ADIPOQ (adiponectin, C1Q and collagen domain containing)

Gene

• Entrez ID: 9370
• Gene name: Adiponectin, C1Q and collagen domain containing
• Gene symbol: ADIPOQ
• Synonyms (NCBI Gene): ACDC, ACRP30, ADIPQTL1, ADPN, APM-1, APM1, GBP28
• Chromosome: 3
• Chromosome location: 3q27.3
• Summary: This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs876661321	G>T	Risk-factor	Upstream transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT691125	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT691124	hsa-miR-6087	HITS-CLIP	23313552
MIRT691123	hsa-miR-214-5p	HITS-CLIP	23313552
MIRT691122	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT691121	hsa-miR-3656	HITS-CLIP	23313552
MIRT691120	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT691119	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT691118	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT691117	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT691116	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT691115	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT691114	hsa-miR-363-5p	HITS-CLIP	23313552
MIRT691113	hsa-miR-6745	HITS-CLIP	23313552
MIRT691112	hsa-miR-3165	HITS-CLIP	23313552
MIRT691111	hsa-miR-6514-3p	HITS-CLIP	23313552
MIRT691110	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT691109	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT691108	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT691107	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT691106	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT691105	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT691104	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT691103	hsa-miR-3689c	HITS-CLIP	23313552
MIRT691102	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT691101	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT691100	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT691099	hsa-miR-3122	HITS-CLIP	23313552
MIRT691098	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT691097	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT691096	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT732970	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33451320
MIRT733363	hsa-miR-365a-3p	ELISA, Immunoprecipitaion (IP), qRT-PCR	34203452
MIRT733364	hsa-miR-26b-5p	ELISA, Immunoprecipitaion (IP), qRT-PCR	34203452
MIRT733365	hsa-miR-26a-5p	ELISA, Immunoprecipitaion (IP), qRT-PCR	34203452
MIRT733366	hsa-miR-146a-5p	ELISA, Immunoprecipitaion (IP), qRT-PCR	34203452
MIRT732970	hsa-miR-9-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC)	33451320
MIRT691125	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT691124	hsa-miR-6087	HITS-CLIP	23313552
MIRT691123	hsa-miR-214-5p	HITS-CLIP	23313552
MIRT691122	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT691121	hsa-miR-3656	HITS-CLIP	23313552
MIRT691120	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT691119	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT691118	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT691117	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT691116	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT691115	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT691114	hsa-miR-363-5p	HITS-CLIP	23313552
MIRT691113	hsa-miR-6745	HITS-CLIP	23313552
MIRT691112	hsa-miR-3165	HITS-CLIP	23313552
MIRT691111	hsa-miR-6514-3p	HITS-CLIP	23313552
MIRT691110	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT691109	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT691108	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT691107	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT691106	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT691105	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT691104	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT691103	hsa-miR-3689c	HITS-CLIP	23313552
MIRT691102	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT691101	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT691100	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT691099	hsa-miR-3122	HITS-CLIP	23313552
MIRT691098	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT691097	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT691096	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT768807	hsa-miR-101	CLIP-seq
MIRT768808	hsa-miR-1228	CLIP-seq
MIRT768809	hsa-miR-1244	CLIP-seq
MIRT768810	hsa-miR-1252	CLIP-seq
MIRT768811	hsa-miR-1253	CLIP-seq
MIRT768812	hsa-miR-1262	CLIP-seq
MIRT768813	hsa-miR-1273f	CLIP-seq
MIRT768814	hsa-miR-1303	CLIP-seq
MIRT768815	hsa-miR-144	CLIP-seq
MIRT768816	hsa-miR-153	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768818	hsa-miR-199a-3p	CLIP-seq
MIRT768819	hsa-miR-199b-3p	CLIP-seq
MIRT768820	hsa-miR-224	CLIP-seq
MIRT768821	hsa-miR-298	CLIP-seq
MIRT768822	hsa-miR-3119	CLIP-seq
MIRT768823	hsa-miR-3125	CLIP-seq
MIRT768824	hsa-miR-3129-5p	CLIP-seq
MIRT768825	hsa-miR-3153	CLIP-seq
MIRT768826	hsa-miR-3154	CLIP-seq
MIRT768827	hsa-miR-3173-3p	CLIP-seq
MIRT768828	hsa-miR-3192	CLIP-seq
MIRT768829	hsa-miR-3612	CLIP-seq
MIRT768830	hsa-miR-3613-3p	CLIP-seq
MIRT768831	hsa-miR-3672	CLIP-seq
MIRT768832	hsa-miR-371-5p	CLIP-seq
MIRT768833	hsa-miR-371b-5p	CLIP-seq
MIRT768834	hsa-miR-3916	CLIP-seq
MIRT768835	hsa-miR-3926	CLIP-seq
MIRT768836	hsa-miR-3929	CLIP-seq
MIRT768837	hsa-miR-4261	CLIP-seq
MIRT768838	hsa-miR-4311	CLIP-seq
MIRT768839	hsa-miR-4419b	CLIP-seq
MIRT768840	hsa-miR-4428	CLIP-seq
MIRT768841	hsa-miR-4475	CLIP-seq
MIRT768842	hsa-miR-4476	CLIP-seq
MIRT768843	hsa-miR-4478	CLIP-seq
MIRT768844	hsa-miR-448	CLIP-seq
MIRT768845	hsa-miR-4484	CLIP-seq
MIRT768846	hsa-miR-4509	CLIP-seq
MIRT768847	hsa-miR-4517	CLIP-seq
MIRT768848	hsa-miR-4533	CLIP-seq
MIRT768849	hsa-miR-4534	CLIP-seq
MIRT768850	hsa-miR-4539	CLIP-seq
MIRT768851	hsa-miR-4649-3p	CLIP-seq
MIRT768852	hsa-miR-4653-3p	CLIP-seq
MIRT768853	hsa-miR-4668-5p	CLIP-seq
MIRT768854	hsa-miR-4680-5p	CLIP-seq
MIRT768855	hsa-miR-4701-3p	CLIP-seq
MIRT768856	hsa-miR-4714-3p	CLIP-seq
MIRT768857	hsa-miR-4715-5p	CLIP-seq
MIRT768858	hsa-miR-4724-5p	CLIP-seq
MIRT768859	hsa-miR-4744	CLIP-seq
MIRT768860	hsa-miR-4777-3p	CLIP-seq
MIRT768861	hsa-miR-4793-5p	CLIP-seq
MIRT768862	hsa-miR-4797-5p	CLIP-seq
MIRT768863	hsa-miR-485-5p	CLIP-seq
MIRT768864	hsa-miR-490-3p	CLIP-seq
MIRT768865	hsa-miR-508-5p	CLIP-seq
MIRT768866	hsa-miR-542-3p	CLIP-seq
MIRT768867	hsa-miR-548an	CLIP-seq
MIRT768868	hsa-miR-548s	CLIP-seq
MIRT768869	hsa-miR-571	CLIP-seq
MIRT768870	hsa-miR-576-3p	CLIP-seq
MIRT768871	hsa-miR-582-5p	CLIP-seq
MIRT768872	hsa-miR-600	CLIP-seq
MIRT768873	hsa-miR-649	CLIP-seq
MIRT768874	hsa-miR-650	CLIP-seq
MIRT768875	hsa-miR-661	CLIP-seq
MIRT768876	hsa-miR-759	CLIP-seq
MIRT768877	hsa-miR-766	CLIP-seq
MIRT768878	hsa-miR-10a	CLIP-seq
MIRT768879	hsa-miR-10b	CLIP-seq
MIRT768880	hsa-miR-1226	CLIP-seq
MIRT768810	hsa-miR-1252	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768881	hsa-miR-24	CLIP-seq
MIRT768821	hsa-miR-298	CLIP-seq
MIRT768882	hsa-miR-3185	CLIP-seq
MIRT768828	hsa-miR-3192	CLIP-seq
MIRT768883	hsa-miR-339-5p	CLIP-seq
MIRT768829	hsa-miR-3612	CLIP-seq
MIRT768830	hsa-miR-3613-3p	CLIP-seq
MIRT768835	hsa-miR-3926	CLIP-seq
MIRT768836	hsa-miR-3929	CLIP-seq
MIRT768884	hsa-miR-3934	CLIP-seq
MIRT768885	hsa-miR-3945	CLIP-seq
MIRT768886	hsa-miR-4253	CLIP-seq
MIRT768887	hsa-miR-4267	CLIP-seq
MIRT768888	hsa-miR-4284	CLIP-seq
MIRT768838	hsa-miR-4311	CLIP-seq
MIRT768839	hsa-miR-4419b	CLIP-seq
MIRT768889	hsa-miR-4421	CLIP-seq
MIRT768890	hsa-miR-4433	CLIP-seq
MIRT768842	hsa-miR-4476	CLIP-seq
MIRT768843	hsa-miR-4478	CLIP-seq
MIRT768848	hsa-miR-4533	CLIP-seq
MIRT768851	hsa-miR-4649-3p	CLIP-seq
MIRT768852	hsa-miR-4653-3p	CLIP-seq
MIRT768891	hsa-miR-4703-3p	CLIP-seq
MIRT768892	hsa-miR-4709-3p	CLIP-seq
MIRT768893	hsa-miR-4717-5p	CLIP-seq
MIRT768894	hsa-miR-4722-5p	CLIP-seq
MIRT768895	hsa-miR-4733-3p	CLIP-seq
MIRT768896	hsa-miR-4768-3p	CLIP-seq
MIRT768897	hsa-miR-4786-5p	CLIP-seq
MIRT768863	hsa-miR-485-5p	CLIP-seq
MIRT768864	hsa-miR-490-3p	CLIP-seq
MIRT768898	hsa-miR-499-3p	CLIP-seq
MIRT768899	hsa-miR-499a-3p	CLIP-seq
MIRT768900	hsa-miR-511	CLIP-seq
MIRT768901	hsa-miR-548c-3p	CLIP-seq
MIRT768868	hsa-miR-548s	CLIP-seq
MIRT768902	hsa-miR-570	CLIP-seq
MIRT768874	hsa-miR-650	CLIP-seq
MIRT768903	hsa-miR-665	CLIP-seq
MIRT768904	hsa-miR-890	CLIP-seq
MIRT768905	hsa-miR-9	CLIP-seq
MIRT768906	hsa-miR-940	CLIP-seq
MIRT1920217	hsa-miR-186	CLIP-seq
MIRT1920218	hsa-miR-3133	CLIP-seq
MIRT1920219	hsa-miR-3647-3p	CLIP-seq
MIRT1920220	hsa-miR-577	CLIP-seq
MIRT1926733	hsa-miR-3145-5p	CLIP-seq
MIRT1926734	hsa-miR-3646	CLIP-seq
MIRT1926735	hsa-miR-3682-5p	CLIP-seq
MIRT1926736	hsa-miR-505	CLIP-seq
MIRT1926737	hsa-miR-606	CLIP-seq
MIRT2167691	hsa-miR-1208	CLIP-seq
MIRT768812	hsa-miR-1262	CLIP-seq
MIRT2167692	hsa-miR-1273e	CLIP-seq
MIRT768813	hsa-miR-1273f	CLIP-seq
MIRT2167693	hsa-miR-143	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT2167694	hsa-miR-187	CLIP-seq
MIRT768821	hsa-miR-298	CLIP-seq
MIRT2167695	hsa-miR-302f	CLIP-seq
MIRT1926733	hsa-miR-3145-5p	CLIP-seq
MIRT2167696	hsa-miR-3157-5p	CLIP-seq
MIRT2167697	hsa-miR-3622a-5p	CLIP-seq
MIRT2167698	hsa-miR-3622b-5p	CLIP-seq
MIRT2167699	hsa-miR-3664-3p	CLIP-seq
MIRT2167700	hsa-miR-3908	CLIP-seq
MIRT768835	hsa-miR-3926	CLIP-seq
MIRT768836	hsa-miR-3929	CLIP-seq
MIRT2167701	hsa-miR-3974	CLIP-seq
MIRT768887	hsa-miR-4267	CLIP-seq
MIRT2167702	hsa-miR-4281	CLIP-seq
MIRT768839	hsa-miR-4419b	CLIP-seq
MIRT2167703	hsa-miR-4423-3p	CLIP-seq
MIRT768890	hsa-miR-4433	CLIP-seq
MIRT2167704	hsa-miR-4434	CLIP-seq
MIRT2167705	hsa-miR-4457	CLIP-seq
MIRT2167706	hsa-miR-4459	CLIP-seq
MIRT768843	hsa-miR-4478	CLIP-seq
MIRT2167707	hsa-miR-4516	CLIP-seq
MIRT2167708	hsa-miR-4535	CLIP-seq
MIRT768851	hsa-miR-4649-3p	CLIP-seq
MIRT2167709	hsa-miR-4691-3p	CLIP-seq
MIRT768855	hsa-miR-4701-3p	CLIP-seq
MIRT768891	hsa-miR-4703-3p	CLIP-seq
MIRT2167710	hsa-miR-4708-5p	CLIP-seq
MIRT768894	hsa-miR-4722-5p	CLIP-seq
MIRT768896	hsa-miR-4768-3p	CLIP-seq
MIRT2167711	hsa-miR-4770	CLIP-seq
MIRT2167712	hsa-miR-4776-5p	CLIP-seq
MIRT768897	hsa-miR-4786-5p	CLIP-seq
MIRT768863	hsa-miR-485-5p	CLIP-seq
MIRT768865	hsa-miR-508-5p	CLIP-seq
MIRT2167713	hsa-miR-512-5p	CLIP-seq
MIRT2167714	hsa-miR-513b	CLIP-seq
MIRT768866	hsa-miR-542-3p	CLIP-seq
MIRT768868	hsa-miR-548s	CLIP-seq
MIRT2167715	hsa-miR-597	CLIP-seq
MIRT2167716	hsa-miR-624	CLIP-seq
MIRT768875	hsa-miR-661	CLIP-seq
MIRT768903	hsa-miR-665	CLIP-seq
MIRT2167717	hsa-miR-668	CLIP-seq
MIRT2167718	hsa-miR-711	CLIP-seq
MIRT768877	hsa-miR-766	CLIP-seq
MIRT768904	hsa-miR-890	CLIP-seq
MIRT768906	hsa-miR-940	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768878	hsa-miR-10a	CLIP-seq
MIRT768879	hsa-miR-10b	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768883	hsa-miR-339-5p	CLIP-seq
MIRT2167697	hsa-miR-3622a-5p	CLIP-seq
MIRT768836	hsa-miR-3929	CLIP-seq
MIRT2167702	hsa-miR-4281	CLIP-seq
MIRT2470376	hsa-miR-4293	CLIP-seq
MIRT768839	hsa-miR-4419b	CLIP-seq
MIRT768889	hsa-miR-4421	CLIP-seq
MIRT2167703	hsa-miR-4423-3p	CLIP-seq
MIRT768843	hsa-miR-4478	CLIP-seq
MIRT768851	hsa-miR-4649-3p	CLIP-seq
MIRT2470377	hsa-miR-4684-5p	CLIP-seq
MIRT768863	hsa-miR-485-5p	CLIP-seq
MIRT768900	hsa-miR-511	CLIP-seq
MIRT768901	hsa-miR-548c-3p	CLIP-seq
MIRT2470378	hsa-miR-596	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768878	hsa-miR-10a	CLIP-seq
MIRT768879	hsa-miR-10b	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768821	hsa-miR-298	CLIP-seq
MIRT768828	hsa-miR-3192	CLIP-seq
MIRT768883	hsa-miR-339-5p	CLIP-seq
MIRT768829	hsa-miR-3612	CLIP-seq
MIRT2167697	hsa-miR-3622a-5p	CLIP-seq
MIRT768836	hsa-miR-3929	CLIP-seq
MIRT2167702	hsa-miR-4281	CLIP-seq
MIRT2470376	hsa-miR-4293	CLIP-seq
MIRT768839	hsa-miR-4419b	CLIP-seq
MIRT768889	hsa-miR-4421	CLIP-seq
MIRT2167703	hsa-miR-4423-3p	CLIP-seq
MIRT768843	hsa-miR-4478	CLIP-seq
MIRT2470377	hsa-miR-4684-5p	CLIP-seq
MIRT768863	hsa-miR-485-5p	CLIP-seq
MIRT768864	hsa-miR-490-3p	CLIP-seq
MIRT768900	hsa-miR-511	CLIP-seq
MIRT768901	hsa-miR-548c-3p	CLIP-seq
MIRT2470378	hsa-miR-596	CLIP-seq
MIRT768874	hsa-miR-650	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
PPARG	Activation	20484463
PPARG	Unknown	18373719;19833717
SP1	Activation	12378384
TFAP2B	Repression	19325541

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	18431508
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	ISS	12368907
GO:0005125	Function	Cytokine activity	NAS	12611609
GO:0005179	Function	Hormone activity	IDA	11222466, 18703020
GO:0005179	Function	Hormone activity	IEA
GO:0005201	Function	Extracellular matrix structural constituent	RCA	28675934
GO:0005515	Function	Protein binding	IPI	12070119, 25910212, 31515488, 32296183, 32814053
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IDA	11222466
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005581	Component	Collagen trimer	IEA
GO:0005615	Component	Extracellular space	IDA	10403784, 15585515, 17327472
GO:0005615	Component	Extracellular space	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006006	Process	Glucose metabolic process	ISS	12368907
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	10095105
GO:0006635	Process	Fatty acid beta-oxidation	IEA
GO:0006635	Process	Fatty acid beta-oxidation	ISS	12368907
GO:0007584	Process	Response to nutrient	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0009744	Process	Response to sucrose	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0009749	Process	Response to glucose	ISS	12368907
GO:0009967	Process	Positive regulation of signal transduction	IEA
GO:0009967	Process	Positive regulation of signal transduction	ISS	12368907
GO:0009986	Component	Cell surface	IDA	10982546
GO:0010467	Process	Gene expression	IEA
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	12070119
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	IEA
GO:0010745	Process	Negative regulation of macrophage derived foam cell differentiation	IDA	11222466
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IDA	10604883
GO:0010875	Process	Positive regulation of cholesterol efflux	IDA	18703020
GO:0010906	Process	Regulation of glucose metabolic process	IDA	17327472
GO:0014823	Process	Response to activity	IEA
GO:0019395	Process	Fatty acid oxidation	IEA
GO:0019395	Process	Fatty acid oxidation	ISS
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0030336	Process	Negative regulation of cell migration	ISS
GO:0030853	Process	Negative regulation of granulocyte differentiation	IDA	10961870
GO:0031012	Component	Extracellular matrix	HDA	28675934
GO:0031667	Process	Response to nutrient levels	IEA
GO:0031953	Process	Negative regulation of protein autophosphorylation	IDA	12070119
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	10961870
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	19524870
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0032991	Component	Protein-containing complex	IEA
GO:0033034	Process	Positive regulation of myeloid cell apoptotic process	IDA	10961870
GO:0033211	Process	Adiponectin-activated signaling pathway	IDA	18703020
GO:0033691	Function	Sialic acid binding	IDA	19855092
GO:0034115	Process	Negative regulation of heterotypic cell-cell adhesion	IDA	10604883
GO:0034383	Process	Low-density lipoprotein particle clearance	IDA	11222466
GO:0034612	Process	Response to tumor necrosis factor	IDA	10604883
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS	12368907
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	12021245
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	10982546
GO:0043407	Process	Negative regulation of MAP kinase activity	ISS
GO:0043539	Function	Protein serine/threonine kinase activator activity	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IDA	12021245
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045650	Process	Negative regulation of macrophage differentiation	IDA	10961870
GO:0045721	Process	Negative regulation of gluconeogenesis	IEA
GO:0045721	Process	Negative regulation of gluconeogenesis	ISS	12368907
GO:0045776	Process	Negative regulation of blood pressure	IDA	17327472
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	18431508
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045923	Process	Positive regulation of fatty acid metabolic process	IEA
GO:0045923	Process	Positive regulation of fatty acid metabolic process	ISS	12368907
GO:0046326	Process	Positive regulation of D-glucose import	IEA
GO:0046326	Process	Positive regulation of D-glucose import	ISS	12368907
GO:0046888	Process	Negative regulation of hormone secretion	IEA
GO:0048261	Process	Negative regulation of receptor-mediated endocytosis	IDA	11222466
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0050728	Process	Negative regulation of inflammatory response	NAS	12611609
GO:0050765	Process	Negative regulation of phagocytosis	IDA	10961870
GO:0050805	Process	Negative regulation of synaptic transmission	IDA	17327472
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0050873	Process	Brown fat cell differentiation	ISS
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0060621	Process	Negative regulation of cholesterol import	IDA	11222466
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	12070119
GO:0070543	Process	Response to linoleic acid	IEA
GO:0070994	Process	Detection of oxidative stress	IEA
GO:0070994	Process	Detection of oxidative stress	ISS
GO:0071320	Process	Cellular response to cAMP	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	ISS
GO:0071639	Process	Positive regulation of monocyte chemotactic protein-1 production	IDA	19524870
GO:0071872	Process	Cellular response to epinephrine stimulus	IEA
GO:0072659	Process	Protein localization to plasma membrane	IDA	18431508
GO:0090317	Process	Negative regulation of intracellular protein transport	IDA	18431508
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24531262, 26166748
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	24531262, 26166748
GO:0141163	Process	Positive regulation of cAMP/PKA signal transduction	IDA	10982546
GO:1900121	Process	Negative regulation of receptor binding	IDA	12070119
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IDA	12070119
GO:1904753	Process	Negative regulation of vascular associated smooth muscle cell migration	IDA	12070119
GO:2000279	Process	Negative regulation of DNA biosynthetic process	IDA	12070119
GO:2000467	Process	Positive regulation of glycogen (starch) synthase activity	ISS
GO:2000478	Process	Positive regulation of metanephric podocyte development	IEA
GO:2000478	Process	Positive regulation of metanephric podocyte development	ISS
GO:2000481	Process	Positive regulation of cAMP-dependent protein kinase activity	IDA	18431508, 19524870
GO:2000534	Process	Positive regulation of renal albumin absorption	IDA	18431508
GO:2000534	Process	Positive regulation of renal albumin absorption	IEA
GO:2000584	Process	Negative regulation of platelet-derived growth factor receptor-alpha signaling pathway	IEA
GO:2000584	Process	Negative regulation of platelet-derived growth factor receptor-alpha signaling pathway	ISS
GO:2000590	Process	Negative regulation of metanephric mesenchymal cell migration	IEA
GO:2000590	Process	Negative regulation of metanephric mesenchymal cell migration	ISS

Other IDs

• MIM: 605441
• HGNC: 13633
• e!Ensembl: ENSG00000181092

Protein

• UniProt ID: Q15848
• Protein name: Adiponectin (30 kDa adipocyte complement-related protein) (Adipocyte complement-related 30 kDa protein) (ACRP30) (Adipocyte, C1q and collagen domain-containing protein) (Adipose most abundant gene transcript 1 protein) (apM-1) (Gelatin-binding protein)
• Protein function: Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal mus
• PDB: 4DOU, 6U66, 6U6N
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01391	Collagen	37 → 108	Collagen triple helix repeat (20 copies)	Repeat
  PF00386	C1q	114 → 239	C1q domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Synthesized exclusively by adipocytes and secreted into plasma. {ECO:0000269|PubMed:8947845}.
• Sequence:

  MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDG
  TPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLE
  TYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK
  AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLY
  HDTN

• Sequence length: 244

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Adiponectin deficiency	Pathogenic	rs121917815, rs777532127	RCV003227598 RCV003228146	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ADIPOQ-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY RESTENOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES, GESTATIONAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEREMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME X	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METACHRONOUS COLORECTAL ADENOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY OPEN ANGLE GLAUCOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY EDEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	26860691, 29190629		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	26860691, 29190629		★☆☆☆☆ Found in Text Mining only
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	28824624, 31827477		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	22887729, 28195387, 29305337, 29903845		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	16404369, 30696312, 31415396		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	10961870		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	19696691		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18313838		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24636346		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	18313838, 24330848		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	27644646		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28506662, 30654148		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	24793551		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	31425509		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	22653349		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16685404, 25370174, 29802748		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	22193626		★☆☆☆☆ Found in Text Mining only
Adiponectin Deficiency	Adiponectin Deficiency	BEFREE	17256056, 20700533, 27137743, 28073830, 28256562, 28606849, 31134096		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Adiponectin Deficiency	Adiponectin Deficiency	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	25313911		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	19672024		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30696312, 31415396		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	22387454, 26301885, 28763559		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	19725899, 22186245, 30587608		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	25945502		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22213409, 28421328	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25902149, 34757660, 36114174, 36527105	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	31025923		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	25902149, 29108295		★☆☆☆☆ Found in Text Mining only
Amblyopia	Amblyopia	Pubtator	33897209	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	22935190, 29022894		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	26984187, 28427413, 28550440, 28663573, 29482216		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	30241458, 30819183		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	29287218		★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	40303486	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	31561637	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28534699, 28619118, 28985620		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28027898		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	29379539		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	LHGDN	15598689, 17184143, 17705672		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	17705672, 29261731, 30264643		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	17705672	Associate	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	31214769		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	23153628, 29988086, 30504920, 30885718, 31539673		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	30504920, 36472110	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	23153628, 29988086, 30504920, 30885718, 31539673		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	36472110	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	31377728		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	22163325, 37897936	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	LHGDN	17967974		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	31377728		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	29168539		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	35524481	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12578865, 12716750, 12736161, 12890697, 15046547, 15209773, 15682645, 15725703, 15756215, 15877215, 16091909, 16269654, 16731835, 16952554, 17303804, 18054335, 18511057, 18703020, 19165155, 19426517, 20124735, 20232346, 20350970, 20810317, 21091079, 21248784, 21262584, 21474811, 21738048, 21938426, 22227293, 22534793, 22836642, 23625959, 24330659, 24417942, 25060790, 25582653, 25865302, 26276317, 27007665, 27455039, 27534859, 27771154, 27977529, 28062540, 28121618, 28237515, 28262215, 28293385, 28463859, 28546220, 28577872, 28606474, 28606559, 28643464, 28743977, 28848139, 29109761, 29115433, 29156813, 29329827, 29336612, 29410350, 29452073, 29543038, 29633340, 29877610, 30205790, 30213651, 30379252, 30511299, 30692584, 30857216, 31030940, 31262082, 31678306, 31756645, 31805941		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	33562295	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16547285, 22340319, 28752573, 31167128		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	16547285, 26712749	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	36994890	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	23144698	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	24434628	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	25196858	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16547285	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19883500, 20222108, 20564003, 22532632, 22767598, 29940013, 35136158, 36439145	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	22366095		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	16547285		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	LHGDN	16547285		★☆☆☆☆ Found in Text Mining only
Asphyxia	Asphyxia	Pubtator	32627013	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	22837379, 26546898, 36253437	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23777560, 26546898, 27337146, 27469060, 27473714, 28115224, 28411906, 29665658, 30306746, 30584969, 30618522, 30728088, 30848574		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12578865, 12716750, 12736161, 12890697, 15046547, 15209773, 15682645, 15725703, 15756215, 15877215, 16091909, 16269654, 16731835, 16756736, 16952554, 17303804, 18054335, 18511057, 18703020, 19165155, 19426517, 20124735, 20232346, 20350970, 20810317, 21091079, 21248784, 21262584, 21474811, 21738048, 21938426, 22227293, 22534793, 22836642, 23177015, 23625959, 24330659, 24417942, 25060790, 25582653, 25865302, 26276317, 27007665, 27455039, 27534859, 27771154, 27977529, 28062540, 28121618, 28237515, 28262215, 28293385, 28463859, 28546220, 28577872, 28606474, 28606559, 28643464, 28743977, 28848139, 29109761, 29115433, 29156813, 29329827, 29336612, 29410350, 29452073, 29543038, 29633340, 29877610, 30205790, 30213651, 30379252, 30511299, 30692584, 30857216, 31030940, 31262082, 31678306, 31756645, 31805941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	12736161, 17332688, 17991878, 18270431, 18511057, 19165155, 19426517, 20044088, 20145358, 20395949, 20819416, 21273992, 23897791, 24330659, 25049200, 26382922, 26884098, 27771154, 28761062, 28848139, 30280797, 36157437	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	14675060, 16106049, 16269654, 16891099, 16926524, 17216283, 17991878, 19617629, 19667111, 20016047, 20178558, 20814418, 21219602, 21284833, 21943112, 22078265, 22227293, 22253614, 22471989, 23220424, 23628382, 24561985, 26781170, 28250354, 29263167, 29633340, 29686595, 29718962, 33484170, 34779349, 37175838, 38114533, 38603890	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	14733921, 15877296, 15928248, 17303804, 17357284, 17495599, 17521614, 18006102		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	18931039		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	25855796	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29016783, 31088901, 31553329, 31584315		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	38114533	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	24559850, 28097908, 29276993		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	30043356		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	17256056, 29940013, 30173124, 30716658, 31252407, 31823915		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	23144698	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29333604, 30524947, 30584969		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	18818986		★☆☆☆☆ Found in Text Mining only
Barber Say syndrome	Barber Say Syndrome	BEFREE	25376908		★☆☆☆☆ Found in Text Mining only
Bardet-Biedl Syndrome	Bardet-Biedl Syndrome	BEFREE	22669322		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	23756394		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	23756394	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	17949565		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	29356069		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	25586350, 27658341, 28256562, 29179455		★☆☆☆☆ Found in Text Mining only
Bernard-Soulier Syndrome	Bernard Soulier Syndrome	BEFREE	25376908		★☆☆☆☆ Found in Text Mining only
BETHLEM MYOPATHY 1	Bethlem Myopathy	BEFREE	28848425		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	23151860		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	26884098	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	35384390	Stimulate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	28875764, 30047831, 30818254		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	21908434, 28092987		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	34948648	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	30819183	Associate	★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	27981440		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16350853, 17123704, 17145894, 18182989, 18288417, 18451143, 18813842, 19483724, 19524379, 19661131, 21397927, 22664497, 23017724, 23358729, 23624817, 24335340, 25657113, 25923423, 26817629, 27742668, 28414093, 28416193, 28579830, 28696138, 28730178, 28983080, 29088874, 29175445, 29254161, 29311755, 29433827, 29513571, 29869823, 30024516, 30332900, 30650411, 30732167, 31415715, 31538300, 31571108, 31637624		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18451143, 18827813, 20418665, 20697428, 21397927, 21516303, 21694446, 23624817, 23750285, 25923423, 26395295, 27857161, 29311755, 30883598, 32028860, 32345671, 32736587, 32977760, 33067778, 33342783, 35115550, 35846306, 37787312, 39379897	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19483724, 36114448	Inhibit	★☆☆☆☆ Found in Text Mining only
Brooke-Spiegler syndrome	Brooke-Spiegler Syndrome	BEFREE	25376908		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	LHGDN	14602778		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	28049078		★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	22881231	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19483724, 20418665, 23628382, 25370174, 30379922, 33587254, 36429712, 39379897	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18424096, 19290887, 25300295, 35384390	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24619866	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of Endocrine Gland	Endocrine Gland cancer	BEFREE	31212761		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19294700, 23500159, 25273172, 26018909, 28506662, 30654148		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	29603059	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25827778, 28178338, 31401413	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	22653349		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25700032, 29603059, 30450532, 30967059		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	36114174	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	17106732, 37804308	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	BEFREE	23723143, 27629528, 29219172		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	20230294, 29318144		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	20230294, 26614846, 30557036		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	12694320, 16210704, 17363678, 18239552, 18299205, 18362426, 19556726, 20395949, 20418665, 20460359, 20930713, 21226932, 21617638, 21771975, 22253614, 22785032, 23047599, 23057719, 23512866, 23936408, 24586568, 25880054, 26276317, 26382922, 26754433, 26797284, 26884098, 27609367, 28077136, 29686595, 31412946, 31561637, 31945100, 32771014	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	14675060, 15855354, 15877215, 16210704, 16320084, 16324920, 16581078, 16644713, 16685404, 16990411, 17222292, 17303804, 17505621, 17991878, 18027814, 18191060, 18650840, 19227810, 19483724, 19556726, 19906806, 20044026, 20395949, 20580032, 20930713, 21073447, 21091079, 21226932, 21323646, 21474811, 21617638, 21771975, 21870907, 22040602, 22138143, 22309242, 22639977, 23017720, 23041095, 23181352, 23358099, 23466101, 23470075, 23512866, 23625959, 23670978, 23685884, 23698590, 23972466, 24289790, 24417947, 24417948, 24657240, 24749767, 25074391, 25123125, 25169573, 25233986, 26276317, 26446643, 26745681, 26754433, 27490206, 27550907, 27609367, 27629236, 27688246, 27796618, 28185529, 28190184, 28219936, 28288631, 28341375, 28504609, 28542531, 28585210, 28635626, 28646476, 28673384, 28699615, 28899889, 28912752, 29016783, 29039145, 29052034, 29078817, 29115432, 29248425, 29263167, 29287218, 29313754, 29412474, 29452073, 29452178, 29576602, 29674409, 29750888, 29807528, 29861101, 29877610, 29899496, 29903845, 29969725, 30041791, 30069271, 30077183, 30194955, 30213651, 30341569, 30388239, 30395885, 30479668, 30536591, 30719766, 30857216, 30946215, 31037597, 31088901, 31149766, 31229411, 31242268, 31262082, 31290981, 31310580, 31412946, 31553329, 31805941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	14675060, 18511057, 19483724, 22471989, 23339001, 30536591	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	15780820, 17714716, 18241619		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	Pubtator	17332688	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	17332688, 21474811, 27534859, 28285652		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	20044088	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	29305337		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	16891099, 33484170	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage Diseases	BEFREE	28767622		★☆☆☆☆ Found in Text Mining only
Central Precocious Puberty	Central Precocious Puberty	BEFREE	28610651, 29145926		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	27981440		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	18506375, 25966186, 26611106, 29201467, 31173318		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	21155030, 21771975, 28245897, 32771014, 33378050	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	31363056		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	21155030, 23047599, 24203850, 25501307, 26873941, 27578536, 27913202, 28121618, 28187508, 28463859, 28721154, 30150999, 30892950, 31412946		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	29486166, 30642187, 30892950		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	9427755		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	30557036		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28598548, 30696312, 31415396		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	31152468		★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	15826715		★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	20659429		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	20659429		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	15826715		★☆☆☆☆ Found in Text Mining only
Cholesterol gallstones	Cholesterol gallstones	BEFREE	20659429		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	19549705, 27252405		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	29723618		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	20443850	Associate	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	19477358, 20103776, 21623778, 23723143, 26921438, 28344417		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 3	Kidney Disease	BEFREE	17363678		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	14675060, 15096450, 15200411, 17697862, 18496510, 23283133, 25049200, 27368123, 28402446, 28499019, 30911344, 31323071		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	15096450, 17363678, 19359150, 23374890, 23535586, 25049200, 27368123, 27514393, 27600335, 27692989, 28743977, 29199440, 29287218, 29304245, 29701806, 29794781, 29804241, 29873514, 30236068, 31245009, 31323071		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	15826715		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18818986		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	17625082, 19109202		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	19109202, 22233975, 23017725, 23209832, 23500159, 26806298, 28432078, 29164557, 29609563, 31802861		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	31038568		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	31038568	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	17006986, 21706165, 29469045		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	28123583		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	30150999		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28366721, 28812049, 29098530		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	32020605, 35600795, 36114174	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	16952554, 18484673, 28258220, 28425943		★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	29723618		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16775490, 18310295, 18695895, 19138981, 20444885, 21694446, 21749709, 22193626, 22565227, 24157941, 27092462, 28045589, 28183249, 29446048		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	19138981		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33140821	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18310295, 18827209, 19148467, 19264763, 19273568, 19760027, 20697428, 20846215, 21263187, 21351255, 21749709, 21829206, 22087284, 23826253, 23869187, 24293390, 25273172, 25370174, 25422229, 25431318, 25489716, 25516230, 26203767, 26282004, 26329379, 26362652, 26598515, 26931562, 27061803, 27644646, 27704292, 28529612, 28550647, 29446048, 29765231, 29991578, 30379922, 30675219, 31747664		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17348431, 18827209		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18827209, 20846215, 21263187, 21299716, 21694446, 21749709, 21829206, 22087284, 22565227, 23826253, 24116229, 25022390, 25370174, 25422229, 25489716, 26203767, 26362652, 26598515, 27644646, 30379922, 31659105, 33038280, 34801038, 36429712	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21749709, 25431318, 28550647, 32210264, 32744690	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	24636346		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32053666	Stimulate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	28824624, 31827477		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	31827477	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	17462782, 18190648		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	23151860		★☆☆☆☆ Found in Text Mining only
Congenital Generalized Lipodystrophy Type 1	Congenital Lipodystrophy	BEFREE	18640396		★☆☆☆☆ Found in Text Mining only
Congenital Generalized Lipodystrophy Type 2	Congenital Lipodystrophy	BEFREE	27144933		★☆☆☆☆ Found in Text Mining only
Congenital Hemidysplasia with Ichthyosiform Erythroderma and Limb Defects	Congenital hemidysplasia with ichthyosiform erythroderma and limb defects	Pubtator	35002951	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	19367012, 26670611		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	19477358, 20103776, 21330150, 21623778, 22974530, 23723143, 24117366, 24239242, 25060790, 26921438, 27629528, 28195387, 28255978, 28344417, 28696825, 29318144, 29559829, 29969725, 30626897, 30699407, 31314851, 31553971		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conn Adenoma	Conn Adenoma	BEFREE	16685404		★☆☆☆☆ Found in Text Mining only
Conn Syndrome	Conn Syndrome	BEFREE	19481913, 23590605		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	30581351		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20399960, 24096711, 25827778, 28123583, 28178338, 28484923, 29723618, 31215811, 31236331, 31401413		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	29723618		★☆☆☆☆ Found in Text Mining only
Corneal dystrophy Avellino type	Corneal dystrophy	Pubtator	23121676	Inhibit	★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy Fleck	Corneal dystrophy	Pubtator	23121676	Inhibit	★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	31523981		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	26446643	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10604883, 11549668, 14752031, 15063429, 15123570, 15209773, 15277433, 15682645, 15877215, 16389553, 16443770, 16926524, 17618943, 17712123, 18328815, 18562207, 19661719, 19960000, 20056223, 20116810, 20528971, 20608995, 20829073, 20835900, 21036322, 21208676, 21226932, 21248784, 21284833, 21400095, 21416461, 21706003, 21726267, 21738048, 21744264, 22147092, 22261475, 22386722, 22459242, 22534793, 22748670, 23017720, 23224687, 23590551, 23664276, 24548634, 24760538, 25582653, 27007665, 27252388, 27300270, 28121618, 28463859, 28617663, 28881706, 29211251, 29233027, 29278852, 29324260, 29633340, 29859480, 30041791, 30186434, 30379252, 30837669, 30879388, 30885128, 31276836, 31462128		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	10604883, 11549668, 12578865, 14671398, 14752031, 15063429, 15123570, 15209773, 15277433, 15682645, 15877215, 16389553, 16443770, 16926524, 17222292, 17303804, 17618943, 17640627, 17712123, 18328815, 18562207, 18650840, 19661719, 19960000, 20056223, 20528971, 20608995, 20829073, 20835900, 21036322, 21208676, 21226932, 21284833, 21330150, 21400095, 21416461, 21626471, 21706003, 21726267, 21738048, 21744264, 21981776, 22147092, 22261475, 22386722, 22459242, 22534793, 22748670, 22971728, 23017720, 23041095, 23224687, 23590551, 23664276, 24548634, 24760538, 25470794, 25582653, 26965314, 27007665, 27218147, 27252388, 27300270, 28033351, 28121618, 28168796, 28463859, 28577872, 28617663, 28848139, 28881706, 29168539, 29211251, 29233027, 29278852, 29324260, 29633340, 30041791, 30186434, 30212581, 30379252, 30879388, 30885128, 31276836, 31462128, 31464731, 31608708		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	12728641, 15616802, 15749025, 16111669, 16530178, 16822679, 16978998, 17123536, 17334513, 17486299, 17651832, 18021784, 18164019, 18300743		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	15063429, 16565557, 16926524, 19661719, 19960000, 20930713, 21218266, 21226932, 21498926, 23590551, 24699314, 25880054, 26781170, 26884098, 28848139, 29211251, 29633340, 30212581, 30662365, 31561637, 32153153, 33735200, 33802675, 34779349, 35197230, 35461346	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	16739393, 20145358, 21284833, 21981776, 27352781	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	17712123, 24760538, 26400332, 26754433, 27252388, 28737466	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	21741045	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10604883, 11549668, 14752031, 15063429, 15123570, 15209773, 15277433, 15682645, 15877215, 16389553, 16443770, 16926524, 17618943, 17712123, 17945166, 18328815, 18562207, 19191728, 19324915, 19661719, 19960000, 20011104, 20056223, 20528971, 20608995, 20829073, 20835900, 21036322, 21208676, 21226932, 21284833, 21400095, 21416461, 21706003, 21726267, 21738048, 21744264, 22147092, 22261475, 22386722, 22459242, 22534793, 22748670, 23017720, 23224687, 23664276, 24548634, 24760538, 25582653, 26754433, 27007665, 27252388, 27300270, 28121618, 28463859, 28617663, 28881706, 29211251, 29233027, 29278852, 29324260, 29633340, 29903845, 29969725, 30041791, 30186434, 30379252, 30879388, 30885128, 31276836, 31462128		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	LHGDN	15677512, 16804063, 17119002		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary Restenosis	CTD_human_DG	12138120		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary restenosis	Pubtator	18349107, 31389602	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	15888786	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	16775490, 29033577, 29287006		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	CTD_human_DG	21829567		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	23121676	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	21829567		★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	21829567		★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	Pubtator	35677050	Stimulate	★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	28801055		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30979683, 31582896, 31606405		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	31582896	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29720688		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	16891099, 21854818, 21935928, 22340319, 26544540, 27435997, 27884778, 29100514, 29105498, 29225423, 29422077, 30115130, 30123499, 30891782, 31025923, 31137976, 31450004, 31683344		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	16891099		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	29801516		★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	30400097		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	22213409, 23055000, 28421328, 29752657, 29758945		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	22213409	Stimulate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	28421328	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	28421328, 29629537		★☆☆☆☆ Found in Text Mining only
Dental Diseases	Dental Diseases	BEFREE	28513060		★☆☆☆☆ Found in Text Mining only
Depression, Postpartum	Mental Depression	BEFREE	28224268		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	25597795, 27938498, 28187508, 28224268, 28662456, 29520075, 29702755, 30005278, 30115912, 30150999, 30391327, 30552920, 30818254, 31824431		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	26173479		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	35998284	Associate	★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	27676325		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11812766, 12354786, 12716750, 12802337, 12878598, 12941784, 15047634, 15114471, 15123570, 15239024, 15334388, 15616040, 15725703, 16028335, 16091909, 16567542, 16756736, 16894363, 16933180, 16990411, 17052201, 17194889, 17335469, 17416799, 17475934, 17607322, 17618943, 17684226, 17868184, 17895880, 17991878, 18191060, 18311774, 18363889, 18431508, 18639522, 18776141, 18988888, 19088327, 19116277, 19178518, 19183309, 19484180, 19667111, 19855092, 19906806, 20033714, 20083470, 20153489, 20179670, 20651470, 20810317, 20878967, 21400095, 21623778, 22161113, 22342226, 22443353, 22791750, 22904306, 23041553, 23296264, 23512866, 23624817, 23670348, 23747931, 23958652, 23985723, 24185422, 24586568, 24937531, 25169573, 25759378, 25818192, 25864761, 26114833, 26196305, 26247729, 27550907, 27611701, 27770592, 28083716, 28195387, 28261283, 28407551, 28455662, 28577872, 28699615, 28705835, 28888981, 28938100, 28954262, 29078817, 29101068, 29145717, 29195493, 29199440, 29263167, 29305337, 29348480, 29572383, 29635921, 29674409, 29991592, 30002734, 30027366, 30069271, 30186434, 30282888, 30333718, 30334082, 30399195, 30467975, 30473057, 30599058, 30672698, 30857216, 30911344, 30974901, 31048658, 31310580, 31501920, 31811995		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	15005780, 24338462, 24349098, 25031708, 30020508, 35532201, 36709877	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	20150288, 26094529, 26842272, 28050671, 28846666, 30355290, 31978117, 32627013, 33750967, 35689735, 37524927, 37953238, 38093364, 40004118	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11812766, 12354786, 12716750, 12802337, 12878598, 12941784, 15047634, 15114471, 15123570, 15239024, 15334388, 15616040, 15725703, 16028335, 16091909, 16210704, 16567542, 16756736, 16894363, 16933180, 16990411, 17052201, 17194889, 17335469, 17416799, 17475934, 17607322, 17618943, 17684226, 17868184, 17895880, 17991878, 18191060, 18311774, 18363889, 18431508, 18506375, 18639522, 18776141, 18988888, 19088327, 19116277, 19178518, 19183309, 19324915, 19484180, 19667111, 19855092, 19906806, 20033714, 20083470, 20153489, 20179670, 20651470, 20810317, 20878967, 21400095, 21623778, 22049178, 22161113, 22342226, 22443353, 22459242, 22791750, 22904306, 23041553, 23047599, 23296264, 23466101, 23512866, 23624817, 23653335, 23670348, 23747931, 23958652, 23985723, 24185422, 24203850, 24586568, 24937531, 25169573, 25759378, 25818192, 25864761, 26051417, 26114833, 26196305, 26247729, 26616148, 27550907, 27611701, 27770592, 28083716, 28190184, 28195387, 28214534, 28236525, 28261283, 28407551, 28455662, 28472298, 28577872, 28699615, 28705835, 28713075, 28888981, 28938100, 28940978, 28954262, 29078817, 29101068, 29145717, 29195493, 29199440, 29243792, 29263167, 29287218, 29291779, 29305337, 29348480, 29543038, 29572383, 29635921, 29674409, 29912982, 29991592, 30002734, 30027366, 30069271, 30186434, 30203461, 30282888, 30333718, 30334082, 30399195, 30467975, 30473057, 30599058, 30672698, 30857216, 30911344, 30974901, 31048658, 31177798, 31234308, 31245009, 31310580, 31501920, 31811995		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	CTD_human_DG	12860835		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	16210704, 16788799, 17224338, 17684226, 18239552, 18285554, 18776141, 19107905, 20443850, 21218266, 21409316, 22049178, 22056417, 22164267, 22443353, 23047599, 23057719, 23213322, 23624817, 23818415, 23936408, 24185422, 24324367, 24338462, 24586568, 24643166, 25516658, 26884098, 28407551, 28413567, 29145541, 29263167, 31115373, 31517610, 32544194, 33155222, 33562295, 33655931, 34779349, 34784930, 35528179, 37175838, 37953238	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	16891099, 16926524, 19667111, 19672024, 20368216, 22445099, 22545589, 23283133, 25049200, 26781170, 28713075, 31533725, 38114533	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	LHGDN	17229078, 17684226, 18974768		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	14675060, 18496510, 19056609, 20667095, 25942477, 27368123, 30467975	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	21900154, 26382922	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	11469400, 15761178, 17184146, 18448614, 18511057, 19238139, 19622782, 19797823, 20819416, 21234863, 22403302, 23339001, 24324367, 24495560, 25759378, 27705028, 27771154, 29509263, 30212581, 32235466, 33484170, 35461346, 35805088, 38603890	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	12388136, 15063429, 15830179, 16443793, 16788799, 16926524, 17216283, 17259404, 17705672, 18299205, 18429970, 18442481, 18614852, 18716158, 18719649, 18776141, 19056609, 19107905, 19131459, 19846176, 19960000, 20018283, 20395949, 20576642, 21219602, 21234863, 21409316, 21700879, 21771975, 22023374, 22049178, 22327199, 22443353, 22489167, 22583123, 22673923, 23057719, 23351195, 23512866, 23590551, 23658423, 24086540, 24414038, 24643166, 24688318, 24894086, 24943964, 25121131, 25405601, 26699120, 26781170, 26817832, 26884098, 27181706, 27609367, 27834443, 27883041, 28413567, 28758947, 28761062, 29665620, 29686595, 29752628, 30467975, 30599058, 31131096, 31517610, 31561637, 32076038, 32131811, 32685510, 32886301, 33155222, 33562295, 33788629, 34784930, 35528179, 35831700, 36347891, 36674502	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	14675060, 15239024, 17189871, 17687539, 18496510, 19056609, 20667095, 21105490, 21208676, 23470075, 23922494, 26114833, 27368123, 27565410, 27871914, 28499019, 28587667, 28702765, 28721140, 28875223, 30186875, 30273227, 30333718, 30689904, 31050684, 31110527		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	14675060		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10403784, 11334417, 11756320, 11812766, 12086969, 12354786, 12540592, 12547549, 12601307, 12750819, 12788102, 12802337, 12804757, 12941784, 14693717, 14749263, 15047634, 15063429, 15105989, 15114471, 15209773, 15239024, 15277403, 15277433, 15277436, 15334388, 15504979, 15583845, 15616040, 15682645, 15734870, 15761178, 15830179, 15842511, 15855264, 15855354, 15855579, 15918014, 15955369, 15983228, 16025741, 16028335, 16091909, 16231017, 16254197, 16259488, 16352688, 16389553, 16443770, 16443793, 16505255, 16551730, 16644713, 16788799, 16797099, 16801592, 16801926, 16933180, 17052201, 17160088, 17216283, 17222292, 17259404, 17334638, 17416799, 17445531, 17705672, 17945166, 17973869, 17980008, 18027814, 18054335, 18191060, 18294218, 18328815, 18386294, 18429970, 18465144, 18466348, 18498634, 18571119, 18680072, 18716158, 18719649, 18777458, 18828733, 19056609, 19131459, 19178518, 19183309, 19183842, 19227810, 19238139, 19263799, 19269196, 19322030, 19324915, 19359061, 19481913, 19484180, 19490068, 19556726, 19631916, 19690575, 19708766, 19846176, 19883376, 19929719, 19955001, 20011104, 20033714, 20044026, 20083470, 20384434, 20395949, 20552210, 20580771, 20585974, 20597906, 20651470, 20810317, 20832248, 21035442, 21109196, 21219602, 21262584, 21284483, 21323646, 21400095, 21416461, 21589658, 21594755, 21623778, 21638131, 21700879, 21738048, 21744264, 21771975, 21916932, 21931325, 22023374, 22040602, 22046359, 22049178, 22138143, 22147092, 22155316, 22187345, 22189999, 22222620, 22269154, 22309242, 22327199, 22403302, 22443353, 22479202, 22489167, 22496878, 22497971, 22515931, 22539443, 22594400, 22827962, 22971728, 23041553, 23049674, 23057719, 23260797, 23351195, 23466101, 23512866, 23552441, 23585875, 23590551, 23653335, 23670978, 23764562, 23772547, 23834543, 23835345, 23845780, 23885987, 24055485, 24404592, 24414038, 24417942, 24432991, 24440313, 24469713, 24655058, 24688318, 24825737, 24894086, 25123125, 25135112, 25294284, 25322755, 25470794, 25546819, 25561226, 25599387, 26042596, 26051417, 26144281, 26243686, 26610729, 26699120, 26740596, 26817832, 26999420, 27036040, 27181706, 27218147, 27289142, 27374856, 27388775, 27481890, 27514756, 27573980, 27609367, 27684566, 27705028, 27720679, 27757829, 27771154, 27845333, 27883041, 28033351, 28041985, 28195387, 28207876, 28236525, 28295931, 28332351, 28402446, 28407551, 28413567, 28437198, 28448891, 28463859, 28476623, 28522646, 28587667, 28594865, 28639641, 28654680, 28667102, 28673384, 28679518, 28686216, 28721137, 28721140, 28721154, 28721438, 28758947, 28846711, 28875870, 28945274, 28962190, 29098530, 29101068, 29147484, 29174342, 29195493, 29204667, 29205013, 29243792, 29263167, 29308741, 29321603, 29330340, 29381968, 29384321, 29395659, 29453672, 29494595, 29509263, 29520075, 29525039, 29558518, 29567080, 29568898, 29582200, 29627525, 29665620, 29686595, 29691896, 29717906, 29752628, 29903845, 29912982, 29933718, 29951553, 29952412, 29969725, 30002734, 30069271, 30160532, 30203461, 30212581, 30339037, 30467975, 30523063, 30599058, 30678182, 30689904, 30762811, 30816670, 30841005, 30860284, 30863757, 30864188, 30899283, 31009504, 31100493, 31128439, 31159801, 31168327, 31229411, 31234308, 31292311, 31336986, 31345359, 31408894, 31424368, 31461078, 31484347, 31539648, 31561637, 31629112, 31676315, 31688578, 31690939, 31693217, 31755094, 31769241, 31805941, 31811995		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	12114044, 12354786, 15734870		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	12766104, 17445536, 18191060, 18777458		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	21397613	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	26614846	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic Foot	BEFREE	18639522		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	18496510, 19056609, 20667095, 24894086, 27368123, 30135333, 37175838	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15334388, 17065357, 17189871, 17942768, 18496510, 18599322, 19056609, 20083470, 20667095, 21521713, 24344808, 24469713, 24655058, 24816832, 24825737, 24894086, 25280384, 25957229, 27368123, 28402446, 28499019, 28870804, 29330340, 29462574, 29507597, 29894207, 30135333, 30557306, 30974901, 31048658, 31245009, 31572480		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	17490776		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	17942768		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	15248834		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	18680072, 23260797, 24655058, 30882695, 30982980		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	30882695, 33374471	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	29168186, 31252407		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	31607358		★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	BEFREE	16775490		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	27837083, 28749784		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	31596727		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	19690401, 29274847		★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	20016047	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	11571669, 12788102, 12804757, 16389553, 17607322, 20964254, 23222963, 23845780, 24432991, 24528335, 27885961, 29109369, 29145717, 29280189, 30816311, 30979683, 31191115		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	LHGDN	12694320, 15562208, 15798954, 17714716, 18670142		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	23047599, 25897955, 28315561, 30816311, 36157437	Associate	★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	17952840		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	17505945, 18958929, 21951069, 28165570, 28875223, 29109760		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	23777323	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	29184485		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	21226932		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	22653349		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16055459, 16404369, 21980131, 22038736, 22327423, 22653349, 25613698, 28748857, 30845297, 30934676, 31003933		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	27931017, 28748857		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	17914101		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21980131	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22038736, 26386690, 29297146, 32370713	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	16055459		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	16055459, 16135012		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	26459399	Inhibit	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29935409		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	30530136		★☆☆☆☆ Found in Text Mining only
Epiphyseal dysplasia multiple 1	Epiphyseal dysplasia	Pubtator	24982243	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	29603059		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	30339037, 31177798		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30640413	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	16025741, 18568692, 19481913, 21637762, 23822941, 23897791, 27936341		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	21637762, 23047599, 23897791, 27936341	Associate	★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	31715450		★☆☆☆☆ Found in Text Mining only
Familial generalized lipodystrophy	Lipodystrophy	BEFREE	20097706, 25376908		★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	31377728	Associate	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	18398047, 24330848, 28285359		★☆☆☆☆ Found in Text Mining only
Familial partial lipodystrophy	Partial Lipodystrophy	BEFREE	16320084		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	LHGDN	15239085, 15369797, 15797948, 16139921, 17006986, 18311774		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	15591515, 22327199, 22898488, 29863454, 32053513, 35831700	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	18029322, 18190648, 19474520, 20168312, 21496456, 21791204, 22118966, 22327199, 22898488, 23892696, 23948064, 25048195, 26042596, 27289142, 28260907, 28574439, 28836350, 28849192, 28929125, 30541285, 30968772, 31071311, 31167890, 31265993, 31715215		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	20168312, 25132761	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	15591515	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	15591515, 16989692, 17006986, 18029322, 18311774, 18376369, 20041267, 21791204, 22898488, 23627434, 25703085, 26897098, 26992300, 29746485		★☆☆☆☆ Found in Text Mining only
Fatty Liver, Alcoholic	Alcoholic Fatty Liver	BEFREE	19032584		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	17462782, 18098312, 19484180, 20564215, 21539538, 21846328, 25575598, 27083512, 30231008, 30293572, 31324181		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	30784899		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	35384390	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	18310295		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24648185		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24648185		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31665421		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	30547763	Stimulate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	28763559		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	20016047	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	BEFREE	19048458		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	LHGDN	16253634		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	14764816, 15886250	Associate	★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	28946816		★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	33655931	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	23723143, 30210613, 30872595		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	34716426, 36114174	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	18362426, 19477358, 19797823, 22379072, 22785032, 24114971, 25961010, 26921438, 29559829	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	19367012, 26670611		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	19477358, 21330150, 22974530, 24117366, 25060790, 27629528, 28195387, 28255978, 28696825, 29318144, 29559829, 29969725, 30699407, 31314851, 31553971		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	22196150	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	19367012, 26670611		★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	32877226	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30144561		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	22996660		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	25985182	Associate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	29913483	Stimulate	★☆☆☆☆ Found in Text Mining only
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	22996660		★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	23058473	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	24259947	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	32053513	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	18568135, 28267407, 32053513	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	17868184, 19019483		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	23177015		★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	31786710		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	29635921		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	19548952, 29635921		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	20388053, 28522293		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	24113220, 26190448		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	LHGDN	17123536		★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	BEFREE	12860835		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperemia	Hyperemia	CTD_human_DG	12860835		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperemia	Hyperemia	LHGDN	15920062		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	BEFREE	15047634, 16567542, 17052201, 17868184, 20145925, 20466332, 21562756, 22147092, 23259700, 25316675, 28317342, 28641783, 29180355, 29744365, 29912982, 30374109, 31275407		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	Pubtator	20466332, 33155222, 34203452	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	CTD_human_DG	29991592		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	BEFREE	12540592, 12601307, 12663460, 15855264, 16952554, 17052201, 17607322, 17893258, 18208577, 18363889, 18568692, 18827209, 20388053, 22664497, 22996660, 23259700, 23274890, 23822941, 23826141, 25453978, 27798951, 28974704, 29029184, 29271886, 29412474, 29494595, 29906708, 30006585, 30356972, 30451912, 31265057		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	18827209, 20388053	Associate	★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	18639522		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	LHGDN	15690190		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	19906806, 25384966, 28585210, 29859480		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia Familial Combined	Hyperlipidemia	Pubtator	16106049	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	10403784, 19632099		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	LHGDN	16106049, 18762168		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	23352378	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemias	Hyperlipoproteinemia	Pubtator	22023374	Associate	★☆☆☆☆ Found in Text Mining only
HYPERPIGMENTATION, FAMILIAL PROGRESSIVE	HYPERPIGMENTATION	BEFREE	29617320		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	16785148, 20516205, 21150884, 21558084, 21637762, 22023374, 23057719, 23897791, 24330659, 24414038, 25546819, 25894102, 26146630, 27936341, 29914579, 36094942, 36157437	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	20552610	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	12429873, 12517687, 17452504		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	12860835		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	15123570, 16741355, 16785148, 16944773, 18506375, 18650840, 19191728, 20516205, 20528971, 20664545, 20836698, 21150884, 21637762, 21872196, 22534793, 22714914, 23017720, 23057719, 23478100, 23685884, 23845780, 23897791, 24414038, 24432991, 25546819, 26146630, 26634484, 26817832, 27455039, 27882931, 27936341, 27974594, 28099908, 28181566, 28841247, 28982776, 29093301, 29243792, 30381540, 30791536, 30911344, 30940525, 31042407, 31052455, 31121868, 31236708, 31262082, 31714888, 31746004		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	Pubtator	37876543	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	23897791	Associate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	LHGDN	18591837		★☆☆☆☆ Found in Text Mining only
Hypoadiponectinemia	Hypoadiponectinemia	BEFREE	12788102, 12860835, 12878598, 15919831, 16801592, 17625437, 18465144, 19960000, 20168312, 20659429, 21139317, 21150884, 21323646, 21617638, 23478100, 23822941, 23958652, 24055485, 24362030, 24796925, 25818192, 25864761, 28145500, 30946215, 31368881		★☆☆☆☆ Found in Text Mining only
Hypoadiponectinemia	Hypoadiponectinemia	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Hypoadiponectinemia	Hypoadiponectinemia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	LHGDN	15690190		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	LHGDN	18547236		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	19131459	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	28829491		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	31004687		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17609976, 21448846, 37759548	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24434628, 34954853	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29348564	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	31345155		★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	30934785		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28604281, 29115380		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30784899, 31324858		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	38263093	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	28039519		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	30547763		★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	21829567		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28824624, 30140232		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	23055000, 28366721, 28812049, 29098530, 29243792, 29267309, 29752657, 30002734, 30400097, 30692905, 31389588, 31424368		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29033577, 29086333, 29540173, 31779136		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	26173479		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	11469400, 12388136, 15005780, 16210704, 16739393, 16926524, 17030959, 17213476, 17216283, 17372314, 17684226, 17705672, 17712104, 18258617, 18429970, 18480556, 18511057, 18716158, 18820653, 19079714, 19106328, 19131459, 19426517, 19483724, 19720790, 19755407, 19761474, 20032495, 20382687, 20388053, 20395949, 20418665, 20443850, 20454813, 20570822, 20576642, 20819416, 20887962, 21218266, 21397927, 22161113, 22327199, 22457861, 22462604, 22570091, 23351195, 23818415, 23826141, 23826253, 24009259, 24414038, 24502610, 25048195, 25423261, 25832963, 26203767, 26423718, 26871994, 27133621, 28027637, 28060790, 28683803, 28758947, 30360393, 30816311, 30920415, 31002147, 31517610, 31659105, 32076038, 33562295, 33750349, 33849843, 33997011, 34645953, 35409282, 35528179, 36708720, 37953238, 38140287, 39180924, 39692030	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	12687327, 17488807, 18445668, 19667111, 20168312, 21229348, 21846802, 22393448, 22545589, 23283133, 24586568, 24796925, 27342408, 31359766, 31554182	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	38048212	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30273227		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	36740606	Stimulate	★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	28258220		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	28824624		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	22996660, 23723143, 29219172, 30027366		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31306342		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	30902059, 31275164		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	16990411, 20848215, 21155030, 21771975, 22207032, 24203850, 25501307, 27913202, 28121618, 28245897, 28285652, 29969725, 30391327, 31412946		★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	28596789		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	14675060, 17065357, 18431507, 18431508, 18599322, 19056609, 20667095, 23283133, 23334396, 24417947, 24894086, 29207395, 29655459, 30557306		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	14675060, 19056609, 19524870, 20667095, 24894086, 29207395, 31269899	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	17984105		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	15200411, 23334396, 26215580, 30210613, 31715450		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	12694320, 15200411, 18496510, 23283133, 25049200, 27368123	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	14675060	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	14675060, 15096450, 15200411, 17697862, 18496510, 23283133, 25049200, 27368123, 28402446, 28499019, 30911344, 31323071		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	LHGDN	14675060, 15736110, 17005524, 18315699, 18346990, 18496510		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	19539174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LAURIN-SANDROW SYNDROME	Laurin-Sandrow syndrome	BEFREE	29261731		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	28292262		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	19367012, 26670611		★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh syndrome	Pubtator	36549505	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	29348564	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22082804, 28193268		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	16203766		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16404369		★☆☆☆☆ Found in Text Mining only
Leukostasis	Leukostasis	BEFREE	19342600		★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	26634484, 28463859, 29582200		★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	BEFREE	15725703, 28339344		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	12679491, 12829646, 15725703, 20097706, 20964254, 21079616, 26111083, 27497155, 28088613, 28339344, 28448764, 29242557, 29788076, 31071311, 31149766		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	LHGDN	12713059		★☆☆☆☆ Found in Text Mining only
Lipodystrophy Congenital Generalized	Lipodystrophy	Pubtator	18640396	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11444852, 16273386, 20637208, 20941777, 22898488, 23740135, 24132578, 25492487, 26089158, 26632699, 30547888, 30944152, 31000682, 31421311		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	15826715, 17006986, 17462782, 21706165, 28744589, 29469045		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	17006986		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	28267407, 28744589	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	19883500, 24434628	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	24259947	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	29469045	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	18719649, 24259947, 29469045, 35831700	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11444852, 26089158		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	22233975, 23500159, 30654148		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	38263093	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18424891		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26018909	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32570854	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16164660	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19524870, 19811274, 20044088, 30183598	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19524870, 28898254, 28937471, 29173690, 30098476, 30183598, 31094570		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	19524870, 28361601, 28898254, 30159624		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	25345756, 27716443	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23181352	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	16160698		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29870819, 30005278, 30562581		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	22095628		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16350853, 17123704, 17145894, 18182989, 18288417, 18451143, 18813842, 19483724, 19524379, 19661131, 21397927, 22664497, 23017724, 23358729, 23624817, 24335340, 25657113, 25923423, 26817629, 27742668, 28414093, 28416193, 28579830, 28696138, 28730178, 28983080, 29088874, 29175445, 29254161, 29311755, 29433827, 29513571, 29869823, 30024516, 30332900, 30650411, 30732167, 31415715, 31538300, 31571108, 31637624		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16055459, 21980131, 22038736, 22327423, 22653349, 25613698, 28748857, 30845297, 31003933		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30944152		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19294700, 23500159, 25273172, 26018909, 28506662, 30654148		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25700032, 29603059, 30450532, 30967059		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21357378, 25051362, 25516658, 28096201, 29156726, 29777233, 30038429, 30745818		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16899222, 19676095, 20697428, 21397927, 21960694, 22249290, 22415092, 23225349, 24793551, 25038177, 25586350, 25877612, 26160610, 26320190, 27699825, 27768592, 28183249, 28453464, 28693794, 29222347, 29465157, 30648824, 31147627		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17459059, 18695895, 20336470, 25270251		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17459059, 18310295, 19138981, 19906806, 20444885, 21111705, 21397927, 21574190, 21694446, 21960694, 22038736, 22082804, 22087284, 22653349, 23065236, 23143890, 23200411, 23225349, 23628382, 23884578, 24203850, 24636346, 24648185, 24720830, 24749767, 24969908, 25007742, 25038177, 25273172, 25586350, 25613698, 25700032, 25827778, 26018909, 26598515, 27061803, 27092462, 28069486, 28123583, 28178338, 28193268, 28215174, 28402255, 28454352, 28506662, 28529612, 28693794, 29036907, 29115033, 29155136, 29197678, 29222347, 29465157, 29549722, 29576602, 29603059, 29991592, 30145771, 30672698, 30781341, 30883598, 30967059, 31003933, 31052147, 31121868, 31128991		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16775490, 18310295, 18695895, 19138981, 20444885, 21694446, 21749709, 22193626, 22565227, 24157941, 27092462, 28045589, 28183249, 29446048		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	15200411, 15855268, 28069486, 29465158, 31518996		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14654554, 17192291, 18163210, 18451143		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19723917, 31685042		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30082356		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37481560	Inhibit	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	11304690		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	25597795, 27938498, 28187508, 28224268, 28662456, 29520075, 29702755, 30005278, 30047831, 30115912, 30150999, 30391327, 30552920, 30818254, 31824431		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	30504920, 30562581, 30864396, 31539673		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	11029602, 11571669, 16801926, 17277888, 17593901, 18160463, 18535556, 20423458, 20651470, 20810317, 21150884, 21447704, 22016761, 22155316, 23032297, 23149075, 23510830, 23512866, 23656997, 23685884, 24330659, 24657240, 25123125, 26139044, 26173479, 26419856, 26423718, 26535443, 27246401, 28187508, 28258220, 28325521, 28463859, 28539232, 28945274, 29145717, 29237687, 29248425, 29398443, 29414510, 29655459, 29669464, 29684480, 29759068, 29912982, 29937410, 30346829, 30745818, 30904998, 31048658, 31128991, 31222110, 31337827, 31368881, 31483293, 31554925, 31561637, 31731705		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	LHGDN	15246202, 18414778		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	18239552, 20460359, 21150884, 21218266, 23032297, 23149075, 23512866, 24330659, 24477029, 26423718, 26504811, 29237687, 32076038, 34716426, 34779349, 35436409, 36708720, 37883858, 37953238	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	38603890	Inhibit	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	15063429, 15562250, 15919831, 16231029, 17332688, 17634253, 17684226, 18568135, 18820653, 19164335, 19238139, 19321583, 19483724, 19761474, 19887569, 20018283, 20032495, 20067957, 20395949, 20454813, 20814418, 21150884, 21319340, 21397613, 21409316, 21562092, 21637762, 21700879, 21771975, 22090467, 22507618, 22948153, 23047599, 23057719, 23351195, 23590605, 23628382, 24330659, 24561985, 25875811, 25891757, 26423718, 26525420, 26797284, 26884098, 27133621, 28077136, 28188344, 29863454, 30265726, 30356143, 30381540, 31131096, 32915782, 33155222, 33232281, 33319570, 33997011, 35461346, 36117520, 38140287, 39290095	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome	Metabolic syndrome	Pubtator	17652887, 20418665, 21498926, 22489167	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome	Metabolic syndrome	Pubtator	38114533	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	11549668, 11700024, 11756320, 12086965, 12086969, 12663460, 12716750, 12788102, 14551151, 14764792, 15047634, 15063429, 15123570, 15562250, 15682645, 15843989, 15919831, 16231017, 16320084, 16389553, 16418740, 16443770, 16456090, 16551730, 16581078, 16634986, 16678433, 16700915, 16741355, 16756736, 16955209, 17112391, 17481768, 17618945, 17634253, 17663805, 17684226, 17991878, 18027814, 18054335, 18160463, 18208577, 18328815, 18349065, 18949681, 18957933, 18988888, 19011278, 19191728, 19238139, 19246975, 19321583, 19359150, 19474520, 19481913, 19483724, 19533865, 19690575, 19761474, 19794286, 19844182, 19887569, 19960000, 20018283, 20032495, 20067957, 20232346, 20395949, 20406164, 20552210, 20585974, 20810317, 21125210, 21150884, 21323646, 21330150, 21562092, 21637762, 21771975, 21870907, 21872196, 21979884, 22095824, 22269963, 22281526, 22354267, 22374249, 22439148, 22475777, 22489167, 22507618, 22996660, 23041553, 23047599, 23057719, 23108996, 23292171, 23351195, 23358099, 23590605, 23593121, 23628382, 23656997, 23698590, 23826141, 23845780, 24104889, 24330659, 24432991, 24549138, 24561985, 24749767, 24819472, 25074391, 25864761, 25875811, 25893694, 25916157, 26423718, 27490206, 27554120, 27578536, 27639310, 27644646, 27688246, 27832021, 27915341, 28039914, 28046037, 28077136, 28120564, 28139438, 28188344, 28193268, 28279166, 28439190, 28463859, 28511904, 28529612, 28577342, 28578188, 28606559, 28638270, 28670347, 28746378, 28747790, 28763403, 28814962, 28878827, 28879415, 29016249, 29016251, 29020116, 29115033, 29205013, 29205099, 29213336, 29225622, 29242557, 29313754, 29335849, 29395659, 29410303, 29609563, 29625373, 29665770, 29675927, 29759068, 29788076, 29988086, 30058513, 30115912, 30256492, 30265726, 30309709, 30333754, 30338401, 30381540, 30472712, 30530892, 30688550, 30813240, 30835048, 30857216, 30910989, 30974901, 31052455, 31059867, 31076636, 31117266, 31121868, 31137976, 31149031, 31151171, 31179792, 31262082, 31265993, 31311491, 31323071, 31337827, 31341853, 31346314, 31483293, 31552725, 31705791, 31786572		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	LHGDN	12728641, 16872712, 17684226		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	CTD_human_DG	16793964, 17618945, 18162013, 20833989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	34242326	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	27165492, 28270183, 28677995, 30798617		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	23055000, 27599805, 29243792, 29629537, 29752657, 30689587		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	29559003		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	35600795	Associate	★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	30196837		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	29261731		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	21908434, 28602036		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	30504920		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	30504920	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21908434, 28602036		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28602036, 30408155, 31985020	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27514756, 27903934, 28641765, 30196837, 30219158, 30300462, 31129285, 31550559		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	32154570, 33486671	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	30962487		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	28188344	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	28188344, 28463682, 29558930, 30934785, 30962487		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	35802752	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	22082804		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	19367012, 26670611		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	16990411, 17712123, 17786291, 19361803, 19940263, 20332381, 20528971, 21130994, 23041095, 24242286, 29196254, 29524572, 30902059		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	17712123, 20528971, 20576642, 22196150, 24330659	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	18997620		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	20814418	Inhibit	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	12601307, 25060790, 27845333, 30832662		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	LHGDN	15877296		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16155579		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	22196150	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	BEFREE	30927046, 30934785		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	36867130	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	28042053, 28240307, 28463682		★☆☆☆☆ Found in Text Mining only
Myositis Ossificans	Myositis	Pubtator	34954853	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	31131096, 32544194, 33155222	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	32933141	Inhibit	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	28940978		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30535454	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36361525	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11304690, 18310295, 19138981, 19672024, 20336470, 20637208, 20700533, 20941777, 21263187, 21908434, 21960694, 22193626, 22653349, 23181352, 23884578, 24113220, 24636346, 24648185, 25038177, 25492487, 25657113, 25877612, 26018909, 26160610, 26598515, 26656720, 27092462, 28379958, 28414093, 28422056, 28454352, 29032404, 29086519, 29212223, 29549722, 29956809, 30021348, 30038429, 30640413, 30794695, 31421311, 9427755		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	27365371		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	12694320	Stimulate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30221582		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16814256		★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	30400097		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	16814256, 23055000, 28282917, 28427413, 28963462, 31607358		★☆☆☆☆ Found in Text Mining only
Neuroma	Neuroma	BEFREE	30986512		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	23260797		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	17942768		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	15591515, 16989692, 17999673, 18311774, 18376369, 18565022, 19246975, 19422483, 19474520, 19484180, 19948621, 21240660, 22118966, 22269154, 22898488, 23977033, 24548122, 25385252, 26042596, 26212089, 26293833, 26334200, 26632699, 26865047, 26897098, 26909902, 26965314, 27164963, 27266339, 27527746, 27547913, 27831642, 28446162, 28758929, 28849192, 29037210, 29201040, 29425212, 29471595, 29696816, 29953011, 30032465, 30096951, 30186875, 30266576, 30390352, 30425219, 30470912, 30473057, 30522122, 30541001, 30601337, 30735485, 30838812, 30913263, 31176759, 31204416, 31216264, 31311491, 31324181, 31449538, 31482741, 31656991, 31659105, 31750276, 31756645, 31765666, 31781179		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	20415685		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21619462, 26018909, 26235182, 26656720, 28506662, 29956809, 30429035		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	15886250		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	12663460, 15591515, 16989692, 17823431, 20041267, 21791204, 26897098, 26992300		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	20415685		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	19661131		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	29228174		★☆☆☆☆ Found in Text Mining only
Nuchal bleb, familial	Nuchal Bleb	BEFREE	10403784, 18681780		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10092513, 10403784, 11334417, 11549668, 11571669, 11700024, 11756320, 12086965, 12354786, 12429872, 12663465, 12750819, 12802337, 12829646, 12860835, 14671185, 14693717, 14764792, 15001639, 15047634, 15123570, 15149722, 15178661, 15583845, 15601956, 15616040, 15682645, 15725703, 15769985, 15843989, 15853826, 15897474, 16025741, 16028335, 16231017, 16418740, 16421345, 16443793, 16551730, 16581078, 16608891, 16648605, 16675483, 16756736, 16797099, 16801926, 16823476, 16891099, 16894363, 16899222, 16926524, 16933180, 16944773, 17052201, 17080261, 17112391, 17209173, 17284627, 17391161, 17495197, 17607322, 17684226, 17704301, 17705672, 17922949, 17932317, 17945166, 17991878, 17992633, 18027814, 18054335, 18070757, 18071343, 18182989, 18202126, 18311774, 18313838, 18381574, 18386294, 18397542, 18465144, 18472261, 18510797, 18719649, 18728122, 18777458, 18828732, 18988888, 19088327, 19116277, 19131459, 19138981, 19165155, 19227810, 19238139, 19322030, 19359061, 19369430, 19426517, 19490068, 19573164, 19634985, 19733160, 19747414, 19755407, 19760027, 19794286, 19818774, 19887569, 19893502, 19906806, 19929719, 20033714, 20061428, 20067957, 20201938, 20395949, 20399960, 20406164, 20466332, 20495294, 20561616, 20651470, 20697428, 20842437, 20846890, 21111705, 21139317, 21219602, 21224869, 21273992, 21397927, 21474811, 21574190, 21617638, 21660081, 21755292, 21829206, 21870907, 21916932, 21980131, 22038736, 22138143, 22147092, 22155316, 22161113, 22187345, 22193626, 22249290, 22272346, 22309242, 22327423, 22374249, 22391136, 22393448, 22450341, 22462604, 22594400, 22607892, 22767440, 22791750, 22948153, 23065236, 23108996, 23283133, 23374890, 23425917, 23470075, 23612446, 23624817, 23757803, 23805277, 23834543, 23845780, 23958652, 24034586, 24055485, 24105470, 24289790, 24417947, 24432991, 24449366, 24502610, 24549138, 24586568, 24636346, 24740426, 24796925, 25007742, 25123125, 25223469, 25453978, 25478993, 25575598, 25700032, 25759378, 25760548, 25772781, 25911279, 25929254, 26020766, 26078399, 26192702, 26196305, 26199115, 26243686, 26247729, 26290432, 26446643, 26455770, 26577083, 26598515, 26677772, 26740596, 27061803, 27083512, 27196486, 27236826, 27299582, 27388775, 27470682, 27487851, 27573980, 27629594, 27639310, 27720679, 27838444, 27841944, 27886379, 27928591, 28027637, 28096201, 28115224, 28139438, 28145500, 28226031, 28241462, 28256562, 28284726, 28285652, 28330882, 28332351, 28371297, 28411906, 28416193, 28421328, 28422056, 28439667, 28499669, 28513060, 28584304, 28585210, 28595178, 28635626, 28638270, 28693794, 28743061, 28749394, 28758947, 28763403, 28771179, 28888981, 28945274, 28946816, 28982776, 29016251, 29036907, 29054470, 29205099, 29213336, 29217381, 29278513, 29299904, 29313754, 29329236, 29331338, 29337272, 29344438, 29377113, 29395659, 29452073, 29497032, 29559003, 29573242, 29575057, 29655459, 29720688, 29723618, 29769704, 29856943, 29891216, 29907930, 29925443, 29975666, 30022055, 30027366, 30086171, 30174020, 30240442, 30265726, 30282888, 30309709, 30318936, 30324835, 30338401, 30346829, 30372704, 30379922, 30401008, 30416093, 30473057, 30474186, 30504920, 30530892, 30539776, 30584969, 30597304, 30653656, 30670780, 30672698, 30678182, 30692905, 30726580, 30732639, 30745818, 30760783, 30791536, 30816311, 30841005, 30843931, 30904536, 30967059, 30978696, 31042407, 31048658, 31071114, 31076636, 31090824, 31117266, 31130918, 31146419, 31174304, 31178129, 31204527, 31212761, 31216264, 31242268, 31337827, 31341853, 31364017, 31372167, 31410126, 31420057, 31484347, 31502880, 31533725, 31539673, 31551485, 31566247, 31639770, 31647300, 31654701, 31656991, 31659105, 31706980, 31731705, 31736971, 31765666, 31778708, 31845502, 9765595		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	10092513, 14617771		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	11469400, 15562250, 15761179, 16118250, 17184146, 18511057, 19672024, 20150288, 20825686, 21150884, 21273999, 21397613, 21558084, 22319581, 22545589, 22797373, 23283133, 23339001, 23535586, 23834543, 24586568, 24796925, 24969908, 28320058, 28771179, 29737494, 31533725, 31547312, 33750349, 38603890, 39658714	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	15547300, 15830179, 16210704, 16421345, 16443793, 16648605, 16926524, 17030959, 17224338, 17332688, 17495197, 17684226, 17705672, 18719649, 18827209, 18972601, 19079714, 19131459, 19165155, 19238139, 19426517, 19483724, 19755407, 19760027, 19887569, 19893502, 20035337, 20067957, 20168312, 20359719, 20382687, 20395949, 20418665, 20443850, 20466332, 20495294, 20576642, 20697428, 20814411, 20858286, 20887962, 20970753, 21218266, 21219602, 21273992, 21299716, 21357378, 21378472, 21397927, 21409316, 21617638, 21736829, 21755292, 21761356, 21829206, 22023374, 22038736, 22056417, 22161113, 22272346, 22309242, 22393448, 22443353, 22462604, 22791750, 23351195, 23624817, 23658423, 23756394, 23805277, 23950976, 24289790, 24427296, 24643166, 25022390, 25038177, 25224558, 25448795, 25759378, 25772781, 25929254, 26290432, 26374448, 26386690, 26598515, 26797284, 26884098, 27759977, 28027637, 28178338, 28195351, 28453464, 28602036, 28758947, 28947843, 29017362, 29073286, 29559003, 29645064, 30265726, 30379922, 30504920, 30572569, 30732639, 31115373, 31178129, 31547312, 31554182, 31659105, 31661820, 31978107, 32053666, 32076038, 32131811, 32398726, 32544194, 32685510, 33155222, 33319570, 33484170, 33983957, 34457110, 34642196, 34716426, 35250389, 35436947, 35457174, 35689735, 35703718, 35964108, 36126070, 36253437, 37149591, 37231745, 37715984, 37853077, 37901192, 38140287, 38172514, 39457458	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	15547300, 17209173, 18568135, 20460359, 26504811, 29645064	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	19887569, 23903497, 31608050	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	28947843, 29645064	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	32545403, 37266430	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	12870165, 15830179, 17607322, 18777458, 19011278, 19474520, 21240660, 26677772, 28049078, 28475159, 29645064, 30131311, 30309709, 31547312		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	16891099, 21194467, 24462671, 24667577, 32095874, 33484170	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	30777928, 39313801	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	24888493, 26544540, 28013331, 28831581, 29191221, 29335849, 30123499, 30777928, 31450004		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	27914707, 28811200, 31369758		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	18511746	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	21854818, 28448764, 28646476, 28975973, 29696936, 30679996, 31566247		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	34948648	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	31566247		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	16516410		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31690262	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	25700032		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	23579009	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	23370338		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25700032, 29603059, 30450532, 30967059		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29603059, 33921111	Associate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	19138981, 22415092		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21357378, 25051362, 25516658, 28096201, 29156726, 29777233, 30038429, 30745818		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28096201		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	29156726		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19051043, 21357378, 25408239, 25516658, 30038429, 30678425, 37555827	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	LHGDN	18376301		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	29723618		★☆☆☆☆ Found in Text Mining only
Paragangliomas 3	Paraganglioma	Pubtator	32396633	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	16814256		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	28765165, 29674409, 30508418		★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	BEFREE	29016783		★☆☆☆☆ Found in Text Mining only
Partial lipodystrophy	Partial Lipodystrophy	BEFREE	20097706		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	28096201		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	17030959, 19543786, 26192702, 28017965, 28052063, 29329827, 29684480, 30507998, 31714888, 31845423		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	37266648	Associate	★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	30711174		★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	30395653		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28662701, 30626266		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	33616153	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	23819115	Inhibit	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	23819115	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	23819115, 29543038, 30738358		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	36741233	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	23819115, 29543038		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	28667272		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	19672024		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	19672024	Associate	★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	30144414		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	28330882		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	12923129, 15178661, 15757855, 15862282, 15926113, 17562334, 17616856, 17706206, 18230834, 18997670		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	15178661, 15472214, 15590747, 15890734, 15926113, 16335909, 16675483, 17001470, 17562334, 17848407, 18230834, 19544118, 19700156, 20388053, 20530094, 20561616, 21082232, 21125210, 21419406, 21637951, 22074033, 22270872, 23118428, 23685884, 24260557, 24502610, 24559720, 25123125, 26631404, 27075719, 27473078, 27597432, 27824398, 27827322, 27960599, 28060790, 28332170, 28522293, 28790184, 28911368, 28946816, 29105398, 29155136, 29271278, 29344438, 29428305, 29428584, 29737802, 30318936, 30509295, 30540803, 30544235, 30623695, 30904998, 31022741, 31116958, 31122534, 31242787, 31346314, 31516017, 31661670, 31663293, 31781027, 31814467, 31823915		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	16335909, 19544118, 19700156, 20388053, 21082232, 24502610, 24559720, 26631404, 28060790, 29156452, 31242787, 31382403, 32283997, 33228780, 33750349, 33914321, 35689735, 39692030	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	23118428, 25423261, 25446648, 31814467, 35409282	Inhibit	★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	17337499		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28662456		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	LHGDN	15476445		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	15870134, 20061428, 25478934		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	28344417, 28356730		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	23370338		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	22213409, 23055000, 28421328, 29752657, 29758945		★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	15756215		★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	28224268		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16899222, 19676095, 20697428, 21397927, 21960694, 22249290, 22415092, 23225349, 25038177, 25586350, 25877612, 26320190, 27699825, 27768592, 28183249, 28453464, 29222347, 29465157, 30648824, 31147627		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16403434, 17465703, 17938644		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19035456, 21397927, 21960694, 25038177, 26160610, 26320190, 28453464	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	21960694		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	12694320, 16164660	Associate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	30547763	Stimulate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	18028320, 18029322, 18190648, 18773295, 22898488, 26293833, 26683021, 28267407		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	21681565, 33416099	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	24851032	Inhibit	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26123401, 26173479, 29232663, 29416693, 29432655, 31062065, 31090824, 31179792		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	29228174		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	24114971, 36157437, 40073405	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28604281, 29115380		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	32877226	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22881231, 22927754, 23209832, 26806298, 30338815	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21615510, 25945502		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	25945502		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rectal Carcinoma	Rectal Carcinoma	BEFREE	21749709, 31425509		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	31425509		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	20222108		★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	21829567		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17205522		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24096711, 25827778, 28123583, 28178338, 28484923, 29723618, 31215811, 31236331, 31401413		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	29723618		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	LHGDN	15920060, 17095862		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	24595307, 30210613		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	24586568		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	28708576		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	32567428	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	18680072, 23922494, 25169573		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	24141897		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	18710461		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	12833524		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17949565, 18799090, 19013427		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18395775, 20222108, 21073447, 22340319, 28079506, 28205390, 28752573, 29225423, 29422077, 29898766, 29940013, 30148441, 30376894, 30657068, 30919210, 31025923, 31152257, 31540528, 31563887		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rickets	Rickets	BEFREE	29271278		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	29723618		★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	40162588	Associate	★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	31276836		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20821366, 20832248, 25284335, 27885961, 28009525, 28315932, 29219062, 29625373, 31059867, 31276836		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	31667578	Inhibit	★☆☆☆☆ Found in Text Mining only
Secondary Adrenal Insufficiency	Adrenal Insufficiency	BEFREE	31290981		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	25580089	Inhibit	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28500919, 28919840, 30462773, 30524674, 31637623		★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	28513060, 31128439		★☆☆☆☆ Found in Text Mining only
Sialic Acid Storage Disease, Finnish Type (disorder)	Sialic Acid Storage Disease	BEFREE	28402255		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	16802369		★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	28428430, 28769120		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	20112400	Associate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	29422077, 31025923		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	15761179, 31008949, 33378050, 38172514	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	19090328	Inhibit	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep apnea	Pubtator	15761179, 19090328, 31008949	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	21139317		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	LHGDN	17033258, 18198351		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	18198351, 21139317, 22884135, 27470682, 28327146, 28341925, 28796077, 28982776, 29609563, 30032465, 30151379, 30684961, 31008949, 31210052, 31383242, 31441069, 31473914		★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	31383242		★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	28596789, 29274847, 29913483		★☆☆☆☆ Found in Text Mining only
Splenic Hypoplasia	Splenic Hypoplasia	BEFREE	27224208		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30640413		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23181352	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	23181352		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	28100880, 30779470		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	15591515, 15964656, 17625437, 18029322, 18190648, 18565022, 18773295, 19019483, 19474520, 20168312, 20573726, 21496456, 21791204, 22118966, 22327199, 22664476, 22898488, 23892696, 23948064, 24432991, 24528335, 25048195, 26042596, 27289142, 28128372, 28260907, 28267407, 28271033, 28574439, 28836350, 28849192, 28929125, 30541285, 30566857, 30968772, 31071311, 31167890, 31265993, 31324181, 31715215		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17459059, 18695895, 20336470, 25270251		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15701829, 18595130		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22078265, 35384390	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35691615	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	21155030, 23047599, 31412946	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	26760913		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	16802369		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	16802369		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	19883500, 20222108, 24434628	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	20222108, 24434628		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	27321124, 28667272, 30087356, 30784899, 31333350, 31667578		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	24324367		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	27154871, 30524674		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	14764816, 15886250		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	21937620, 33587254	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	21937620, 33587254	Inhibit	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	17618945, 28439190, 29410303		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28414093		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35964108	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36114448	Inhibit	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	20637208		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	29983357		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29033577		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	29870819, 30562581		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	23058473, 25049200	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34329197, 36218131	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	16055459		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	32396633	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	29718962	Inhibit	★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	31945100	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	12694320, 16855192, 18496510, 21397613, 25448795, 30572569, 30920415	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	14551151, 18174285, 23177015, 28919424		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	LHGDN	14551151, 17893004, 18670142		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	31667578	Inhibit	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	20016047	Inhibit	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	20814418	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	16648605	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	31533725	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitamin B 12 Deficiency	Vitamin b deficiency	Pubtator	38140305	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	29271278, 30881343		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	16806559		★☆☆☆☆ Found in Text Mining only