1095258 hsa-miR-1267 CLIP-seq
MIRT1095259 hsa-miR-1275 CLIP-seq
MIRT1095260 hsa-miR-138 CLIP-seq
MIRT1095261 hsa-miR-3147 CLIP-seq
MIRT1095262 hsa-miR-4425 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002764 Process Immune response-regulating signaling pathway IBA
GO:0005515 Function Protein binding IPI 18624290, 28685972
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 18682925
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604956 6337 HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14953
Protein name Killer cell immunoglobulin-like receptor 2DS5 (CD158 antigen-like family member G) (Natural killer-associated transcript 9) (NKAT-9) (CD antigen CD158g)
Protein function Activating natural killer (NK) receptor that recognizes C2 epitopes of HLA-C alleles. Bridging the innate and adaptive immune systems, NK cells express a number of cell surface receptors which either inhibit or stimulate their cytotoxicity (PubM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00047 ig 132 → 213 Immunoglobulin domain Domain
PF00047 ig 32 → 115 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed on a discrete subset of peripheral blood NK cells. {ECO:0000269|PubMed:18624290}.
Sequence 
MSLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLL
HREGTFNHTLRLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNRT
FQADFPLDPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNSSNSWPSPTEPSSETGN
PRHLHVLIGTSVVKLPFTILLFFLLHRWCSNKKNASVMDQGPAGNRTVNREDSDEQDHQE
VSYA
Sequence length 304
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Antigen processing and presentation DAP12 interactions
Natural killer cell mediated cytotoxicity  
Sort by:
KIR2DS4 3 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, DAP12 interactions Related via 3 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR2DS2 3 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, DAP12 interactions Related via 3 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR2DS1 3 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, DAP12 interactions Related via 3 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KLRC2 3 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, DAP12 interactions Related via 3 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR2DS3 2 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity Related via 2 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity.
Creutzfeldt-jakob disease Linked via 1 of 5 related genesKLRC2