INSR (insulin receptor)

Gene

• Entrez ID: 3643
• Gene name: Insulin receptor
• Gene symbol: INSR
• Synonyms (NCBI Gene): CD220, HHF5
• Chromosome: 19
• Chromosome location: 19p13.2
• Summary: This gene encodes a member of the receptor tyrosine kinase family of proteins. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that form a heterotetrameric receptor. Binding of insulin or other ligands to this re

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1799816	C>T	Benign, likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity, benign-likely-benign	Coding sequence variant, missense variant
rs41304772	C>T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs52836744	C>T	Pathogenic	Coding sequence variant, missense variant
rs121913135	C>A	Pathogenic	Coding sequence variant, missense variant
rs121913136	T>C	Pathogenic	Coding sequence variant, missense variant
rs121913137	G>A,C	Pathogenic	Coding sequence variant, missense variant, stop gained
rs121913138	C>A	Pathogenic	Coding sequence variant, missense variant
rs121913139	C>T	Pathogenic	Coding sequence variant, missense variant
rs121913140	C>G,T	Pathogenic	Stop gained, coding sequence variant, missense variant
rs121913141	A>C,G	Pathogenic	Coding sequence variant, missense variant
rs121913142	A>C	Pathogenic	Coding sequence variant, missense variant
rs121913143	G>T	Pathogenic	Coding sequence variant, missense variant
rs121913144	G>A	Pathogenic	Coding sequence variant, stop gained
rs121913145	T>C	Pathogenic	Coding sequence variant, missense variant
rs121913146	C>T	Pathogenic	Coding sequence variant, stop gained
rs121913147	T>C	Pathogenic	Coding sequence variant, missense variant
rs121913148	C>T	Pathogenic	Coding sequence variant, missense variant
rs121913150	C>T	Pathogenic	Coding sequence variant, missense variant
rs121913151	G>A	Pathogenic, uncertain-significance	Coding sequence variant, stop gained
rs121913152	A>G	Pathogenic	Coding sequence variant, missense variant
rs121913153	C>A,G,T	Pathogenic	Coding sequence variant, missense variant
rs121913154	G>A,T	Pathogenic	Coding sequence variant, missense variant
rs121913155	T>A	Pathogenic	Coding sequence variant, stop gained
rs121913156	C>T	Pathogenic	Coding sequence variant, missense variant
rs121913157	C>T	Pathogenic	Coding sequence variant, missense variant
rs121913158	C>G	Pathogenic	Coding sequence variant, missense variant
rs121913159	G>C	Pathogenic	Coding sequence variant, missense variant
rs121913160	T>C	Pathogenic	Coding sequence variant, missense variant
rs138528064	G>A	Likely-benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs140573575	C>A,G,T	Benign, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs140852238	C>T	Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs146588336	G>C	Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs147125937	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs149795690	A>G	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs201445608	C>G,T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs267607184	C>T	Pathogenic	Missense variant, coding sequence variant
rs376497490	G>A,C	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant, intron variant
rs387906538	G>A,C	Pathogenic	Stop gained, coding sequence variant, missense variant
rs587776819	T>C	Pathogenic	Splice acceptor variant
rs587776820	GTCCTGGT>-	Pathogenic	Frameshift variant, coding sequence variant
rs752552480	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs781007453	G>A,C	Pathogenic	Missense variant, coding sequence variant
rs797045624	A>G	Pathogenic	Splice donor variant
rs886037750	C>T	Pathogenic	Missense variant, coding sequence variant
rs1135401737	C>A	Pathogenic	Coding sequence variant, missense variant
rs1135401738	G>A	Pathogenic	Coding sequence variant, missense variant
rs1135401739	C>A	Pathogenic	Coding sequence variant, missense variant
rs1135401740	A>C	Pathogenic	Coding sequence variant, stop gained
rs1135401741	C>T	Pathogenic	Coding sequence variant, missense variant
rs1135401742	T>C	Pathogenic	Coding sequence variant, missense variant
rs1347163319	GTTA>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555689937	A>G	Pathogenic	Coding sequence variant, missense variant
rs1555735951	ATCACTGGCA>CTTCC	Pathogenic	Frameshift variant, coding sequence variant
rs1555736246	GATA>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1568426700	G>A	Pathogenic	Coding sequence variant, missense variant
rs1599874183	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1599881881	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1599937180	G>A	Likely-pathogenic	Stop gained, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029227	hsa-miR-26b-5p	Microarray	19088304
MIRT438296	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	25240198
MIRT438296	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	25240198
MIRT438296	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	25240198
MIRT438296	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	25240198
MIRT438296	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	25240198
MIRT438296	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	25240198
MIRT438296	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	25240198
MIRT438296	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	25240198
MIRT495786	hsa-miR-7108-3p	PAR-CLIP	22291592
MIRT495786	hsa-miR-7108-3p	PAR-CLIP	22291592
MIRT731383	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot	26179126
MIRT731383	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot	26179126
MIRT495786	hsa-miR-7108-3p	PAR-CLIP	22291592
MIRT495786	hsa-miR-7108-3p	PAR-CLIP	22291592
MIRT1067783	hsa-let-7a	CLIP-seq
MIRT1067784	hsa-let-7b	CLIP-seq
MIRT1067785	hsa-let-7c	CLIP-seq
MIRT1067786	hsa-let-7d	CLIP-seq
MIRT1067787	hsa-let-7e	CLIP-seq
MIRT1067788	hsa-let-7f	CLIP-seq
MIRT1067789	hsa-let-7g	CLIP-seq
MIRT1067790	hsa-let-7i	CLIP-seq
MIRT1067791	hsa-miR-1204	CLIP-seq
MIRT1067792	hsa-miR-1226	CLIP-seq
MIRT1067793	hsa-miR-1236	CLIP-seq
MIRT1067794	hsa-miR-128	CLIP-seq
MIRT1067795	hsa-miR-1283	CLIP-seq
MIRT1067796	hsa-miR-1298	CLIP-seq
MIRT1067797	hsa-miR-1304	CLIP-seq
MIRT1067798	hsa-miR-135a	CLIP-seq
MIRT1067799	hsa-miR-135b	CLIP-seq
MIRT1067800	hsa-miR-150	CLIP-seq
MIRT1067801	hsa-miR-151-3p	CLIP-seq
MIRT1067802	hsa-miR-15a	CLIP-seq
MIRT1067803	hsa-miR-15b	CLIP-seq
MIRT1067804	hsa-miR-16	CLIP-seq
MIRT1067805	hsa-miR-187	CLIP-seq
MIRT1067806	hsa-miR-18a	CLIP-seq
MIRT1067807	hsa-miR-18b	CLIP-seq
MIRT1067808	hsa-miR-195	CLIP-seq
MIRT1067809	hsa-miR-202	CLIP-seq
MIRT1067810	hsa-miR-218	CLIP-seq
MIRT1067811	hsa-miR-223	CLIP-seq
MIRT1067812	hsa-miR-2355-5p	CLIP-seq
MIRT1067813	hsa-miR-2467-5p	CLIP-seq
MIRT1067814	hsa-miR-27a	CLIP-seq
MIRT1067815	hsa-miR-27b	CLIP-seq
MIRT1067816	hsa-miR-2964a-5p	CLIP-seq
MIRT1067817	hsa-miR-3065-5p	CLIP-seq
MIRT1067818	hsa-miR-3074-3p	CLIP-seq
MIRT1067819	hsa-miR-3120-3p	CLIP-seq
MIRT1067820	hsa-miR-3125	CLIP-seq
MIRT1067821	hsa-miR-3152-3p	CLIP-seq
MIRT1067822	hsa-miR-3166	CLIP-seq
MIRT1067823	hsa-miR-3177-5p	CLIP-seq
MIRT1067824	hsa-miR-3183	CLIP-seq
MIRT1067825	hsa-miR-3188	CLIP-seq
MIRT1067826	hsa-miR-320a	CLIP-seq
MIRT1067827	hsa-miR-320b	CLIP-seq
MIRT1067828	hsa-miR-320c	CLIP-seq
MIRT1067829	hsa-miR-320d	CLIP-seq
MIRT1067830	hsa-miR-330-3p	CLIP-seq
MIRT1067831	hsa-miR-342-3p	CLIP-seq
MIRT1067832	hsa-miR-34b	CLIP-seq
MIRT1067833	hsa-miR-34c-3p	CLIP-seq
MIRT1067834	hsa-miR-3529	CLIP-seq
MIRT1067835	hsa-miR-3609	CLIP-seq
MIRT1067836	hsa-miR-3616-5p	CLIP-seq
MIRT1067837	hsa-miR-3647-5p	CLIP-seq
MIRT1067838	hsa-miR-3667-3p	CLIP-seq
MIRT1067839	hsa-miR-379	CLIP-seq
MIRT1067840	hsa-miR-3916	CLIP-seq
MIRT1067841	hsa-miR-3927	CLIP-seq
MIRT1067842	hsa-miR-3975	CLIP-seq
MIRT1067843	hsa-miR-410	CLIP-seq
MIRT1067844	hsa-miR-424	CLIP-seq
MIRT1067845	hsa-miR-4277	CLIP-seq
MIRT1067846	hsa-miR-4279	CLIP-seq
MIRT1067847	hsa-miR-4290	CLIP-seq
MIRT1067848	hsa-miR-4293	CLIP-seq
MIRT1067849	hsa-miR-4429	CLIP-seq
MIRT1067850	hsa-miR-4458	CLIP-seq
MIRT1067851	hsa-miR-4463	CLIP-seq
MIRT1067852	hsa-miR-4499	CLIP-seq
MIRT1067853	hsa-miR-4500	CLIP-seq
MIRT1067854	hsa-miR-4524	CLIP-seq
MIRT1067855	hsa-miR-4697-3p	CLIP-seq
MIRT1067856	hsa-miR-4704-3p	CLIP-seq
MIRT1067857	hsa-miR-4709-3p	CLIP-seq
MIRT1067858	hsa-miR-4711-3p	CLIP-seq
MIRT1067859	hsa-miR-4711-5p	CLIP-seq
MIRT1067860	hsa-miR-4717-3p	CLIP-seq
MIRT1067861	hsa-miR-4723-3p	CLIP-seq
MIRT1067862	hsa-miR-4733-3p	CLIP-seq
MIRT1067863	hsa-miR-4735-3p	CLIP-seq
MIRT1067864	hsa-miR-4757-5p	CLIP-seq
MIRT1067865	hsa-miR-4762-3p	CLIP-seq
MIRT1067866	hsa-miR-4766-5p	CLIP-seq
MIRT1067867	hsa-miR-4771	CLIP-seq
MIRT1067868	hsa-miR-4795-5p	CLIP-seq
MIRT1067869	hsa-miR-485-5p	CLIP-seq
MIRT1067870	hsa-miR-488	CLIP-seq
MIRT1067871	hsa-miR-497	CLIP-seq
MIRT1067872	hsa-miR-503	CLIP-seq
MIRT1067873	hsa-miR-511	CLIP-seq
MIRT1067874	hsa-miR-513a-5p	CLIP-seq
MIRT1067875	hsa-miR-548aa	CLIP-seq
MIRT1067876	hsa-miR-548ah	CLIP-seq
MIRT1067877	hsa-miR-548t	CLIP-seq
MIRT1067878	hsa-miR-561	CLIP-seq
MIRT1067879	hsa-miR-573	CLIP-seq
MIRT1067880	hsa-miR-581	CLIP-seq
MIRT1067881	hsa-miR-587	CLIP-seq
MIRT1067882	hsa-miR-592	CLIP-seq
MIRT1067883	hsa-miR-597	CLIP-seq
MIRT1067884	hsa-miR-599	CLIP-seq
MIRT1067885	hsa-miR-603	CLIP-seq
MIRT1067886	hsa-miR-605	CLIP-seq
MIRT1067887	hsa-miR-607	CLIP-seq
MIRT1067888	hsa-miR-630	CLIP-seq
MIRT1067889	hsa-miR-636	CLIP-seq
MIRT1067890	hsa-miR-646	CLIP-seq
MIRT1067891	hsa-miR-676	CLIP-seq
MIRT1067892	hsa-miR-922	CLIP-seq
MIRT1067893	hsa-miR-98	CLIP-seq
MIRT1067783	hsa-let-7a	CLIP-seq
MIRT1067784	hsa-let-7b	CLIP-seq
MIRT1067785	hsa-let-7c	CLIP-seq
MIRT1067786	hsa-let-7d	CLIP-seq
MIRT1067787	hsa-let-7e	CLIP-seq
MIRT1067788	hsa-let-7f	CLIP-seq
MIRT1067789	hsa-let-7g	CLIP-seq
MIRT1067790	hsa-let-7i	CLIP-seq
MIRT1067894	hsa-miR-1224-5p	CLIP-seq
MIRT1067797	hsa-miR-1304	CLIP-seq
MIRT1067801	hsa-miR-151-3p	CLIP-seq
MIRT1067802	hsa-miR-15a	CLIP-seq
MIRT1067803	hsa-miR-15b	CLIP-seq
MIRT1067804	hsa-miR-16	CLIP-seq
MIRT1067808	hsa-miR-195	CLIP-seq
MIRT1067809	hsa-miR-202	CLIP-seq
MIRT1067826	hsa-miR-320a	CLIP-seq
MIRT1067827	hsa-miR-320b	CLIP-seq
MIRT1067828	hsa-miR-320c	CLIP-seq
MIRT1067829	hsa-miR-320d	CLIP-seq
MIRT1067830	hsa-miR-330-3p	CLIP-seq
MIRT1067831	hsa-miR-342-3p	CLIP-seq
MIRT1067834	hsa-miR-3529	CLIP-seq
MIRT1067839	hsa-miR-379	CLIP-seq
MIRT1067895	hsa-miR-3915	CLIP-seq
MIRT1067841	hsa-miR-3927	CLIP-seq
MIRT1067896	hsa-miR-3928	CLIP-seq
MIRT1067844	hsa-miR-424	CLIP-seq
MIRT1067849	hsa-miR-4429	CLIP-seq
MIRT1067850	hsa-miR-4458	CLIP-seq
MIRT1067851	hsa-miR-4463	CLIP-seq
MIRT1067852	hsa-miR-4499	CLIP-seq
MIRT1067853	hsa-miR-4500	CLIP-seq
MIRT1067897	hsa-miR-4517	CLIP-seq
MIRT1067898	hsa-miR-4689	CLIP-seq
MIRT1067860	hsa-miR-4717-3p	CLIP-seq
MIRT1067871	hsa-miR-497	CLIP-seq
MIRT1067890	hsa-miR-646	CLIP-seq
MIRT1067893	hsa-miR-98	CLIP-seq
MIRT2016442	hsa-miR-1200	CLIP-seq
MIRT1067791	hsa-miR-1204	CLIP-seq
MIRT2016443	hsa-miR-1252	CLIP-seq
MIRT2016444	hsa-miR-1253	CLIP-seq
MIRT2016445	hsa-miR-1255a	CLIP-seq
MIRT2016446	hsa-miR-1255b	CLIP-seq
MIRT2016447	hsa-miR-1292	CLIP-seq
MIRT1067800	hsa-miR-150	CLIP-seq
MIRT2016448	hsa-miR-185	CLIP-seq
MIRT2016449	hsa-miR-2116	CLIP-seq
MIRT1067810	hsa-miR-218	CLIP-seq
MIRT2016450	hsa-miR-24	CLIP-seq
MIRT1067813	hsa-miR-2467-5p	CLIP-seq
MIRT1067819	hsa-miR-3120-3p	CLIP-seq
MIRT1067825	hsa-miR-3188	CLIP-seq
MIRT2016451	hsa-miR-3194-3p	CLIP-seq
MIRT1067830	hsa-miR-330-3p	CLIP-seq
MIRT1067832	hsa-miR-34b	CLIP-seq
MIRT1067834	hsa-miR-3529	CLIP-seq
MIRT2016452	hsa-miR-3611	CLIP-seq
MIRT2016453	hsa-miR-3653	CLIP-seq
MIRT2016454	hsa-miR-3670	CLIP-seq
MIRT1067839	hsa-miR-379	CLIP-seq
MIRT1067841	hsa-miR-3927	CLIP-seq
MIRT2016455	hsa-miR-3942-5p	CLIP-seq
MIRT1067842	hsa-miR-3975	CLIP-seq
MIRT2016456	hsa-miR-4258	CLIP-seq
MIRT2016457	hsa-miR-4268	CLIP-seq
MIRT1067845	hsa-miR-4277	CLIP-seq
MIRT2016458	hsa-miR-4306	CLIP-seq
MIRT2016459	hsa-miR-432	CLIP-seq
MIRT2016460	hsa-miR-4327	CLIP-seq
MIRT2016461	hsa-miR-4427	CLIP-seq
MIRT2016462	hsa-miR-4428	CLIP-seq
MIRT2016463	hsa-miR-4434	CLIP-seq
MIRT2016464	hsa-miR-4476	CLIP-seq
MIRT2016465	hsa-miR-450b-3p	CLIP-seq
MIRT2016466	hsa-miR-4516	CLIP-seq
MIRT2016467	hsa-miR-4525	CLIP-seq
MIRT2016468	hsa-miR-4533	CLIP-seq
MIRT2016469	hsa-miR-4635	CLIP-seq
MIRT2016470	hsa-miR-4644	CLIP-seq
MIRT2016471	hsa-miR-4680-3p	CLIP-seq
MIRT2016472	hsa-miR-4699-3p	CLIP-seq
MIRT2016473	hsa-miR-4703-5p	CLIP-seq
MIRT2016474	hsa-miR-4707-3p	CLIP-seq
MIRT2016475	hsa-miR-4713-5p	CLIP-seq
MIRT2016476	hsa-miR-4716-3p	CLIP-seq
MIRT2016477	hsa-miR-4731-3p	CLIP-seq
MIRT1067864	hsa-miR-4757-5p	CLIP-seq
MIRT2016478	hsa-miR-4780	CLIP-seq
MIRT2016479	hsa-miR-4801	CLIP-seq
MIRT1067869	hsa-miR-485-5p	CLIP-seq
MIRT2016480	hsa-miR-507	CLIP-seq
MIRT2016481	hsa-miR-532-3p	CLIP-seq
MIRT2016482	hsa-miR-544b	CLIP-seq
MIRT2016483	hsa-miR-545	CLIP-seq
MIRT2016484	hsa-miR-552	CLIP-seq
MIRT2016485	hsa-miR-556-5p	CLIP-seq
MIRT2016486	hsa-miR-557	CLIP-seq
MIRT2016487	hsa-miR-580	CLIP-seq
MIRT1067882	hsa-miR-592	CLIP-seq
MIRT1067884	hsa-miR-599	CLIP-seq
MIRT2016488	hsa-miR-634	CLIP-seq
MIRT2016489	hsa-miR-642b	CLIP-seq
MIRT2016490	hsa-miR-769-3p	CLIP-seq
MIRT1067783	hsa-let-7a	CLIP-seq
MIRT1067784	hsa-let-7b	CLIP-seq
MIRT1067785	hsa-let-7c	CLIP-seq
MIRT1067786	hsa-let-7d	CLIP-seq
MIRT1067787	hsa-let-7e	CLIP-seq
MIRT1067788	hsa-let-7f	CLIP-seq
MIRT1067789	hsa-let-7g	CLIP-seq
MIRT1067790	hsa-let-7i	CLIP-seq
MIRT2248690	hsa-miR-1208	CLIP-seq
MIRT1067894	hsa-miR-1224-5p	CLIP-seq
MIRT2248691	hsa-miR-1245b-3p	CLIP-seq
MIRT2016444	hsa-miR-1253	CLIP-seq
MIRT2248692	hsa-miR-1254	CLIP-seq
MIRT2248693	hsa-miR-1278	CLIP-seq
MIRT2248694	hsa-miR-129-5p	CLIP-seq
MIRT2248695	hsa-miR-1470	CLIP-seq
MIRT1067801	hsa-miR-151-3p	CLIP-seq
MIRT1067802	hsa-miR-15a	CLIP-seq
MIRT1067803	hsa-miR-15b	CLIP-seq
MIRT1067804	hsa-miR-16	CLIP-seq
MIRT1067808	hsa-miR-195	CLIP-seq
MIRT1067809	hsa-miR-202	CLIP-seq
MIRT2248696	hsa-miR-2110	CLIP-seq
MIRT2016449	hsa-miR-2116	CLIP-seq
MIRT2248697	hsa-miR-2277-3p	CLIP-seq
MIRT1067818	hsa-miR-3074-3p	CLIP-seq
MIRT2248698	hsa-miR-3116	CLIP-seq
MIRT1067820	hsa-miR-3125	CLIP-seq
MIRT2248699	hsa-miR-3127-3p	CLIP-seq
MIRT2248700	hsa-miR-3150a-3p	CLIP-seq
MIRT2248701	hsa-miR-3165	CLIP-seq
MIRT2248702	hsa-miR-3173-3p	CLIP-seq
MIRT2248703	hsa-miR-3182	CLIP-seq
MIRT2248704	hsa-miR-3186-5p	CLIP-seq
MIRT2248705	hsa-miR-323-5p	CLIP-seq
MIRT1067830	hsa-miR-330-3p	CLIP-seq
MIRT2248706	hsa-miR-345	CLIP-seq
MIRT1067834	hsa-miR-3529	CLIP-seq
MIRT2248707	hsa-miR-3613-3p	CLIP-seq
MIRT2248708	hsa-miR-3622a-3p	CLIP-seq
MIRT2248709	hsa-miR-3622b-3p	CLIP-seq
MIRT2248710	hsa-miR-3664-3p	CLIP-seq
MIRT2248711	hsa-miR-3685	CLIP-seq
MIRT2248712	hsa-miR-3686	CLIP-seq
MIRT2248713	hsa-miR-371b-5p	CLIP-seq
MIRT1067839	hsa-miR-379	CLIP-seq
MIRT2248714	hsa-miR-384	CLIP-seq
MIRT2248715	hsa-miR-3907	CLIP-seq
MIRT1067840	hsa-miR-3916	CLIP-seq
MIRT1067841	hsa-miR-3927	CLIP-seq
MIRT2248716	hsa-miR-3974	CLIP-seq
MIRT1067844	hsa-miR-424	CLIP-seq
MIRT2248717	hsa-miR-4260	CLIP-seq
MIRT2248718	hsa-miR-4271	CLIP-seq
MIRT1067846	hsa-miR-4279	CLIP-seq
MIRT2248719	hsa-miR-4307	CLIP-seq
MIRT2248720	hsa-miR-4311	CLIP-seq
MIRT2248721	hsa-miR-4320	CLIP-seq
MIRT2248722	hsa-miR-4420	CLIP-seq
MIRT2248723	hsa-miR-4422	CLIP-seq
MIRT1067850	hsa-miR-4458	CLIP-seq
MIRT1067851	hsa-miR-4463	CLIP-seq
MIRT2248724	hsa-miR-4464	CLIP-seq
MIRT2248725	hsa-miR-4469	CLIP-seq
MIRT2248726	hsa-miR-4484	CLIP-seq
MIRT2248727	hsa-miR-4496	CLIP-seq
MIRT1067852	hsa-miR-4499	CLIP-seq
MIRT1067853	hsa-miR-4500	CLIP-seq
MIRT2248728	hsa-miR-450b-5p	CLIP-seq
MIRT2248729	hsa-miR-4666-5p	CLIP-seq
MIRT2248730	hsa-miR-4667-3p	CLIP-seq
MIRT2248731	hsa-miR-4677-5p	CLIP-seq
MIRT2248732	hsa-miR-4691-5p	CLIP-seq
MIRT1067856	hsa-miR-4704-3p	CLIP-seq
MIRT1067859	hsa-miR-4711-5p	CLIP-seq
MIRT2248733	hsa-miR-4725-3p	CLIP-seq
MIRT2016477	hsa-miR-4731-3p	CLIP-seq
MIRT2248734	hsa-miR-4733-5p	CLIP-seq
MIRT2248735	hsa-miR-4748	CLIP-seq
MIRT2248736	hsa-miR-4751	CLIP-seq
MIRT1067866	hsa-miR-4766-5p	CLIP-seq
MIRT2016479	hsa-miR-4801	CLIP-seq
MIRT2248737	hsa-miR-4802-3p	CLIP-seq
MIRT2248738	hsa-miR-483-3p	CLIP-seq
MIRT2248739	hsa-miR-490-5p	CLIP-seq
MIRT1067871	hsa-miR-497	CLIP-seq
MIRT2248740	hsa-miR-499-3p	CLIP-seq
MIRT2248741	hsa-miR-499a-3p	CLIP-seq
MIRT2248742	hsa-miR-505	CLIP-seq
MIRT2016480	hsa-miR-507	CLIP-seq
MIRT2248743	hsa-miR-518a-5p	CLIP-seq
MIRT2248744	hsa-miR-520d-5p	CLIP-seq
MIRT2248745	hsa-miR-524-5p	CLIP-seq
MIRT2248746	hsa-miR-527	CLIP-seq
MIRT1067877	hsa-miR-548t	CLIP-seq
MIRT2248747	hsa-miR-556-3p	CLIP-seq
MIRT2016486	hsa-miR-557	CLIP-seq
MIRT2016488	hsa-miR-634	CLIP-seq
MIRT2016489	hsa-miR-642b	CLIP-seq
MIRT1067890	hsa-miR-646	CLIP-seq
MIRT2248748	hsa-miR-670	CLIP-seq
MIRT2248749	hsa-miR-873	CLIP-seq
MIRT2248750	hsa-miR-876-3p	CLIP-seq
MIRT2248751	hsa-miR-889	CLIP-seq
MIRT2248752	hsa-miR-890	CLIP-seq
MIRT2248753	hsa-miR-892a	CLIP-seq
MIRT1067893	hsa-miR-98	CLIP-seq
MIRT1067783	hsa-let-7a	CLIP-seq
MIRT1067784	hsa-let-7b	CLIP-seq
MIRT1067785	hsa-let-7c	CLIP-seq
MIRT1067786	hsa-let-7d	CLIP-seq
MIRT1067787	hsa-let-7e	CLIP-seq
MIRT1067788	hsa-let-7f	CLIP-seq
MIRT1067789	hsa-let-7g	CLIP-seq
MIRT1067790	hsa-let-7i	CLIP-seq
MIRT1067801	hsa-miR-151-3p	CLIP-seq
MIRT1067809	hsa-miR-202	CLIP-seq
MIRT2016449	hsa-miR-2116	CLIP-seq
MIRT1067811	hsa-miR-223	CLIP-seq
MIRT1067822	hsa-miR-3166	CLIP-seq
MIRT1067832	hsa-miR-34b	CLIP-seq
MIRT1067834	hsa-miR-3529	CLIP-seq
MIRT2248708	hsa-miR-3622a-3p	CLIP-seq
MIRT2248709	hsa-miR-3622b-3p	CLIP-seq
MIRT1067839	hsa-miR-379	CLIP-seq
MIRT1067841	hsa-miR-3927	CLIP-seq
MIRT1067845	hsa-miR-4277	CLIP-seq
MIRT1067850	hsa-miR-4458	CLIP-seq
MIRT1067851	hsa-miR-4463	CLIP-seq
MIRT1067852	hsa-miR-4499	CLIP-seq
MIRT1067853	hsa-miR-4500	CLIP-seq
MIRT2016469	hsa-miR-4635	CLIP-seq
MIRT2248731	hsa-miR-4677-5p	CLIP-seq
MIRT1067855	hsa-miR-4697-3p	CLIP-seq
MIRT1067867	hsa-miR-4771	CLIP-seq
MIRT2016480	hsa-miR-507	CLIP-seq
MIRT2016486	hsa-miR-557	CLIP-seq
MIRT1067880	hsa-miR-581	CLIP-seq
MIRT1067882	hsa-miR-592	CLIP-seq
MIRT1067883	hsa-miR-597	CLIP-seq
MIRT1067884	hsa-miR-599	CLIP-seq
MIRT1067893	hsa-miR-98	CLIP-seq
MIRT2437902	hsa-miR-127-5p	CLIP-seq
MIRT2437903	hsa-miR-1324	CLIP-seq
MIRT2437904	hsa-miR-4724-5p	CLIP-seq
MIRT1067873	hsa-miR-511	CLIP-seq
MIRT2248692	hsa-miR-1254	CLIP-seq
MIRT2248695	hsa-miR-1470	CLIP-seq
MIRT2451885	hsa-miR-205	CLIP-seq
MIRT2248698	hsa-miR-3116	CLIP-seq
MIRT2248699	hsa-miR-3127-3p	CLIP-seq
MIRT2451886	hsa-miR-3157-5p	CLIP-seq
MIRT2248725	hsa-miR-4469	CLIP-seq
MIRT2248730	hsa-miR-4667-3p	CLIP-seq
MIRT2451887	hsa-miR-4668-3p	CLIP-seq
MIRT2451888	hsa-miR-4758-3p	CLIP-seq
MIRT2451889	hsa-miR-500a	CLIP-seq
MIRT2451890	hsa-miR-548c-3p	CLIP-seq
MIRT1067791	hsa-miR-1204	CLIP-seq
MIRT2248690	hsa-miR-1208	CLIP-seq
MIRT1067894	hsa-miR-1224-5p	CLIP-seq
MIRT1067792	hsa-miR-1226	CLIP-seq
MIRT2016443	hsa-miR-1252	CLIP-seq
MIRT2016444	hsa-miR-1253	CLIP-seq
MIRT2248692	hsa-miR-1254	CLIP-seq
MIRT2016445	hsa-miR-1255a	CLIP-seq
MIRT2016446	hsa-miR-1255b	CLIP-seq
MIRT2552287	hsa-miR-125a-3p	CLIP-seq
MIRT2552288	hsa-miR-125a-5p	CLIP-seq
MIRT2552289	hsa-miR-125b	CLIP-seq
MIRT2552290	hsa-miR-1271	CLIP-seq
MIRT2552291	hsa-miR-1279	CLIP-seq
MIRT2248694	hsa-miR-129-5p	CLIP-seq
MIRT1067796	hsa-miR-1298	CLIP-seq
MIRT1067797	hsa-miR-1304	CLIP-seq
MIRT1067798	hsa-miR-135a	CLIP-seq
MIRT1067799	hsa-miR-135b	CLIP-seq
MIRT2552292	hsa-miR-140-3p	CLIP-seq
MIRT2248695	hsa-miR-1470	CLIP-seq
MIRT1067800	hsa-miR-150	CLIP-seq
MIRT1067802	hsa-miR-15a	CLIP-seq
MIRT1067803	hsa-miR-15b	CLIP-seq
MIRT1067804	hsa-miR-16	CLIP-seq
MIRT2552293	hsa-miR-181a	CLIP-seq
MIRT2552294	hsa-miR-181b	CLIP-seq
MIRT2552295	hsa-miR-181c	CLIP-seq
MIRT2552296	hsa-miR-181d	CLIP-seq
MIRT2552297	hsa-miR-182	CLIP-seq
MIRT2016448	hsa-miR-185	CLIP-seq
MIRT2552298	hsa-miR-186	CLIP-seq
MIRT1067805	hsa-miR-187	CLIP-seq
MIRT1067806	hsa-miR-18a	CLIP-seq
MIRT1067807	hsa-miR-18b	CLIP-seq
MIRT1067808	hsa-miR-195	CLIP-seq
MIRT2451885	hsa-miR-205	CLIP-seq
MIRT2552299	hsa-miR-208a	CLIP-seq
MIRT2552300	hsa-miR-208b	CLIP-seq
MIRT2016449	hsa-miR-2116	CLIP-seq
MIRT2552301	hsa-miR-216a	CLIP-seq
MIRT1067810	hsa-miR-218	CLIP-seq
MIRT1067812	hsa-miR-2355-5p	CLIP-seq
MIRT2552302	hsa-miR-2467-3p	CLIP-seq
MIRT1067813	hsa-miR-2467-5p	CLIP-seq
MIRT1067816	hsa-miR-2964a-5p	CLIP-seq
MIRT1067817	hsa-miR-3065-5p	CLIP-seq
MIRT1067818	hsa-miR-3074-3p	CLIP-seq
MIRT2248698	hsa-miR-3116	CLIP-seq
MIRT2248699	hsa-miR-3127-3p	CLIP-seq
MIRT2552303	hsa-miR-3133	CLIP-seq
MIRT1067821	hsa-miR-3152-3p	CLIP-seq
MIRT2451886	hsa-miR-3157-5p	CLIP-seq
MIRT2552304	hsa-miR-3163	CLIP-seq
MIRT1067823	hsa-miR-3177-5p	CLIP-seq
MIRT1067824	hsa-miR-3183	CLIP-seq
MIRT2552305	hsa-miR-3185	CLIP-seq
MIRT1067825	hsa-miR-3188	CLIP-seq
MIRT1067826	hsa-miR-320a	CLIP-seq
MIRT1067827	hsa-miR-320b	CLIP-seq
MIRT1067828	hsa-miR-320c	CLIP-seq
MIRT1067829	hsa-miR-320d	CLIP-seq
MIRT2552306	hsa-miR-323b-3p	CLIP-seq
MIRT2552307	hsa-miR-329	CLIP-seq
MIRT1067830	hsa-miR-330-3p	CLIP-seq
MIRT2552308	hsa-miR-339-5p	CLIP-seq
MIRT1067831	hsa-miR-342-3p	CLIP-seq
MIRT2248706	hsa-miR-345	CLIP-seq
MIRT1067835	hsa-miR-3609	CLIP-seq
MIRT2248707	hsa-miR-3613-3p	CLIP-seq
MIRT2552309	hsa-miR-3618	CLIP-seq
MIRT2552310	hsa-miR-362-3p	CLIP-seq
MIRT2016453	hsa-miR-3653	CLIP-seq
MIRT2552311	hsa-miR-3658	CLIP-seq
MIRT2552312	hsa-miR-3663-3p	CLIP-seq
MIRT2248710	hsa-miR-3664-3p	CLIP-seq
MIRT2552313	hsa-miR-3667-5p	CLIP-seq
MIRT2016454	hsa-miR-3670	CLIP-seq
MIRT2552314	hsa-miR-3678-3p	CLIP-seq
MIRT2552315	hsa-miR-3690	CLIP-seq
MIRT2552316	hsa-miR-371-5p	CLIP-seq
MIRT2248713	hsa-miR-371b-5p	CLIP-seq
MIRT2552317	hsa-miR-377	CLIP-seq
MIRT2552318	hsa-miR-382	CLIP-seq
MIRT2552319	hsa-miR-3908	CLIP-seq
MIRT2552320	hsa-miR-3912	CLIP-seq
MIRT1067895	hsa-miR-3915	CLIP-seq
MIRT1067841	hsa-miR-3927	CLIP-seq
MIRT1067896	hsa-miR-3928	CLIP-seq
MIRT2552321	hsa-miR-3938	CLIP-seq
MIRT2552322	hsa-miR-3941	CLIP-seq
MIRT2016455	hsa-miR-3942-5p	CLIP-seq
MIRT1067842	hsa-miR-3975	CLIP-seq
MIRT1067843	hsa-miR-410	CLIP-seq
MIRT1067844	hsa-miR-424	CLIP-seq
MIRT2552323	hsa-miR-4254	CLIP-seq
MIRT2016456	hsa-miR-4258	CLIP-seq
MIRT2552324	hsa-miR-4262	CLIP-seq
MIRT2016457	hsa-miR-4268	CLIP-seq
MIRT2552325	hsa-miR-4274	CLIP-seq
MIRT1067846	hsa-miR-4279	CLIP-seq
MIRT2552326	hsa-miR-4286	CLIP-seq
MIRT2552327	hsa-miR-4304	CLIP-seq
MIRT2016458	hsa-miR-4306	CLIP-seq
MIRT2552328	hsa-miR-4319	CLIP-seq
MIRT2552329	hsa-miR-433	CLIP-seq
MIRT2248722	hsa-miR-4420	CLIP-seq
MIRT2248723	hsa-miR-4422	CLIP-seq
MIRT2016462	hsa-miR-4428	CLIP-seq
MIRT1067849	hsa-miR-4429	CLIP-seq
MIRT2552330	hsa-miR-4446-5p	CLIP-seq
MIRT2552331	hsa-miR-4457	CLIP-seq
MIRT2248725	hsa-miR-4469	CLIP-seq
MIRT2552332	hsa-miR-4470	CLIP-seq
MIRT2016464	hsa-miR-4476	CLIP-seq
MIRT2016465	hsa-miR-450b-3p	CLIP-seq
MIRT2552333	hsa-miR-4514	CLIP-seq
MIRT1067897	hsa-miR-4517	CLIP-seq
MIRT2552334	hsa-miR-4522	CLIP-seq
MIRT1067854	hsa-miR-4524	CLIP-seq
MIRT2016467	hsa-miR-4525	CLIP-seq
MIRT2552335	hsa-miR-4532	CLIP-seq
MIRT2016468	hsa-miR-4533	CLIP-seq
MIRT2016470	hsa-miR-4644	CLIP-seq
MIRT2552336	hsa-miR-4649-5p	CLIP-seq
MIRT2552337	hsa-miR-4650-3p	CLIP-seq
MIRT2552338	hsa-miR-4652-3p	CLIP-seq
MIRT2552339	hsa-miR-4662a-3p	CLIP-seq
MIRT2248729	hsa-miR-4666-5p	CLIP-seq
MIRT2248730	hsa-miR-4667-3p	CLIP-seq
MIRT2451887	hsa-miR-4668-3p	CLIP-seq
MIRT2248731	hsa-miR-4677-5p	CLIP-seq
MIRT1067898	hsa-miR-4689	CLIP-seq
MIRT2552340	hsa-miR-4692	CLIP-seq
MIRT2552341	hsa-miR-4694-3p	CLIP-seq
MIRT2016472	hsa-miR-4699-3p	CLIP-seq
MIRT2016473	hsa-miR-4703-5p	CLIP-seq
MIRT1067857	hsa-miR-4709-3p	CLIP-seq
MIRT2552342	hsa-miR-4712-3p	CLIP-seq
MIRT2016475	hsa-miR-4713-5p	CLIP-seq
MIRT2016476	hsa-miR-4716-3p	CLIP-seq
MIRT1067860	hsa-miR-4717-3p	CLIP-seq
MIRT2552343	hsa-miR-4717-5p	CLIP-seq
MIRT2552344	hsa-miR-4718	CLIP-seq
MIRT1067861	hsa-miR-4723-3p	CLIP-seq
MIRT2016477	hsa-miR-4731-3p	CLIP-seq
MIRT2552345	hsa-miR-4732-3p	CLIP-seq
MIRT1067862	hsa-miR-4733-3p	CLIP-seq
MIRT2248734	hsa-miR-4733-5p	CLIP-seq
MIRT1067863	hsa-miR-4735-3p	CLIP-seq
MIRT2552346	hsa-miR-4742-3p	CLIP-seq
MIRT1067864	hsa-miR-4757-5p	CLIP-seq
MIRT2451888	hsa-miR-4758-3p	CLIP-seq
MIRT1067865	hsa-miR-4762-3p	CLIP-seq
MIRT2552347	hsa-miR-4766-3p	CLIP-seq
MIRT1067866	hsa-miR-4766-5p	CLIP-seq
MIRT2016478	hsa-miR-4780	CLIP-seq
MIRT2016479	hsa-miR-4801	CLIP-seq
MIRT1067869	hsa-miR-485-5p	CLIP-seq
MIRT2248739	hsa-miR-490-5p	CLIP-seq
MIRT1067871	hsa-miR-497	CLIP-seq
MIRT2552348	hsa-miR-499-5p	CLIP-seq
MIRT2451889	hsa-miR-500a	CLIP-seq
MIRT1067872	hsa-miR-503	CLIP-seq
MIRT2016480	hsa-miR-507	CLIP-seq
MIRT2552349	hsa-miR-510	CLIP-seq
MIRT2552350	hsa-miR-513a-3p	CLIP-seq
MIRT2552351	hsa-miR-517b	CLIP-seq
MIRT2248744	hsa-miR-520d-5p	CLIP-seq
MIRT2552352	hsa-miR-520g	CLIP-seq
MIRT2552353	hsa-miR-520h	CLIP-seq
MIRT2248745	hsa-miR-524-5p	CLIP-seq
MIRT2016481	hsa-miR-532-3p	CLIP-seq
MIRT2552354	hsa-miR-532-5p	CLIP-seq
MIRT2016483	hsa-miR-545	CLIP-seq
MIRT1067875	hsa-miR-548aa	CLIP-seq
MIRT1067876	hsa-miR-548ah	CLIP-seq
MIRT2552355	hsa-miR-548b-3p	CLIP-seq
MIRT2451890	hsa-miR-548c-3p	CLIP-seq
MIRT1067877	hsa-miR-548t	CLIP-seq
MIRT2552356	hsa-miR-550a	CLIP-seq
MIRT2016485	hsa-miR-556-5p	CLIP-seq
MIRT2016486	hsa-miR-557	CLIP-seq
MIRT2016487	hsa-miR-580	CLIP-seq
MIRT2552357	hsa-miR-583	CLIP-seq
MIRT1067885	hsa-miR-603	CLIP-seq
MIRT2552358	hsa-miR-624	CLIP-seq
MIRT1067888	hsa-miR-630	CLIP-seq
MIRT1067889	hsa-miR-636	CLIP-seq
MIRT2016489	hsa-miR-642b	CLIP-seq
MIRT1067890	hsa-miR-646	CLIP-seq
MIRT2248748	hsa-miR-670	CLIP-seq
MIRT2552359	hsa-miR-671-3p	CLIP-seq
MIRT2552360	hsa-miR-7	CLIP-seq
MIRT2016490	hsa-miR-769-3p	CLIP-seq
MIRT2248749	hsa-miR-873	CLIP-seq
MIRT2248751	hsa-miR-889	CLIP-seq
MIRT2552361	hsa-miR-934	CLIP-seq
MIRT2552362	hsa-miR-96	CLIP-seq
MIRT1067791	hsa-miR-1204	CLIP-seq
MIRT1067894	hsa-miR-1224-5p	CLIP-seq
MIRT1067792	hsa-miR-1226	CLIP-seq
MIRT2016443	hsa-miR-1252	CLIP-seq
MIRT2016444	hsa-miR-1253	CLIP-seq
MIRT2248692	hsa-miR-1254	CLIP-seq
MIRT2016445	hsa-miR-1255a	CLIP-seq
MIRT2016446	hsa-miR-1255b	CLIP-seq
MIRT2552287	hsa-miR-125a-3p	CLIP-seq
MIRT2552290	hsa-miR-1271	CLIP-seq
MIRT2552291	hsa-miR-1279	CLIP-seq
MIRT2248694	hsa-miR-129-5p	CLIP-seq
MIRT1067796	hsa-miR-1298	CLIP-seq
MIRT1067797	hsa-miR-1304	CLIP-seq
MIRT1067798	hsa-miR-135a	CLIP-seq
MIRT1067799	hsa-miR-135b	CLIP-seq
MIRT2248695	hsa-miR-1470	CLIP-seq
MIRT1067800	hsa-miR-150	CLIP-seq
MIRT1067802	hsa-miR-15a	CLIP-seq
MIRT1067803	hsa-miR-15b	CLIP-seq
MIRT1067804	hsa-miR-16	CLIP-seq
MIRT2552293	hsa-miR-181a	CLIP-seq
MIRT2552294	hsa-miR-181b	CLIP-seq
MIRT2552295	hsa-miR-181c	CLIP-seq
MIRT2552296	hsa-miR-181d	CLIP-seq
MIRT2552297	hsa-miR-182	CLIP-seq
MIRT2016448	hsa-miR-185	CLIP-seq
MIRT2552298	hsa-miR-186	CLIP-seq
MIRT1067806	hsa-miR-18a	CLIP-seq
MIRT1067807	hsa-miR-18b	CLIP-seq
MIRT1067808	hsa-miR-195	CLIP-seq
MIRT2451885	hsa-miR-205	CLIP-seq
MIRT2552299	hsa-miR-208a	CLIP-seq
MIRT2552300	hsa-miR-208b	CLIP-seq
MIRT2016449	hsa-miR-2116	CLIP-seq
MIRT1067810	hsa-miR-218	CLIP-seq
MIRT1067812	hsa-miR-2355-5p	CLIP-seq
MIRT2552302	hsa-miR-2467-3p	CLIP-seq
MIRT1067813	hsa-miR-2467-5p	CLIP-seq
MIRT1067817	hsa-miR-3065-5p	CLIP-seq
MIRT2248698	hsa-miR-3116	CLIP-seq
MIRT2248699	hsa-miR-3127-3p	CLIP-seq
MIRT2552303	hsa-miR-3133	CLIP-seq
MIRT1067821	hsa-miR-3152-3p	CLIP-seq
MIRT2451886	hsa-miR-3157-5p	CLIP-seq
MIRT2552304	hsa-miR-3163	CLIP-seq
MIRT1067823	hsa-miR-3177-5p	CLIP-seq
MIRT1067824	hsa-miR-3183	CLIP-seq
MIRT2552305	hsa-miR-3185	CLIP-seq
MIRT1067825	hsa-miR-3188	CLIP-seq
MIRT2552307	hsa-miR-329	CLIP-seq
MIRT1067830	hsa-miR-330-3p	CLIP-seq
MIRT2552308	hsa-miR-339-5p	CLIP-seq
MIRT1067835	hsa-miR-3609	CLIP-seq
MIRT2248707	hsa-miR-3613-3p	CLIP-seq
MIRT2552310	hsa-miR-362-3p	CLIP-seq
MIRT2016453	hsa-miR-3653	CLIP-seq
MIRT2552311	hsa-miR-3658	CLIP-seq
MIRT2248710	hsa-miR-3664-3p	CLIP-seq
MIRT2552313	hsa-miR-3667-5p	CLIP-seq
MIRT2016454	hsa-miR-3670	CLIP-seq
MIRT2552314	hsa-miR-3678-3p	CLIP-seq
MIRT2552315	hsa-miR-3690	CLIP-seq
MIRT2552317	hsa-miR-377	CLIP-seq
MIRT2552318	hsa-miR-382	CLIP-seq
MIRT2552320	hsa-miR-3912	CLIP-seq
MIRT1067895	hsa-miR-3915	CLIP-seq
MIRT1067896	hsa-miR-3928	CLIP-seq
MIRT2552321	hsa-miR-3938	CLIP-seq
MIRT2552322	hsa-miR-3941	CLIP-seq
MIRT2016455	hsa-miR-3942-5p	CLIP-seq
MIRT1067842	hsa-miR-3975	CLIP-seq
MIRT1067843	hsa-miR-410	CLIP-seq
MIRT1067844	hsa-miR-424	CLIP-seq
MIRT2552323	hsa-miR-4254	CLIP-seq
MIRT2016456	hsa-miR-4258	CLIP-seq
MIRT2552324	hsa-miR-4262	CLIP-seq
MIRT2016457	hsa-miR-4268	CLIP-seq
MIRT2552325	hsa-miR-4274	CLIP-seq
MIRT1067846	hsa-miR-4279	CLIP-seq
MIRT2552326	hsa-miR-4286	CLIP-seq
MIRT2552327	hsa-miR-4304	CLIP-seq
MIRT2016458	hsa-miR-4306	CLIP-seq
MIRT2552329	hsa-miR-433	CLIP-seq
MIRT2248723	hsa-miR-4422	CLIP-seq
MIRT2016462	hsa-miR-4428	CLIP-seq
MIRT2552330	hsa-miR-4446-5p	CLIP-seq
MIRT2248725	hsa-miR-4469	CLIP-seq
MIRT2552332	hsa-miR-4470	CLIP-seq
MIRT2016464	hsa-miR-4476	CLIP-seq
MIRT2552333	hsa-miR-4514	CLIP-seq
MIRT1067897	hsa-miR-4517	CLIP-seq
MIRT2552334	hsa-miR-4522	CLIP-seq
MIRT1067854	hsa-miR-4524	CLIP-seq
MIRT2016467	hsa-miR-4525	CLIP-seq
MIRT2552335	hsa-miR-4532	CLIP-seq
MIRT2016468	hsa-miR-4533	CLIP-seq
MIRT2016470	hsa-miR-4644	CLIP-seq
MIRT2552336	hsa-miR-4649-5p	CLIP-seq
MIRT2248729	hsa-miR-4666-5p	CLIP-seq
MIRT2248730	hsa-miR-4667-3p	CLIP-seq
MIRT2451887	hsa-miR-4668-3p	CLIP-seq
MIRT1067898	hsa-miR-4689	CLIP-seq
MIRT2552340	hsa-miR-4692	CLIP-seq
MIRT2552341	hsa-miR-4694-3p	CLIP-seq
MIRT2016472	hsa-miR-4699-3p	CLIP-seq
MIRT2016473	hsa-miR-4703-5p	CLIP-seq
MIRT1067857	hsa-miR-4709-3p	CLIP-seq
MIRT2552342	hsa-miR-4712-3p	CLIP-seq
MIRT2016475	hsa-miR-4713-5p	CLIP-seq
MIRT2016476	hsa-miR-4716-3p	CLIP-seq
MIRT2552343	hsa-miR-4717-5p	CLIP-seq
MIRT2552344	hsa-miR-4718	CLIP-seq
MIRT1067861	hsa-miR-4723-3p	CLIP-seq
MIRT2016477	hsa-miR-4731-3p	CLIP-seq
MIRT1067862	hsa-miR-4733-3p	CLIP-seq
MIRT2248734	hsa-miR-4733-5p	CLIP-seq
MIRT1067863	hsa-miR-4735-3p	CLIP-seq
MIRT2552346	hsa-miR-4742-3p	CLIP-seq
MIRT1067864	hsa-miR-4757-5p	CLIP-seq
MIRT2451888	hsa-miR-4758-3p	CLIP-seq
MIRT1067865	hsa-miR-4762-3p	CLIP-seq
MIRT2016478	hsa-miR-4780	CLIP-seq
MIRT2016479	hsa-miR-4801	CLIP-seq
MIRT1067869	hsa-miR-485-5p	CLIP-seq
MIRT2248739	hsa-miR-490-5p	CLIP-seq
MIRT1067871	hsa-miR-497	CLIP-seq
MIRT2552348	hsa-miR-499-5p	CLIP-seq
MIRT2451889	hsa-miR-500a	CLIP-seq
MIRT1067872	hsa-miR-503	CLIP-seq
MIRT2016480	hsa-miR-507	CLIP-seq
MIRT2552349	hsa-miR-510	CLIP-seq
MIRT2552350	hsa-miR-513a-3p	CLIP-seq
MIRT2248744	hsa-miR-520d-5p	CLIP-seq
MIRT2248745	hsa-miR-524-5p	CLIP-seq
MIRT2016481	hsa-miR-532-3p	CLIP-seq
MIRT2552354	hsa-miR-532-5p	CLIP-seq
MIRT2016483	hsa-miR-545	CLIP-seq
MIRT1067875	hsa-miR-548aa	CLIP-seq
MIRT1067876	hsa-miR-548ah	CLIP-seq
MIRT2552355	hsa-miR-548b-3p	CLIP-seq
MIRT2451890	hsa-miR-548c-3p	CLIP-seq
MIRT1067877	hsa-miR-548t	CLIP-seq
MIRT2016485	hsa-miR-556-5p	CLIP-seq
MIRT2016486	hsa-miR-557	CLIP-seq
MIRT2016487	hsa-miR-580	CLIP-seq
MIRT2552357	hsa-miR-583	CLIP-seq
MIRT1067885	hsa-miR-603	CLIP-seq
MIRT1067888	hsa-miR-630	CLIP-seq
MIRT1067889	hsa-miR-636	CLIP-seq
MIRT2016489	hsa-miR-642b	CLIP-seq
MIRT1067890	hsa-miR-646	CLIP-seq
MIRT2248748	hsa-miR-670	CLIP-seq
MIRT2552360	hsa-miR-7	CLIP-seq
MIRT2248749	hsa-miR-873	CLIP-seq
MIRT2552362	hsa-miR-96	CLIP-seq
MIRT2451885	hsa-miR-205	CLIP-seq
MIRT1067813	hsa-miR-2467-5p	CLIP-seq
MIRT1067890	hsa-miR-646	CLIP-seq
MIRT2248748	hsa-miR-670	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPA	Activation	8288055
CEBPB	Activation	8288055
ESR2	Repression	22099628
HMGA1	Activation	16707431
HMGA1	Repression	17434141
SP1	Activation	1311316;16707431
SP1	Unknown	7983788

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001540	Function	Amyloid-beta binding	IPI	19406747
GO:0002092	Process	Positive regulation of receptor internalization	IDA	25401701
GO:0003007	Process	Heart morphogenesis	IMP	7693131
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IDA	8496180, 38056462
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IMP	7537849
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0005009	Function	Insulin receptor activity	IBA
GO:0005009	Function	Insulin receptor activity	IDA	6849137, 8440175, 38056462
GO:0005009	Function	Insulin receptor activity	IEA
GO:0005009	Function	Insulin receptor activity	IGI	19727662
GO:0005009	Function	Insulin receptor activity	TAS
GO:0005159	Function	Insulin-like growth factor receptor binding	IDA	8452530
GO:0005198	Function	Structural molecule activity	IDA	1898103
GO:0005515	Function	Protein binding	IPI	7493946, 7537849, 7935368, 8452530, 8702689, 8999839, 9506989, 9593725, 9742218, 10500481, 10660596, 11136729, 11163213, 11279102, 11289049, 11374898, 11506178, 11579209, 11796522, 12237455, 12634852, 14568990, 14722096, 15588987, 15629149, 16271887, 16582879, 16926280, 17092689, 171
GO:0005524	Function	ATP binding	IDA	6849137
GO:0005524	Function	ATP binding	IEA
GO:0005525	Function	GTP binding	IDA	9092559
GO:0005635	Component	Nuclear envelope	IDA	19406747
GO:0005764	Component	Lysosome	IEA
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	6849137
GO:0005886	Component	Plasma membrane	IDA	9092559, 23137377
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005899	Component	Insulin receptor complex	IBA
GO:0005899	Component	Insulin receptor complex	IDA	1898103, 19406747
GO:0005899	Component	Insulin receptor complex	IMP	15069075
GO:0005901	Component	Caveola	IDA	15182363
GO:0005901	Component	Caveola	IEA
GO:0005979	Process	Regulation of glycogen biosynthetic process	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	12881524
GO:0006898	Process	Receptor-mediated endocytosis	ISS	19406747
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	9092559
GO:0007612	Process	Learning	TAS	19188609
GO:0007613	Process	Memory	TAS	19188609
GO:0008284	Process	Positive regulation of cell population proliferation	IC	11500939
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	17925406
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	12138094
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0008286	Process	Insulin receptor signaling pathway	IDA	3518947, 6849137, 8440175, 20455999, 38056462
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IGI	19727662
GO:0008286	Process	Insulin receptor signaling pathway	ISS	19406747
GO:0008286	Process	Insulin receptor signaling pathway	TAS
GO:0008544	Process	Epidermis development	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0009897	Component	External side of plasma membrane	ISS
GO:0010008	Component	Endosome membrane	TAS
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0010906	Process	Regulation of glucose metabolic process	IEA
GO:0016020	Component	Membrane	IDA	8452530
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019904	Function	Protein domain specific binding	IPI	16246733
GO:0030238	Process	Male sex determination	IEA
GO:0030295	Function	Protein kinase activator activity	IMP	9819385
GO:0030325	Process	Adrenal gland development	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	12138094
GO:0030424	Component	Axon	IBA
GO:0030425	Component	Dendrite	ISS	19406747
GO:0031017	Process	Exocrine pancreas development	IEA
GO:0031623	Process	Receptor internalization	IEA
GO:0031981	Component	Nuclear lumen	IDA	19406747
GO:0031994	Function	Insulin-like growth factor I binding	IPI	8452530
GO:0031995	Function	Insulin-like growth factor II binding	IPI	12138094
GO:0032590	Component	Dendrite membrane	ISS
GO:0032809	Component	Neuronal cell body membrane	ISS
GO:0032869	Process	Cellular response to insulin stimulus	IDA	8440175
GO:0038024	Function	Cargo receptor activity	ISS	19406747
GO:0042593	Process	Glucose homeostasis	IBA
GO:0042593	Process	Glucose homeostasis	IMP	7693131
GO:0042802	Function	Identical protein binding	IPI	16957736, 18278056, 26853939
GO:0043025	Component	Neuronal cell body	ISS	19406747
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IGI	19727662
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043235	Component	Receptor complex	IEA
GO:0043243	Process	Positive regulation of protein-containing complex disassembly	ISS	19406747
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	20455999
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	17001305
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	11500939
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IEA
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IPI	7537849, 8276809
GO:0043559	Function	Insulin binding	IDA	8440175
GO:0043559	Function	Insulin binding	IPI	8452530
GO:0043560	Function	Insulin receptor substrate binding	IBA
GO:0043560	Function	Insulin receptor substrate binding	IEA
GO:0043560	Function	Insulin receptor substrate binding	IPI	7493946, 7537849, 7559478
GO:0044297	Component	Cell body	ISS	19406747
GO:0044877	Function	Protein-containing complex binding	IPI	19406747
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IMP	10747347
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	IDA	17925406
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	IEA
GO:0045821	Process	Positive regulation of glycolytic process	IMP	7693131
GO:0045840	Process	Positive regulation of mitotic nuclear division	IEA
GO:0045840	Process	Positive regulation of mitotic nuclear division	IMP	11500939
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045995	Process	Regulation of embryonic development	IMP	7693131
GO:0046326	Process	Positive regulation of D-glucose import	IDA	3518947
GO:0046326	Process	Positive regulation of D-glucose import	NAS	11001060
GO:0046718	Process	Symbiont entry into host cell	IMP	17001305
GO:0046777	Process	Protein autophosphorylation	IMP	7537849
GO:0048513	Process	Animal organ development	IEA
GO:0048639	Process	Positive regulation of developmental growth	IMP	7693131
GO:0048731	Process	System development	IEA
GO:0051130	Process	Positive regulation of cellular component organization	IEA
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0051425	Function	PTB domain binding	IPI	7559478
GO:0051446	Process	Positive regulation of meiotic cell cycle	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	7556070
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	11500939
GO:0060267	Process	Positive regulation of respiratory burst	IDA	9092559
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0097062	Process	Dendritic spine maintenance	ISS	19406747
GO:0097242	Process	Amyloid-beta clearance	ISS	19406747
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1990535	Process	Neuron projection maintenance	ISS
GO:2000194	Process	Regulation of female gonad development	IEA

Other IDs

• MIM: 147670
• HGNC: 6091
• e!Ensembl: ENSG00000171105

Protein

• UniProt ID: P06213
• Protein name: Insulin receptor (IR) (EC 2.7.10.1) (CD antigen CD220) [Cleaved into: Insulin receptor subunit alpha; Insulin receptor subunit beta]
• Protein function: Receptor tyrosine kinase which mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (IRS1, 2, 3, 4), SHC, GAB1, CBL and other signali
• PDB: 1GAG, 1I44, 1IR3, 1IRK, 1P14, 1RQQ, 2AUH, 2B4S, 2HR7, 2MFR, 2Z8C, 3BU3, 3BU5, 3BU6, 3EKK, 3EKN, 3ETA, 3W11, 3W12, 3W13, 4IBM, 4OGA, 4XLV, 4XSS, 4XST, 4ZXB, 5E1S, 5HHW, 5J3H, 5KQV, 5U1M, 6HN4, 6HN5, 6PXV, 6PXW, 6SOF, 6VEP, 6VEQ, 7BW7, 7BW8, 7BWA, 7KD6, 7MQO, 7MQR, 7MQS, 7PG0, 7PG2, 7PG3, 7PG4, 7PHT, 7QID
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01030	Recep_L_domain	52 → 164	Receptor L domain	Repeat
  PF00757	Furin-like	179 → 340	Furin-like cysteine rich region	Domain
  PF01030	Recep_L_domain	359 → 473	Receptor L domain	Repeat
  PF17870	Insulin_TMD	940 → 987	Insulin receptor trans-membrane segment	Domain
  PF07714	PK_Tyr_Ser-Thr	1023 → 1290	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform Long and isoform Short are predominantly expressed in tissue targets of insulin metabolic effects: liver, adipose tissue and skeletal muscle but are also expressed in the peripheral nerve, kidney, pulmonary alveoli, pancreatic
• Sequence:

  MATGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
  QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
  VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
  ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
  GNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQG
  CHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
  TVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
  EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
  RNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
  NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
  DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
  RQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQIL
  KELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAF
  PNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYV
  SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCV
  SRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIG
  PLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSR
  EKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKG
  FTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMA
  AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
  RWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN
  CPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEME
  FEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSN
  PS

• Sequence length: 1382

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
46,XY disorder of sex development	Likely pathogenic	rs2512389876	RCV003126299	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Gastric cancer	Likely pathogenic	rs2512363368	RCV005932734	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hyperinsulinism due to INSR deficiency	Pathogenic; Likely pathogenic	rs797045624, rs121913148, rs121913156, rs1599937180	RCV000194300 RCV002496377 RCV000125461 RCV002291289	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
INSR-related disorder	Likely pathogenic	rs2512519713	RCV004529819	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Insulin resistance	Pathogenic; Likely pathogenic	rs121913139, rs1568426700	RCV000015802 RCV000755004	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Insulin-resistant diabetes mellitus	Pathogenic	rs121913142	RCV000015805	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Insulin-resistant diabetes mellitus AND acanthosis nigricans	Pathogenic; Likely pathogenic	rs121913135, rs121913140, rs121913138, rs121913139, rs121913144, rs121913146, rs121913148, rs121913154, rs121913156	RCV000015793 RCV000015797 RCV000015798 RCV000015801 RCV000128412 RCV000015809 RCV000015812 RCV000015819 RCV000015823	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Leprechaunism syndrome	Likely pathogenic; Pathogenic	rs2512363368, rs1972802448, rs267607184, rs121913137, rs387906538, rs121913141, rs121913145, rs121913148, rs52836744, rs121913151, rs121913152, rs121913153, rs121913155, rs121913158, rs121913159, rs121913160, rs1967766760	RCV003389275 RCV003389276 RCV000015795 RCV000015796 RCV000015800 RCV000015804 RCV000015808 RCV002496377 RCV000015814 RCV000015816 RCV000015817 RCV000015818 RCV000015820 RCV000015825 RCV000015826 RCV000015829 RCV001172282	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Rabson-Mendenhall syndrome	Likely pathogenic; Pathogenic	rs1967775472, rs886037750, rs121913143, rs121913144, rs121913148, rs587776819, rs587776820	RCV004821005 RCV000240670 RCV000015806 RCV000015807 RCV002496377 RCV000015827 RCV000015828	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Type 2 diabetes mellitus	Pathogenic	rs121913150	RCV000015815	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bailey-Bloch congenital myopathy	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEAR CELL RENAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
DIABETES MELLITUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-RESISTANT, WITH ACANTHOSIS NIGRICANS	—	CTD, HPO CTD, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DONOHUE SYNDROME	—	CTD, Disgenet, GWAS catalog, HPO, Orphanet CTD, Disgenet, GWAS catalog, HPO, Orphanet CTD, Disgenet, GWAS catalog, HPO, Orphanet CTD, Disgenet, GWAS catalog, HPO, Orphanet CTD, Disgenet, GWAS catalog, HPO, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal atresia	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERINSULINEMIC HYPOGLYCEMIA, FAMILIAL, 5	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERINSULINISM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERINSULINISM DUE TO INSULIN RECEPTOR DEFICIENCY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE - TYPE A	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANT DIABETES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Monogenic diabetes	Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTINODULAR GOITER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyloric stenosis	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC NODULAR GOITER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Ablepharon macrostomia syndrome	Ablepharon macrostomia syndrome	Pubtator	26637991	Associate	★☆☆☆☆ Found in Text Mining only
Acanthosis Nigricans	Acanthosis Nigricans	BEFREE	11595827, 12107746, 12452857, 15232309, 1588128, 2180980, 23824322, 2544997, 27505086, 29411486, 31827016, 8175972		★☆☆☆☆ Found in Text Mining only
Acanthosis Nigricans	Acanthosis Nigricans	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	24055495		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	2741924		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19688775, 24571613, 25102778, 26026165		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	25102778		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26263910		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	21062411, 24194259		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	17416760, 25102778		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	8252754		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	40038716	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22476197, 24731980, 29851783, 30922963, 37264161	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	24055495		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	24055495		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	24055495		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	24055495		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	15033922, 29572520		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28360038		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18672019, 21984580, 23958265, 27905925, 28752048, 28899902, 29201918, 29463262		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28583713		★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	23263486		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	32512817	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asymmetric Diabetic Proximal Motor Neuropathy	Asymmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	18331706		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18672019, 21647535, 21984580, 23958265, 27905925, 28752048, 28899902, 29201918, 29463262		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	27729247	Associate	★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	17506723		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	35165256	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	27483248		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	29484150		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	1719540	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Pancreatitis	Autoimmune pancreatitis	Pubtator	28151472	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	20888662		★☆☆☆☆ Found in Text Mining only
Bardet-Biedl Syndrome	Bardet-Biedl Syndrome	BEFREE	26103456		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	35654816	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29129118		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	35165256	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28295307		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	25042561	Associate	★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	32651463	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15173073, 31480400		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10229198, 15509777, 1617668, 16707431, 17348446, 17361103, 21062411, 2152773, 21908557, 21913804, 22046260, 2253226, 22573715, 23562473, 24497996, 26276395, 26385458, 26406954, 26876199, 27765041, 28030849, 28038446, 28468775, 29234306, 29330302, 29486734, 29685905, 30168485, 30206202, 30457165, 8518410, 8665514, 9413807, 9615787		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16491398, 17043687, 17348446, 21913804, 22046260, 22128190, 22551578, 26077721, 26324738, 26406954, 26896340, 27415018, 28030849, 28038446, 28591735, 29114882, 29486734, 30168485, 30457165, 31771180, 32733384, 34841688, 35672854, 36882607, 37239973, 38036052	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17348446	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29114882	Stimulate	★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	26452103		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	2664477, 2674026		★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37873683	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19688775, 21062411		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	37185612	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10764799, 12918099, 2469133, 26756219, 27514687, 36031387	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	29669935	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28295307		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24571613, 25820822, 26113601, 28592245, 29610318		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34202040	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24954312, 30852945, 32716909, 34545095	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12193537, 28436941		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	37967988	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18672019, 28752048, 31319588		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Carnitine Palmitoyltransferase II Deficiency Infantile	Carnitine palmitoyltransferase deficiency	Pubtator	37974153	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	26123480		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	26123480	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	17506723	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	LHGDN	17556377		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	18337634		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21307146, 21427241		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	35676670	Associate	★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	17443497		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	22629383	Stimulate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28673577, 28812049		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15247132, 17914103, 18192692, 24175768, 25557790, 26077721, 30137286, 30680065, 31666286		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17914103		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24175768, 24484717, 25342389, 25557790, 26077721, 27138191, 31666286, 34083590, 37475862	Associate	★☆☆☆☆ Found in Text Mining only
Compensatory Hyperinsulinemia	Compensatory Hyperinsulinemia	CTD_human_DG	10949030, 18411068		★☆☆☆☆ Found in Text Mining only
Compensatory Hyperinsulinemia	Compensatory Hyperinsulinemia	BEFREE	27768789, 30453495		★☆☆☆☆ Found in Text Mining only
Complement component 5 deficiency	Complement Component Deficiency	BEFREE	31084499		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	CTD_human_DG	21433279		★☆☆☆☆ Found in Text Mining only
Congenital exomphalos	Congenital Exomphalos	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Fiber Type Disproportion	Congenital myopathy with fiber type disproportion	BEFREE	10844410		★☆☆☆☆ Found in Text Mining only
Congenital hernia of foramen of Bochdalek	Posterolateral diaphragmatic hernia	CTD_human_DG	21433279		★☆☆☆☆ Found in Text Mining only
Congenital hernia of foramen of Morgagni	Morgagni diaphragmatic hernia	CTD_human_DG	21433279		★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Hyperinsulinemic hypoglycemia	BEFREE	15161766, 15868462, 25753915, 29589989		★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	25404386, 25753915, 31989990, 37974153	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Hyperinsulinemic hypoglycemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	22768670, 28381504, 29115626		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28393204		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	22323484		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21700086		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21700086, 23216712		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	21700086		★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	19720790	Associate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	16210778		★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	19638714	Stimulate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30278200		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	32536688	Associate	★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	24173542		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10844410, 12765968, 1316361, 15114529, 15118262, 15222748, 1683636, 17563065, 18672019, 19017805, 19931251, 2002058, 20841312, 21913804, 22775283, 22928576, 23059533, 24334605, 2544997, 2544998, 2566545, 2573522, 26322622, 26387534, 26921319, 27704165, 28034763, 28168960, 28192884, 28346406, 28646158, 28886276, 28925477, 28973479, 29201918, 29435980, 29496905, 29512653, 30131712, 30201849, 30356040, 30367392, 30453495, 30747102, 3234633, 7050215, 8395436, 8550844, 8712800, 9388499		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	31588494	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	21515851, 26921319, 33776919, 34969688	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10844410, 11887975, 12765968, 1316361, 15114529, 15118262, 15222748, 1683636, 17275003, 17563065, 18672019, 19017805, 19931251, 2002058, 20841312, 21913804, 22775283, 22928576, 23059533, 23216712, 24334605, 2544997, 2544998, 2566545, 2573522, 26322622, 26387534, 26921319, 27704165, 28034763, 28168960, 28192884, 28346406, 28646158, 28886276, 28925477, 28973479, 29201918, 29435980, 29486734, 29496905, 29512653, 30131712, 30201849, 30356040, 30367392, 30453495, 30747102, 31693730, 3234633, 7050215, 7714091, 8395436, 8550844, 8712800, 9120013, 9388499		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	11887975, 14551916, 15114529, 1602013, 18599527, 2002058, 20339196, 21913804, 2211678, 24289561, 2573522, 26921319, 27125830, 27138191, 28034763, 29486734, 30457165, 31882596, 31989990, 33761612, 33776919, 34969688, 35634501, 35742925, 37158952, 37897565, 38408297, 38527457, 8900242	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	25825816	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	34831154	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Transient Neonatal 1	Diabetes mellitus transient neonatal	Pubtator	37897565, 38408297	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	2573522, 33761612, 33776919, 35742925	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	15166380, 1602013, 16127220, 1711209, 1918382, 25867326, 27138191, 2888698, 28934129, 29754174, 31714576, 33801830, 34784930, 34875679, 35742925, 36504295, 38003949, 38202781, 39201651, 7681983, 8900242	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36018759	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11956956, 1521731, 15586390, 15610610, 1683636, 1978826, 2205528, 2824266, 28938465, 30809106, 3234633, 7050215, 8359580, 8721774		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Resistant, with Acanthosis Nigricans	Diabetes Mellitus With Acanthosis Nigricans	UNIPROT_DG	10733238, 11260230, 12107746, 12970295, 1563582, 1963473, 2002058, 2168397, 2365819, 2544998, 28765322, 3283938, 8243830, 8288049, 8314008, 8388389, 9175790		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Resistant, with Acanthosis Nigricans	Diabetes Mellitus With Acanthosis Nigricans	ORPHANET_DG	20339196, 8288049		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Resistant, with Acanthosis Nigricans	Diabetes Mellitus With Acanthosis Nigricans	GENOMICS_ENGLAND_DG	8288049		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Resistant, with Acanthosis Nigricans	Diabetes Mellitus With Acanthosis Nigricans	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Resistant, with Acanthosis Nigricans	Diabetes Mellitus With Acanthosis Nigricans	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10025399, 10078569, 10084586, 10389840, 10395191, 11189234, 11256583, 11258596, 11440917, 11679436, 11747141, 11872698, 12213887, 12519871, 12624425, 12765939, 1301912, 1327927, 1348997, 14710358, 1499871, 15127203, 15166380, 1521731, 15314154, 15581831, 1563582, 15924147, 1607076, 16127220, 16278247, 16603055, 1671379, 1676686, 1683636, 1711209, 18267303, 18566589, 18925540, 1918382, 1968373, 19752219, 1978826, 2040394, 2065860, 21364139, 21700086, 21984580, 22140505, 22661254, 22775283, 22928576, 23303383, 24289561, 24447396, 25460725, 2562831, 2566545, 2568958, 25742416, 25867326, 25959789, 26079428, 2620783, 26251103, 26620983, 2684714, 27172814, 27526875, 27577745, 27797911, 27932386, 28117222, 2824266, 2834824, 28432201, 28673577, 2878850, 2892607, 2899037, 2906902, 29071522, 29186763, 29453154, 29610268, 29747813, 29777831, 29896157, 29971619, 30060600, 30062661, 30249002, 30250231, 30300385, 30562745, 30586741, 30714526, 30754657, 30773997, 30780108, 30964398, 31028829, 31378829, 31391336, 31658625, 31676315, 3898768, 7657032, 7681983, 7683288, 7684396, 7775636, 7814014, 7821730, 8083370, 8263133, 8344133, 8432414, 8481401, 8635675, 8636366, 8712800, 8721774, 8739921, 8899294, 8900242, 9472957		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	UNIPROT_DG	1470163, 1607076, 7657032		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Amyotrophy	Diabetic Amyotrophy	CTD_human_DG	18331706		★☆☆☆☆ Found in Text Mining only
Diabetic Asymmetric Polyneuropathy	Diabetic Asymmetric Polyneuropathy	CTD_human_DG	18331706		★☆☆☆☆ Found in Text Mining only
Diabetic Autonomic Neuropathy	Diabetic Autonomic Neuropathy	CTD_human_DG	18331706		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	37986298	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic Ketoacidosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetic Mononeuropathy	Diabetic Mononeuropathy	CTD_human_DG	18331706		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	25867326, 35721731	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	23059533, 25754093, 25867326, 31217420		★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	CTD_human_DG	18331706		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	CTD_human_DG	18331706		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	30742965, 31758725		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Polyneuropathies	Diabetic polyneuropathy	CTD_human_DG	18331706		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27768789, 31025213		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	30922963	Associate	★☆☆☆☆ Found in Text Mining only
Donohue Syndrome	Leprechaunism syndrome	BEFREE	10443650, 12023989, 12538626, 12970295, 1306516, 1316988, 15610610, 1607067, 18302477, 18411068, 1931997, 1968373, 19774849, 20033851, 2157428, 22768670, 22972224, 23229189, 2365819, 23824322, 25153212, 25465274, 2562832, 2569023, 2574533, 26160152, 26691667, 26871809, 26874853, 26974131, 27840822, 28181734, 2834824, 28803747, 29082893, 29695048, 3029156, 3631076, 3883764, 7535732, 7536883, 7538143, 7550226, 7693131, 7815442, 7859597, 7962321, 8101305, 8188715, 8532629, 8606887, 8636294, 8702527, 8881457, 9112018, 9249867		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Donohue Syndrome	Leprechaunism syndrome	UNIPROT_DG	12023989, 12538626, 12970295, 1607067, 1730625, 22768670, 2365819, 24498630, 2479553, 2834824, 28765322, 7538143, 7815442, 8188715, 8326490, 8419945, 8636294, 9249867, 9299395, 9703342		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Donohue Syndrome	Leprechaunism syndrome	ORPHANET_DG	12023989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Donohue Syndrome	Leprechaunism syndrome	GENOMICS_ENGLAND_DG	15161766, 8288049		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Donohue Syndrome	Donohue syndrome	Pubtator	18302477, 20033851, 20339196, 22563226, 22972224, 2300553, 2365819, 25153212, 26871809, 27840822, 2808704, 28663160, 29082893, 31677333, 3280314, 34718628, 34965699, 35110500, 3631076, 36626508, 3883764, 7738565, 7815442, 8326490	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Donohue Syndrome	Leprechaunism syndrome	CTD_human_DG	18411068		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Donohue Syndrome	Leprechaunism syndrome	CLINVAR_DG	24498630, 26874853		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Donohue Syndrome	Donohue syndrome	Pubtator	25811318	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dwarfism	Dwarfism	BEFREE	26871809		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	25644898		★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	BEFREE	26974131		★☆☆☆☆ Found in Text Mining only
Dysmorphism	Dysmorphism	BEFREE	18411068		★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	15114529, 15715684, 16876389, 19326042, 19345584, 22520280		★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	25623440		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	28117222		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	37873683	Associate	★☆☆☆☆ Found in Text Mining only
Endogenous Hyperinsulinism	Endogenous Hyperinsulinism	CTD_human_DG	10949030, 18411068		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	27088794		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	23950881, 30426831		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	27088794		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	17233921, 33622671	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	19878940		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	20624623		★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	25458098	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28436941		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36461008	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	15485753, 28117222, 7913431, 8104754, 8301111, 8523386, 9247738		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN RESISTANCE	Estrogen Resistance	BEFREE	27765041		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	25609059		★☆☆☆☆ Found in Text Mining only
Exogenous Hyperinsulinism	Exogenous Hyperinsulinism	CTD_human_DG	10949030, 18411068		★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	24055495		★☆☆☆☆ Found in Text Mining only
Familial generalized lipodystrophy	Lipodystrophy	BEFREE	20097706, 26273324, 2903867, 7829633		★☆☆☆☆ Found in Text Mining only
Familial Partial Lipodystrophy, Type 2	Partial Lipodystrophy	BEFREE	2903867, 7829633		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	22482891		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	22482891		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	12242462, 21810932, 21979150, 30642871, 30819264		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	31888241	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	20888662, 23147115, 30826467		★☆☆☆☆ Found in Text Mining only
Female Pseudohermaphroditism	Female Pseudohermaphroditism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	12937923		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28468951		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Gastro-enteropancreatic neuroendocrine tumor	Digestive system neuroendocrine neoplasm	BEFREE	26836610		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	24133624, 28760855		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	24133624	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	24173542		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26561558		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26561558		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12539153, 28138037		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34964902, 35225010	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	29084810		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	23263486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves Disease	BEFREE	29168473		★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	19720790, 37897565	Associate	★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	22664743		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	39619326	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	22768670, 28381504		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	11078721, 11146233		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	BEFREE	9746224		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	10804539, 1623148, 25586784, 27505086, 28522293, 7990713, 8175972		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	LHGDN	18556968		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	29442075		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	11443207, 11887975, 16216265, 16278247, 18411068, 23047930, 26179126, 2687060, 26871809, 27322100, 28243682, 28262212, 28267671, 28397090, 28624040, 29029025, 29300910, 29496905, 29562229, 29735266, 31309261, 31378829, 31396301, 6371526, 7821730, 7867639, 8617880, 8900242		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	CTD_human_DG	18056790		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	Pubtator	22266116, 36626508, 8900242	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinemic hypoglycemia	Hyperinsulinemic hypoglycemia	BEFREE	15161766, 19170714, 25753915		★☆☆☆☆ Found in Text Mining only
Hyperinsulinemic hypoglycemia	Hyperinsulinemic hypoglycemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperinsulinemic Hypoglycemia, Familial, 5	Hyperinsulinemic hypoglycemia	UNIPROT_DG	15161766		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinemic Hypoglycemia, Familial, 5	Hyperinsulinemic hypoglycemia	ORPHANET_DG	15161766		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinemic Hypoglycemia, Familial, 5	Hyperinsulinemic hypoglycemia	GENOMICS_ENGLAND_DG	8288049		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinemic Hypoglycemia, Familial, 5	Hyperinsulinemic hypoglycemia	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinemic Hypoglycemia, Familial, 5	Hyperinsulinemic hypoglycemia	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	BEFREE	10066387, 10707036, 15868462, 16569742, 17210722, 17416760, 17560154, 17785698, 18411068, 18752648, 19581418, 19720790, 22399297, 23633480, 23824322, 24068609, 24103803, 2566545, 2687060, 26871809, 27435064, 27911591, 27930980, 28092375, 28271502, 28393204, 28397090, 28852804, 28938465, 29411486, 29710660, 29777831, 30218961, 30451856, 30798001, 31088290, 31309261, 31794259, 7584931, 7836517, 8083370, 8635675, 8636366, 9240761, 9388499, 9486982		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	CTD_human_DG	10949030, 18411068		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	LHGDN	18535540		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	Pubtator	20339196, 24484717, 34841688, 7584931, 9240761, 9486982	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	Pubtator	26896340	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism due to INSR deficiency	Hyperinsulinism	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hyperkeratosis	Hyperkeratosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	27729247	Associate	★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperprolactinemia	LHGDN	18535540		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	10373457	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	7584931, 9240761	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	10933564, 15581831, 22534794, 29289466, 7913431, 8104754, 8740916, 9240761, 9247738		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	15485753		★☆☆☆☆ Found in Text Mining only
Hypertrichosis	HYPERTRICHOSIS	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	23229189		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	23229189		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	22972224	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy of clitoris	Hypertrophy Of Clitoris	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertrophy of nail	Hypertrophy Of Nail	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	15161766, 1727740, 17299733, 25753915, 29411486, 29589989, 30306074, 31156561, 31199472		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	25753915, 33040071, 35110500	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoglycemic coma	Hypoglycemic coma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoglycemic seizures	Hypoglycemic seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASCAT_DG	27182965, 30595370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Impaired cognition	Impaired Cognition	BEFREE	16210778, 22661254, 28673577, 28812049, 29572644, 29736736, 30964050, 31823898		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	HPO_DG			★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	25847845	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	10373457, 10764799, 10819237, 11342531, 11887975, 1315125, 1446650, 15114529, 15380067, 16127220, 17563366, 19164855, 19720790, 2002058, 20339196, 20493471, 20521171, 21318406, 22241293, 22705438, 22971162, 2300553, 2365819, 24447396, 2479553, 25059784, 25153212, 25342129, 25516545, 25627174, 2573522, 25811318, 26262567, 26305227, 26948272, 27840822, 28915272, 29082893, 29469970, 29728363, 30657911, 30901379, 31588494, 31677333, 31771632, 31899992, 31989990, 32100949, 32425888, 32536688, 33040071, 33206859, 33271541, 33682741, 33728347, 3384956, 34946711, 34965699, 34969688, 35110500, 35498407, 35634501, 36018759, 36504295, 36626508, 40105555, 4077982, 6392291, 6480829, 7584931, 7635975, 7815442, 8082780, 8363571, 8387542	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	17986714, 26896340	Stimulate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	8550844, 9120013	Inhibit	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Insulin resistance - type A	Insulin resistance syndrome	BEFREE	11260230, 12970295, 1306516, 1644241, 17785698, 1890161, 19135752, 20591525, 24155250, 24468607, 2544997, 27840822, 29469970, 29695048, 31102683, 3283938, 7860063, 8175972, 8392082, 8890729, 9039330		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin resistance - type A	Insulin resistance syndrome	ORPHANET_DG	20339196, 8288049		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin-resistance syndrome type A	Insulin Resistance Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Insulin-resistant diabetes mellitus	Insulin-resistant diabetes mellitus	BEFREE	1971035, 2544997, 2573522		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Insulin-resistant diabetes mellitus	Insulin-resistant diabetes mellitus	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Insulin-resistant diabetes mellitus	Insulin-resistant diabetes mellitus	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
insulinoma	Insulinoma	BEFREE	25753915, 8635675		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	17001305, 23912867		★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	11443207, 30819264		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	19459784, 31419130		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	11477169, 1457765		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	24954312	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal cleft	Laryngeal cleft	BEFREE	29042286		★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	BEFREE	23637016		★☆☆☆☆ Found in Text Mining only
Leprechaunism	Leprechaunism Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19789352, 31164492, 34619772	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	2741924		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	CTD_human_DG	19276553		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lipoatrophic Diabetes Mellitus	Lipoatrophic Diabetes Mellitus	BEFREE	2903867, 7829633		★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	BEFREE	2903867, 7829633		★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	20097706, 2903867, 30657911, 31102683, 7829633, 8458533		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	30657911	Associate	★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10210639, 11574415, 14976221, 18174283, 1849849, 23633480, 24656929, 2475498, 2543399, 2550426, 28710407, 29933129, 30849481, 31754384		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	40065360	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11574415, 14976221, 1849849, 2475498, 2543399, 2550426, 29610518		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	CTD_human_DG	20438933, 21433279		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	28592245	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31211453	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31211453	Associate	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	38408297	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	9174053		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	9174053		★☆☆☆☆ Found in Text Mining only
Macrostomia	Macrostomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Macrotia	Macrotia	HPO_DG			★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	30103469		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31477685		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	22664743		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	15173073		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10229198, 15509777, 1617668, 16707431, 17348446, 17361103, 21062411, 2152773, 21908557, 21913804, 22046260, 2253226, 22573715, 23562473, 24497996, 26276395, 26385458, 26406954, 26876199, 27765041, 28030849, 28468775, 29234306, 29330302, 29486734, 29685905, 29941485, 30168485, 30206202, 30457165, 8518410, 8665514, 9413807, 9615787		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	23950881, 30426831		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24571613, 25820822, 26113601, 28592245, 29610318		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12193537		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28360038		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18785179, 21204696, 23251408, 23319492, 24809298, 25267499, 26452103, 30165429		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24973425, 25576241, 30989432		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30513575		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28295307		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14710358, 18785179, 19752219, 20154728, 20841312, 23231387, 23251408, 23562473, 24289561, 24338270, 24683100, 24809298, 26026165, 26077721, 26222696, 26406954, 26452103, 26721331, 27088794, 27435064, 28521298, 28760855, 28973479, 29201918, 29330302, 29486622, 29512653, 29518496, 30165429, 30229539, 30453495, 30559346, 30680065, 30934731, 30989432, 31393373, 8034618, 8665514		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16707431, 22551578		★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	2566545, 28803747, 2888698, 3234633		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	12734206, 6381509	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory dysfunction	Memory Disorders	BEFREE	28025042		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30278200		★☆☆☆☆ Found in Text Mining only
Metabolic alkalosis	Metabolic alkalosis	BEFREE	31615897		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	11641236, 12242462, 15868462, 22661254, 26089371, 26387534, 27932386, 28117222, 8612577		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	32898636	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20493471, 22705438, 23515448, 32425888	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	10933564, 18716398, 22705438, 24196191, 26160152, 27368351, 28117222, 28646158, 28858873, 29186763, 29462993, 30586741, 31396301, 31677333		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	11735220, 14624354, 15449251, 16473310		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	15449251	Associate	★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	18455362		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	LHGDN	18455362		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine	Pubtator	18455362	Associate	★☆☆☆☆ Found in Text Mining only
Migrating partial seizures in infancy	Migrating Partial Seizures In Infancy	BEFREE	29442294		★☆☆☆☆ Found in Text Mining only
Monogenic diabetes	Monogenic Diabetes	BEFREE	27271189		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Monogenic diabetes	Monogenic Diabetes	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	30391805	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	26452103		★☆☆☆☆ Found in Text Mining only
Mucolipidosis III Gamma	Mucolipidosis	Pubtator	37897565	Associate	★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis I	Mucopolysaccharidosis	BEFREE	29442294		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23048032	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	3965491		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	10064106		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	11528389, 16862542, 2195130, 23666741, 25476247, 2591962, 27010216, 2877934, 9120013		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	LHGDN	15114529		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	15114529, 15546872, 16946708, 17708420, 20339196, 28915272, 30901379, 9120013	Associate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	15546872, 16946708, 17950578, 20431600, 9120013		★☆☆☆☆ Found in Text Mining only
NAIL DISORDER, NONSYNDROMIC CONGENITAL, 9	Nail Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nail dysplasia	Nail dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neonatal diabetes mellitus	Diabetes Mellitus	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10468998, 11062161, 15753374, 15753986, 17299733, 17416760, 19688775, 1973037, 19902140, 20154728, 20457905, 21068147, 22454254, 23251408, 23633480, 24338270, 25102778, 25797030, 26263910, 26438154, 26452103, 27435064, 28030849, 28095274, 28138037, 28295307, 28393204, 29234306, 29435137, 29910690, 30021864, 30165429, 30260725, 30559346, 31754384, 7504518, 8665514		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	9441865		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	24349301	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27888620, 31419130		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	36835322	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	16210778, 8938265		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	28168960		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	17596878, 20176643, 21839075, 29085434		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19688775, 24289561, 24485233, 24571613, 26113601, 30858179, 30912183, 31419130		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28468951		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11440917, 15118262, 16127220, 1890161, 1968373, 20463885, 20857837, 23637016, 24103803, 2574127, 26179126, 26387534, 26524290, 27322061, 27683310, 27708333, 28034763, 28168960, 2824266, 29201918, 30135311, 30376348, 30453495, 30642871, 30826467, 31028829, 7684396, 7913431, 8530392, 8899294, 9399964		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	16127220, 26305227, 26637991, 26976855, 28034763, 31091445, 33761612, 35970449	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	1563582, 23032149		★☆☆☆☆ Found in Text Mining only
Onychogryposis	Onychogryposis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21324373	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	21751203, 23688189	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	HPO_DG			★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	12193537		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12193537		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30786925	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28360038		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28360038		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20630061, 28360038, 33213062	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	21123448, 29200876		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	CTD_human_DG	19276553		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	8938265		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Partial lipodystrophy	Partial Lipodystrophy	BEFREE	31102683		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35676670	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	8252754		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	10411917, 12477518, 16798275, 17658524, 20493471, 21300347, 21824047, 25303487, 25310961, 26305227, 32425888, 33682741, 33728347, 36139396, 40105555, 7635975, 7920895	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	10804539, 11232039, 11440917, 11522686, 12477518, 14688155, 15240646, 15613682, 1563582, 16510536, 16603055, 16806206, 17658524, 19211708, 19387820, 19926323, 2035966, 20493471, 21082232, 21300347, 21637951, 21645371, 21801267, 22523112, 24947064, 25144631, 25303487, 25310961, 25622255, 26305227, 26721804, 27075719, 27098445, 28522293, 29339197, 31837364, 7635975, 7836517, 7990713, 8456839, 8626868		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	12477518, 15240646, 16510536, 17658524		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	GWASCAT_DG	22885925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	GWASDB_DG	22885925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Precocious Puberty	Precocious puberty	HPO_DG			★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	25516545, 3873110		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	1310491, 3873110		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	16210778		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	24055495		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18785179, 21204696, 23251408, 23319492, 24809298, 25267499, 26452103, 30165429		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	29129118	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18785179		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	21960694		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21983635	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23251408, 30165429	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	30391805, 40430072	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35676670	Associate	★☆☆☆☆ Found in Text Mining only
Rabson-Mendenhall Syndrome	Rabson-Mendenhall Syndrome	BEFREE	10443650, 17201797, 17560154, 17785698, 18411068, 21869538, 22563226, 22876563, 23824322, 23969187, 26691667, 27326825, 28663160, 29082893, 7859597, 8270132, 8314008, 8667867, 9212040, 9299395, 9449692		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Rabson-Mendenhall Syndrome	Rabson-Mendenhall Syndrome	UNIPROT_DG	10443650, 12023989, 17201797, 2121734, 2365819, 28765322, 8314008		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Rabson-Mendenhall Syndrome	Rabson-Mendenhall Syndrome	ORPHANET_DG	17201797, 21869538		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Rabson-Mendenhall Syndrome	Rabson-Mendenhall Syndrome	CTD_human_DG	18411068		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Rabson-Mendenhall syndrome	Rabson-Mendenhall Syndrome	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Rabson-Mendenhall Syndrome	Rabson-Mendenhall Syndrome	CLINVAR_DG	26691667		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Rabson-Mendenhall Syndrome	Rabson-Mendenhall Syndrome	GENOMICS_ENGLAND_DG	8288049		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Reactive hypoglycemia	Reactive hypoglycemia	BEFREE	29411486		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28393204		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	GWASCAT_DG	28598434		★☆☆☆☆ Found in Text Mining only
Renal tubular disorder	Renal Tubular Disorder	BEFREE	23229189		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	28138037, 28646158, 29716918		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	16030497	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	12813019, 18997086		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	22266116	Associate	★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	29435412		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor Predisposition Syndrome 1	Rhabdoid tumor predisposition syndrome	Pubtator	17506723	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	20807811		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25424426, 28583713		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19394958		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	32898636, 35165256, 36310155, 40430072	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	24155906	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28369940		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	15967097	Associate	★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	25266237		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	17075427		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24571613		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35217577	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	29518496		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	12242462, 21810932, 21979150, 23147115, 28301372, 30338914, 30642871, 30819264		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24973425, 25576241, 30989432		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28596683, 30989432, 34554347	Associate	★☆☆☆☆ Found in Text Mining only
Symmetric Diabetic Proximal Motor Neuropathy	Symmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	18331706		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	38225453	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	26921319	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30657911	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30513575		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	30657911	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	25586784		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30513575, 30657911		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	28703219, 38165228	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	30657911	Associate	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	1931997, 27179787, 2808704		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29099049, 36920947	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	25358065		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	12937923, 28324020		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	31509973		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	16030497	Associate	★☆☆☆☆ Found in Text Mining only
Warburg Sjo Fledelius syndrome	Warburg micro syndrome	Pubtator	22341865	Associate	★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	7736897		★☆☆☆☆ Found in Text Mining only