Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	2959
Gene name	General transcription factor IIB
Gene symbol	GTF2B
Synonyms (NCBI Gene)	TF2BTFIIB
Chromosome	1
Chromosome location	1p22.2
Summary	This gene encodes the general transcription factor IIB, one of the ubiquitous factors required for transcription initiation by RNA polymerase II. The protein localizes to the nucleus where it forms a complex (the DAB complex) with transcription factors II

186 Show/Hide all (186)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003079	hsa-miR-122-5p	qRT-PCR	18073344
MIRT003079	hsa-miR-122-5p	qRT-PCR	18073344
MIRT041771	hsa-miR-484	CLASH	23622248
MIRT540156	hsa-miR-4432	HITS-CLIP	23706177
MIRT541939	hsa-miR-508-5p	HITS-CLIP	23706177
MIRT540155	hsa-miR-3664-5p	HITS-CLIP	23706177
MIRT540154	hsa-miR-451b	HITS-CLIP	23706177
MIRT540153	hsa-miR-6501-3p	HITS-CLIP	23706177
MIRT540152	hsa-miR-6849-3p	HITS-CLIP	23706177
MIRT540151	hsa-miR-766-3p	HITS-CLIP	23706177
MIRT540150	hsa-miR-4742-3p	HITS-CLIP	23706177
MIRT540149	hsa-miR-4522	HITS-CLIP	23706177
MIRT540148	hsa-miR-4696	HITS-CLIP	23706177
MIRT540147	hsa-miR-3135a	HITS-CLIP	23706177
MIRT540146	hsa-miR-196a-3p	HITS-CLIP	23706177
MIRT540145	hsa-miR-6512-3p	HITS-CLIP	23706177
MIRT540143	hsa-miR-6720-5p	HITS-CLIP	23706177
MIRT544228	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT544227	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT544226	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT544225	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT544224	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT544223	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT544222	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT544221	hsa-miR-6507-3p	PAR-CLIP	21572407
MIRT544220	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT544219	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT544218	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT328931	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT544217	hsa-miR-3688-3p	PAR-CLIP	21572407
MIRT544216	hsa-miR-5093	PAR-CLIP	21572407
MIRT328925	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT544215	hsa-miR-3924	PAR-CLIP	21572407
MIRT540156	hsa-miR-4432	PAR-CLIP	21572407
MIRT541939	hsa-miR-508-5p	PAR-CLIP	21572407
MIRT540155	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT540154	hsa-miR-451b	PAR-CLIP	21572407
MIRT540153	hsa-miR-6501-3p	PAR-CLIP	21572407
MIRT540152	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT540151	hsa-miR-766-3p	PAR-CLIP	21572407
MIRT540150	hsa-miR-4742-3p	PAR-CLIP	21572407
MIRT540149	hsa-miR-4522	PAR-CLIP	21572407
MIRT540148	hsa-miR-4696	PAR-CLIP	21572407
MIRT540147	hsa-miR-3135a	PAR-CLIP	21572407
MIRT540146	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT540145	hsa-miR-6512-3p	PAR-CLIP	21572407
MIRT540143	hsa-miR-6720-5p	PAR-CLIP	21572407
MIRT540156	hsa-miR-4432	PAR-CLIP	21572407
MIRT540155	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT540154	hsa-miR-451b	PAR-CLIP	21572407
MIRT540153	hsa-miR-6501-3p	PAR-CLIP	21572407
MIRT540152	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT540151	hsa-miR-766-3p	PAR-CLIP	21572407
MIRT540150	hsa-miR-4742-3p	PAR-CLIP	21572407
MIRT540149	hsa-miR-4522	PAR-CLIP	21572407
MIRT540148	hsa-miR-4696	PAR-CLIP	21572407
MIRT540147	hsa-miR-3135a	PAR-CLIP	21572407
MIRT540146	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT540145	hsa-miR-6512-3p	PAR-CLIP	21572407
MIRT540143	hsa-miR-6720-5p	PAR-CLIP	21572407
MIRT540146	hsa-miR-196a-3p	PAR-CLIP	27292025
MIRT540146	hsa-miR-196a-3p	PAR-CLIP	27292025
MIRT540147	hsa-miR-3135a	PAR-CLIP	27292025
MIRT540147	hsa-miR-3135a	PAR-CLIP	27292025
MIRT540155	hsa-miR-3664-5p	PAR-CLIP	27292025
MIRT540155	hsa-miR-3664-5p	PAR-CLIP	27292025
MIRT540156	hsa-miR-4432	PAR-CLIP	27292025
MIRT540156	hsa-miR-4432	PAR-CLIP	27292025
MIRT540154	hsa-miR-451b	PAR-CLIP	27292025
MIRT540154	hsa-miR-451b	PAR-CLIP	27292025
MIRT540149	hsa-miR-4522	PAR-CLIP	27292025
MIRT540149	hsa-miR-4522	PAR-CLIP	27292025
MIRT540148	hsa-miR-4696	PAR-CLIP	27292025
MIRT540148	hsa-miR-4696	PAR-CLIP	27292025
MIRT540150	hsa-miR-4742-3p	PAR-CLIP	27292025
MIRT540150	hsa-miR-4742-3p	PAR-CLIP	27292025
MIRT540153	hsa-miR-6501-3p	PAR-CLIP	27292025
MIRT540153	hsa-miR-6501-3p	PAR-CLIP	27292025
MIRT540145	hsa-miR-6512-3p	PAR-CLIP	27292025
MIRT540145	hsa-miR-6512-3p	PAR-CLIP	27292025
MIRT540143	hsa-miR-6720-5p	PAR-CLIP	27292025
MIRT540143	hsa-miR-6720-5p	PAR-CLIP	27292025
MIRT540152	hsa-miR-6849-3p	PAR-CLIP	27292025
MIRT540152	hsa-miR-6849-3p	PAR-CLIP	27292025
MIRT540151	hsa-miR-766-3p	PAR-CLIP	27292025
MIRT540156	hsa-miR-4432	HITS-CLIP	23706177
MIRT541939	hsa-miR-508-5p	HITS-CLIP	23706177
MIRT540155	hsa-miR-3664-5p	HITS-CLIP	23706177
MIRT540154	hsa-miR-451b	HITS-CLIP	23706177
MIRT540153	hsa-miR-6501-3p	HITS-CLIP	23706177
MIRT540152	hsa-miR-6849-3p	HITS-CLIP	23706177
MIRT540151	hsa-miR-766-3p	HITS-CLIP	23706177
MIRT540150	hsa-miR-4742-3p	HITS-CLIP	23706177
MIRT540149	hsa-miR-4522	HITS-CLIP	23706177
MIRT540148	hsa-miR-4696	HITS-CLIP	23706177
MIRT540147	hsa-miR-3135a	HITS-CLIP	23706177
MIRT540146	hsa-miR-196a-3p	HITS-CLIP	23706177
MIRT540145	hsa-miR-6512-3p	HITS-CLIP	23706177
MIRT540143	hsa-miR-6720-5p	HITS-CLIP	23706177
MIRT544228	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT544227	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT544226	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT544225	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT544224	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT544223	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT544222	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT544221	hsa-miR-6507-3p	PAR-CLIP	21572407
MIRT544220	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT544219	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT544218	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT328931	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT544217	hsa-miR-3688-3p	PAR-CLIP	21572407
MIRT544216	hsa-miR-5093	PAR-CLIP	21572407
MIRT328925	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT544215	hsa-miR-3924	PAR-CLIP	21572407
MIRT540156	hsa-miR-4432	PAR-CLIP	21572407
MIRT541939	hsa-miR-508-5p	PAR-CLIP	21572407
MIRT540155	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT540154	hsa-miR-451b	PAR-CLIP	21572407
MIRT540153	hsa-miR-6501-3p	PAR-CLIP	21572407
MIRT540152	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT540151	hsa-miR-766-3p	PAR-CLIP	21572407
MIRT540150	hsa-miR-4742-3p	PAR-CLIP	21572407
MIRT540149	hsa-miR-4522	PAR-CLIP	21572407
MIRT540148	hsa-miR-4696	PAR-CLIP	21572407
MIRT540147	hsa-miR-3135a	PAR-CLIP	21572407
MIRT540146	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT540145	hsa-miR-6512-3p	PAR-CLIP	21572407
MIRT540143	hsa-miR-6720-5p	PAR-CLIP	21572407
MIRT540156	hsa-miR-4432	PAR-CLIP	21572407
MIRT540155	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT540154	hsa-miR-451b	PAR-CLIP	21572407
MIRT540153	hsa-miR-6501-3p	PAR-CLIP	21572407
MIRT540152	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT540151	hsa-miR-766-3p	PAR-CLIP	21572407
MIRT540150	hsa-miR-4742-3p	PAR-CLIP	21572407
MIRT540149	hsa-miR-4522	PAR-CLIP	21572407
MIRT540148	hsa-miR-4696	PAR-CLIP	21572407
MIRT540147	hsa-miR-3135a	PAR-CLIP	21572407
MIRT540146	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT540145	hsa-miR-6512-3p	PAR-CLIP	21572407
MIRT540143	hsa-miR-6720-5p	PAR-CLIP	21572407
MIRT1036714	hsa-miR-1	CLIP-seq
MIRT1036715	hsa-miR-206	CLIP-seq
MIRT1036716	hsa-miR-216a	CLIP-seq
MIRT1036717	hsa-miR-3136-3p	CLIP-seq
MIRT1036718	hsa-miR-3149	CLIP-seq
MIRT1036719	hsa-miR-3157-5p	CLIP-seq
MIRT1036720	hsa-miR-338-3p	CLIP-seq
MIRT1036721	hsa-miR-342-3p	CLIP-seq
MIRT1036722	hsa-miR-3673	CLIP-seq
MIRT1036723	hsa-miR-3922-5p	CLIP-seq
MIRT1036724	hsa-miR-3942-5p	CLIP-seq
MIRT1036725	hsa-miR-4308	CLIP-seq
MIRT1036726	hsa-miR-4310	CLIP-seq
MIRT1036727	hsa-miR-4480	CLIP-seq
MIRT1036728	hsa-miR-4690-3p	CLIP-seq
MIRT1036729	hsa-miR-4703-5p	CLIP-seq
MIRT1036730	hsa-miR-498	CLIP-seq
MIRT1036731	hsa-miR-511	CLIP-seq
MIRT1036732	hsa-miR-568	CLIP-seq
MIRT1036733	hsa-miR-578	CLIP-seq
MIRT1036734	hsa-miR-613	CLIP-seq
MIRT1036718	hsa-miR-3149	CLIP-seq
MIRT1036720	hsa-miR-338-3p	CLIP-seq
MIRT1036726	hsa-miR-4310	CLIP-seq
MIRT1036732	hsa-miR-568	CLIP-seq
MIRT2007361	hsa-miR-22	CLIP-seq
MIRT1036718	hsa-miR-3149	CLIP-seq
MIRT1036720	hsa-miR-338-3p	CLIP-seq
MIRT1036726	hsa-miR-4310	CLIP-seq
MIRT2007362	hsa-miR-4742-5p	CLIP-seq
MIRT2007363	hsa-miR-488	CLIP-seq
MIRT1036731	hsa-miR-511	CLIP-seq
MIRT1036732	hsa-miR-568	CLIP-seq
MIRT1036718	hsa-miR-3149	CLIP-seq
MIRT1036720	hsa-miR-338-3p	CLIP-seq
MIRT2240044	hsa-miR-371-5p	CLIP-seq
MIRT2240045	hsa-miR-371b-5p	CLIP-seq
MIRT2240046	hsa-miR-4272	CLIP-seq
MIRT1036726	hsa-miR-4310	CLIP-seq
MIRT2007362	hsa-miR-4742-5p	CLIP-seq
MIRT2007363	hsa-miR-488	CLIP-seq
MIRT2240047	hsa-miR-513c	CLIP-seq
MIRT2240048	hsa-miR-514b-5p	CLIP-seq
MIRT1036732	hsa-miR-568	CLIP-seq

Transcription factor	Regulation	Reference
RELA	Activation	7706261

64 Show/Hide all (64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000776	Component	Kinetochore	IEA
GO:0000793	Component	Condensed chromosome	IEA
GO:0000979	Function	RNA polymerase II core promoter sequence-specific DNA binding	IBA
GO:0000979	Function	RNA polymerase II core promoter sequence-specific DNA binding	IDA	7675079, 9420329, 10619841, 16230532
GO:0000993	Function	RNA polymerase II complex binding	IDA	8413225, 8504927
GO:0001174	Process	Transcriptional start site selection at RNA polymerase II promoter	IBA
GO:0001174	Process	Transcriptional start site selection at RNA polymerase II promoter	IMP	10318856
GO:0003677	Function	DNA binding	IEA
GO:0004402	Function	Histone acetyltransferase activity	IEA
GO:0005515	Function	Protein binding	IPI	1517211, 8006019, 8415761, 8504927, 8662660, 10330164, 10449590, 10619841, 12529369, 12552007, 12931194, 14644612, 15207618, 15207693, 25416956, 27193682, 29158257, 31515488, 32296183, 32814053, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9841876, 12931194
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005669	Component	Transcription factor TFIID complex	IDA	27193682
GO:0005694	Component	Chromosome	IDA	24441171
GO:0005694	Component	Chromosome	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006352	Process	DNA-templated transcription initiation	IBA
GO:0006352	Process	DNA-templated transcription initiation	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IDA	27193682
GO:0006366	Process	Transcription by RNA polymerase II	IMP	1517211, 1876184, 7601352, 8413225, 8515820, 8516312, 16230532
GO:0006366	Process	Transcription by RNA polymerase II	TAS	7671313
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IDA	3029109
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IMP	9420329, 12931194
GO:0006473	Process	Protein acetylation	IDA	12931194
GO:0008270	Function	Zinc ion binding	IDA	11045620
GO:0008270	Function	Zinc ion binding	IEA
GO:0010467	Process	Gene expression	IEA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IBA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IDA	27193682
GO:0016407	Function	Acetyltransferase activity	IBA
GO:0016604	Component	Nuclear body	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0017025	Function	TBP-class protein binding	IBA
GO:0017025	Function	TBP-class protein binding	IEA
GO:0017025	Function	TBP-class protein binding	IPI	9841876
GO:0019083	Process	Viral transcription	IDA	24441171
GO:0019083	Process	Viral transcription	IMP	14644612
GO:0032153	Component	Cell division site	IEA
GO:0032993	Component	Protein-DNA complex	IDA	8413225, 8515820, 8516312, 10619841, 29158257
GO:0042585	Component	Germinal vesicle	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046966	Function	Nuclear thyroid hormone receptor binding	IPI	8524305
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IBA
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IDA	3029109, 9841876
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IMP	8413225
GO:0051177	Process	Meiotic sister chromatid cohesion	IEA
GO:0051225	Process	Spindle assembly	IEA
GO:0051276	Process	Chromosome organization	IEA
GO:0061733	Function	Protein-lysine-acetyltransferase activity	IDA	12931194
GO:0061733	Function	Protein-lysine-acetyltransferase activity	IEA
GO:0070897	Process	Transcription preinitiation complex assembly	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	1876184, 3029109
GO:0090575	Component	RNA polymerase II transcription regulator complex	IMP	7601352
GO:0097550	Component	Transcription preinitiation complex	IBA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	9722567
GO:1904798	Process	Positive regulation of core promoter binding	IDA	9841876
GO:1990114	Process	RNA polymerase II core complex assembly	IBA
GO:1990114	Process	RNA polymerase II core complex assembly	IMP	8515820, 8516312
GO:1990841	Function	Promoter-specific chromatin binding	IDA	12931194, 24441171
GO:1990841	Function	Promoter-specific chromatin binding	IEA

MIM	HGNC	e!Ensembl
189963	4648	ENSG00000137947

Q00403

Protein name

Transcription initiation factor IIB (EC 2.3.1.48) (General transcription factor TFIIB) (S300-II)

Protein function

General transcription factor that plays a role in transcription initiation by RNA polymerase II (Pol II). Involved in the pre-initiation complex (PIC) formation and Pol II recruitment at promoter DNA (PubMed:12931194, PubMed:1517211, PubMed:1876

PDB

1C9B , 1DL6 , 1RLY , 1RO4 , 1TFB , 1VOL , 2PHG , 5IY6 , 5IY7 , 5IY8 , 5IY9 , 5IYA , 5IYB , 5IYC , 5IYD , 5WH1 , 6O9L , 7EDX , 7EG7 , 7EG8 , 7EG9 , 7EGA , 7EGB , 7EGC , 7ENA , 7ENC , 7LBM , 7NVR , 7NVS , 7NVT , 7NVU , 7NVY , 7NVZ , 7NW0 , 7ZWC , 7ZWD , 7ZX7 , 7ZX8 , 7ZXE , 8BVW , 8BYQ , 8BZ1 , 8GXQ , 8GXS , 8S51 , 8S52 , 8S5N , 8WAK , 8WAL , 8WAN , 8WAO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00382	TFIIB	121 → 191	Transcription factor TFIIB repeat	Domain
PF00382	TFIIB	215 → 285	Transcription factor TFIIB repeat	Domain
PF08271	TF_Zn_Ribbon	13 → 55	TFIIB zinc-binding	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the inner cell mass forming the embryoblast (PubMed:24441171). Not detected in cells from the outer thin layer trophoblast (at protein level) (PubMed:24441171). {ECO:0000269|PubMed:24441171}.

Sequence

MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKA
TKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKE
ITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEI
CAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV
ELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLF
PTDFKFDTPVDKLPQL

Sequence length

316

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Basal transcription factors	RNA Polymerase II Pre-transcription Events
Spinocerebellar ataxia	RNA polymerase II transcribes snRNA genes
Viral carcinogenesis	RNA Polymerase II Promoter Escape
	RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
	RNA Polymerase II Transcription Initiation
	RNA Polymerase II Transcription Initiation And Promoter Clearance

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (6)
CARDIOVASCULAR DISEASE	—	GWAS catalog	30595370	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	38965376, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	39966646	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (11)
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22194214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23055019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28501746, 31309477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23055019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	22194214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24738062, 28501746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24738062, 29025258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	10707958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29048667	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23550276		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
GTF2E1	[]	8	["Basal transcription factors","Viral carcinogenesis","RNA Polymerase II Pre-transcription Events","RNA polymerase II transcribes snRNA genes","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	[]
GTF2E2	[]	8	["Basal transcription factors","Viral carcinogenesis","RNA Polymerase II Pre-transcription Events","RNA polymerase II transcribes snRNA genes","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	[]
GTF2A1	[]	8	["Basal transcription factors","Viral carcinogenesis","RNA Polymerase II Pre-transcription Events","RNA polymerase II transcribes snRNA genes","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	[]
GTF2A2	[]	8	["Basal transcription factors","Viral carcinogenesis","RNA Polymerase II Pre-transcription Events","RNA polymerase II transcribes snRNA genes","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	[]
TAF5	[]	7	["Basal transcription factors","RNA Polymerase II Pre-transcription Events","RNA polymerase II transcribes snRNA genes","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	[]

GTF2B (general transcription factor IIB)

Bookmark This Gene