KIR2DS2 (killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 2)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100132285
Gene name Killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 2
Gene symbol KIR2DS2
Synonyms (NCBI Gene)
183ActICD158JCD158bKIR-2DS2KIR2DL1NKAT-5NKAT5cl-49
Chromosome 19
Chromosome location 19q13.4
Summary Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the
miRNA miRNA information provided by mirtarbase database.
7 Show/Hide all (7)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1095237 hsa-miR-1267 CLIP-seq
MIRT1095238 hsa-miR-1275 CLIP-seq
MIRT1095239 hsa-miR-138 CLIP-seq
MIRT1095240 hsa-miR-3147 CLIP-seq
MIRT1095241 hsa-miR-4425 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002222 Process Stimulatory killer cell immunoglobulin-like receptor signaling pathway IDA 9655483
GO:0002764 Process Immune response-regulating signaling pathway IBA
GO:0004888 Function Transmembrane signaling receptor activity NAS 8627176
GO:0005515 Function Protein binding IPI 9655483
GO:0005886 Component Plasma membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604953 6334 HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P43631
Protein name Killer cell immunoglobulin-like receptor 2DS2 (CD158 antigen-like family member J) (NK receptor 183 ActI) (Natural killer-associated transcript 5) (NKAT-5) (p58 natural killer cell receptor clone CL-49) (p58 NK receptor CL-49) (CD antigen CD158j)
Protein function Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
PDB 1M4K , 4N8V , 7DUU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00047 ig 32 → 115 Immunoglobulin domain Domain
PF00047 ig 132 → 213 Immunoglobulin domain Domain
Sequence 
MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLL
HREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGT
FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQEPAGNRTVNSEDSDEQDHQE
VSYA
Sequence length 304
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Antigen processing and presentation Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Natural killer cell mediated cytotoxicity DAP12 interactions
Sort by:
KIR2DS1 4 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, DAP12 interactions, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 4 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR2DS4 3 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, DAP12 interactions Related via 3 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR2DS5 3 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, DAP12 interactions Related via 3 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. NCR2 3 shared pathwaysNatural killer cell mediated cytotoxicity, DAP12 interactions, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 3 shared pathways including Natural killer cell mediated cytotoxicity, DAP12 interactions. KLRD1 4 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity, DAP12 interactions, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 4 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity.
Alzheimer disease Linked via 1 of 5 related genesNCR2 Coronary thrombosis Linked via 1 of 5 related genesNCR2 Dementia Linked via 1 of 5 related genesNCR2 Hemolytic anemia Linked via 1 of 5 related genesNCR2 Lung disease Linked via 1 of 5 related genesNCR2