GTF2A2 (general transcription factor IIA subunit 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2958
• Gene name: General transcription factor IIA subunit 2
• Gene symbol: GTF2A2
• Synonyms (NCBI Gene): HsT18745, T18745, TF2A2, TFIIA, TFIIA-12, TFIIA-gamma, TFIIAS
• Chromosome: 15
• Chromosome location: 15q22.2
• Summary: Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and the general initiation factors TFIIA, TFIIB (MIM 189963), TFIID (MIM 313650), TFIIE (MIM 189962), TFIIF (MIM 18

miRNA Show/Hide all (94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029382	hsa-miR-26b-5p	Microarray	19088304
MIRT1036692	hsa-miR-1243	CLIP-seq
MIRT1036693	hsa-miR-128	CLIP-seq
MIRT1036694	hsa-miR-3144-3p	CLIP-seq
MIRT1036695	hsa-miR-326	CLIP-seq
MIRT1036696	hsa-miR-330-5p	CLIP-seq
MIRT1036697	hsa-miR-3613-5p	CLIP-seq
MIRT1036698	hsa-miR-3654	CLIP-seq
MIRT1036699	hsa-miR-369-3p	CLIP-seq
MIRT1036700	hsa-miR-374a	CLIP-seq
MIRT1036701	hsa-miR-374b	CLIP-seq
MIRT1036702	hsa-miR-382	CLIP-seq
MIRT1036703	hsa-miR-3940-5p	CLIP-seq
MIRT1036704	hsa-miR-4280	CLIP-seq
MIRT1036705	hsa-miR-4490	CLIP-seq
MIRT1036706	hsa-miR-4507	CLIP-seq
MIRT1036707	hsa-miR-4718	CLIP-seq
MIRT1036708	hsa-miR-4774-5p	CLIP-seq
MIRT1036709	hsa-miR-548m	CLIP-seq
MIRT1036710	hsa-miR-568	CLIP-seq
MIRT1036711	hsa-miR-584	CLIP-seq
MIRT1036712	hsa-miR-629	CLIP-seq
MIRT1036713	hsa-miR-890	CLIP-seq
MIRT1036703	hsa-miR-3940-5p	CLIP-seq
MIRT1036706	hsa-miR-4507	CLIP-seq
MIRT1036712	hsa-miR-629	CLIP-seq
MIRT2240017	hsa-miR-1278	CLIP-seq
MIRT2240018	hsa-miR-2276	CLIP-seq
MIRT2240019	hsa-miR-3149	CLIP-seq
MIRT2240020	hsa-miR-4772-3p	CLIP-seq
MIRT2240021	hsa-miR-4777-5p	CLIP-seq
MIRT2240022	hsa-miR-518d-5p	CLIP-seq
MIRT2240023	hsa-miR-519b-5p	CLIP-seq
MIRT2240024	hsa-miR-519c-5p	CLIP-seq
MIRT2240025	hsa-miR-520c-5p	CLIP-seq
MIRT2240026	hsa-miR-526a	CLIP-seq
MIRT2240027	hsa-miR-544	CLIP-seq
MIRT2240028	hsa-miR-548a-5p	CLIP-seq
MIRT2240029	hsa-miR-548ab	CLIP-seq
MIRT2240030	hsa-miR-548ak	CLIP-seq
MIRT2240031	hsa-miR-548b-5p	CLIP-seq
MIRT2240032	hsa-miR-548c-5p	CLIP-seq
MIRT2240033	hsa-miR-548d-5p	CLIP-seq
MIRT2240034	hsa-miR-548h	CLIP-seq
MIRT2240035	hsa-miR-548i	CLIP-seq
MIRT2240036	hsa-miR-548j	CLIP-seq
MIRT2240037	hsa-miR-548k	CLIP-seq
MIRT2240038	hsa-miR-548l	CLIP-seq
MIRT2240039	hsa-miR-548w	CLIP-seq
MIRT2240040	hsa-miR-548y	CLIP-seq
MIRT2240041	hsa-miR-559	CLIP-seq
MIRT2240042	hsa-miR-659	CLIP-seq
MIRT2240043	hsa-miR-9	CLIP-seq
MIRT2388832	hsa-miR-1297	CLIP-seq
MIRT2388833	hsa-miR-26a	CLIP-seq
MIRT2388834	hsa-miR-26b	CLIP-seq
MIRT2388835	hsa-miR-378	CLIP-seq
MIRT2388836	hsa-miR-378b	CLIP-seq
MIRT2388837	hsa-miR-378c	CLIP-seq
MIRT2388838	hsa-miR-378d	CLIP-seq
MIRT2388839	hsa-miR-378e	CLIP-seq
MIRT2388840	hsa-miR-378f	CLIP-seq
MIRT2388841	hsa-miR-378h	CLIP-seq
MIRT2388842	hsa-miR-378i	CLIP-seq
MIRT2388843	hsa-miR-3925-3p	CLIP-seq
MIRT2388844	hsa-miR-422a	CLIP-seq
MIRT2388845	hsa-miR-4465	CLIP-seq
MIRT2388846	hsa-miR-4691-5p	CLIP-seq
MIRT2388847	hsa-miR-500a	CLIP-seq
MIRT2543706	hsa-miR-1179	CLIP-seq
MIRT2543707	hsa-miR-203	CLIP-seq
MIRT2543708	hsa-miR-3153	CLIP-seq
MIRT2543709	hsa-miR-4326	CLIP-seq
MIRT2543710	hsa-miR-4668-5p	CLIP-seq
MIRT2543711	hsa-miR-4761-3p	CLIP-seq
MIRT2543712	hsa-miR-4766-5p	CLIP-seq
MIRT2543713	hsa-miR-488	CLIP-seq
MIRT2543714	hsa-miR-502-5p	CLIP-seq
MIRT2543715	hsa-miR-518a-5p	CLIP-seq
MIRT2543716	hsa-miR-527	CLIP-seq
MIRT2543706	hsa-miR-1179	CLIP-seq
MIRT2682189	hsa-miR-1279	CLIP-seq
MIRT2543707	hsa-miR-203	CLIP-seq
MIRT2543708	hsa-miR-3153	CLIP-seq
MIRT2543709	hsa-miR-4326	CLIP-seq
MIRT2543710	hsa-miR-4668-5p	CLIP-seq
MIRT2543711	hsa-miR-4761-3p	CLIP-seq
MIRT2543712	hsa-miR-4766-5p	CLIP-seq
MIRT2543713	hsa-miR-488	CLIP-seq
MIRT2543714	hsa-miR-502-5p	CLIP-seq
MIRT2543715	hsa-miR-518a-5p	CLIP-seq
MIRT2543716	hsa-miR-527	CLIP-seq
MIRT2682190	hsa-miR-586	CLIP-seq
MIRT2682191	hsa-miR-889	CLIP-seq

Gene ontology (GO) Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001091	Function	RNA polymerase II general transcription initiation factor binding	IPI	8626665
GO:0005515	Function	Protein binding	IPI	7724559, 8626665, 25416956, 28514442, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	10022900
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005669	Component	Transcription factor TFIID complex	IDA	27193682
GO:0005672	Component	Transcription factor TFIIA complex	IBA
GO:0005672	Component	Transcription factor TFIIA complex	IDA	7724559, 7958899, 7958900
GO:0005672	Component	Transcription factor TFIIA complex	IEA
GO:0005672	Component	Transcription factor TFIIA complex	IPI	8626665
GO:0005829	Component	Cytosol	IDA
GO:0006366	Process	Transcription by RNA polymerase II	IDA	7724559, 7958900, 8626665, 27193682
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IDA	7958899
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IEA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IBA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IDA	7958899, 27193682
GO:0017025	Function	TBP-class protein binding	IBA
GO:0017025	Function	TBP-class protein binding	IPI	7724559, 8626665
GO:0042803	Function	Protein homodimerization activity	IPI	8626665
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10022900
GO:0046982	Function	Protein heterodimerization activity	IPI	8626665
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IBA
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IDA	7958899, 8626665
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	NAS	8870495
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	IDA	11030333
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA

Other IDs

• MIM: 600519
• HGNC: 4647
• e!Ensembl: ENSG00000140307

Protein

• UniProt ID: P52657
• Protein name: Transcription initiation factor IIA subunit 2 (General transcription factor IIA subunit 2) (TFIIA p12 subunit) (TFIIA-12) (TFIIAS) (Transcription initiation factor IIA gamma chain) (TFIIA-gamma)
• Protein function: TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.
• PDB: 1NVP , 5FUR , 5IY6 , 5IY7 , 5IY8 , 5IY9 , 5IYA , 5IYB , 5IYC , 5IYD , 5M4S , 6MZM , 6O9L , 7EDX , 7EG7 , 7EG8 , 7EG9 , 7EGA , 7EGB , 7EGC , 7EGD , 7EGI , 7EGJ , 7ENA , 7ENC , 7LBM , 7NVR , 7NVS , 7NVT , 7NVU , 7NVY , 7NVZ , 7NW0 , 7ZWC , 7ZWD , 7ZX7 , 7ZX8 , 7ZXE , 8BVW , 8BYQ , 8BZ1 , 8GXQ , 8GXS , 8S51 , 8S52 , 8S5N , 8WAK , 8WAL , 8WAN , 8WAO , 8WAP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02268	TFIIA_gamma_N	2 → 48	Transcription initiation factor IIA, gamma subunit, helical domain	Domain
  PF02751	TFIIA_gamma_C	59 → 100	Transcription initiation factor IIA, gamma subunit	Domain

• Sequence:

  MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRG
  SLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

• Sequence length: 109

Pathways

KEGG Pathway	Reactome Pathway
Basal transcription factors	RNA Polymerase II Pre-transcription Events
Viral carcinogenesis	RNA polymerase II transcribes snRNA genes
	RNA Polymerase II Promoter Escape
	RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
	RNA Polymerase II Transcription Initiation
	RNA Polymerase II Transcription Initiation And Promoter Clearance
	Estrogen-dependent gene expression

Related Genes

Sort by: Blended Diseases Pathways Evidence source

GTF2A1 9 shared pathwaysBasal transcription factors, Viral carcinogenesis, RNA Polymerase II Pre-transcription Events, RNA polymerase II transcribes snRNA genes, RNA Polymerase II Promoter Escape, RNA Polymerase II Transcription Pre-Initiation And Promoter Opening, RNA Polymerase II Transcription Initiation, RNA Polymerase II Transcription Initiation And Promoter Clearance, Estrogen-dependent gene expression Related via 9 shared pathways including Basal transcription factors, Viral carcinogenesis. GTF2E1 8 shared pathwaysBasal transcription factors, Viral carcinogenesis, RNA Polymerase II Pre-transcription Events, RNA polymerase II transcribes snRNA genes, RNA Polymerase II Promoter Escape, RNA Polymerase II Transcription Pre-Initiation And Promoter Opening, RNA Polymerase II Transcription Initiation, RNA Polymerase II Transcription Initiation And Promoter Clearance Related via 8 shared pathways including Basal transcription factors, Viral carcinogenesis. GTF2E2 8 shared pathwaysBasal transcription factors, Viral carcinogenesis, RNA Polymerase II Pre-transcription Events, RNA polymerase II transcribes snRNA genes, RNA Polymerase II Promoter Escape, RNA Polymerase II Transcription Pre-Initiation And Promoter Opening, RNA Polymerase II Transcription Initiation, RNA Polymerase II Transcription Initiation And Promoter Clearance Related via 8 shared pathways including Basal transcription factors, Viral carcinogenesis. GTF2B 8 shared pathwaysBasal transcription factors, Viral carcinogenesis, RNA Polymerase II Pre-transcription Events, RNA polymerase II transcribes snRNA genes, RNA Polymerase II Promoter Escape, RNA Polymerase II Transcription Pre-Initiation And Promoter Opening, RNA Polymerase II Transcription Initiation, RNA Polymerase II Transcription Initiation And Promoter Clearance Related via 8 shared pathways including Basal transcription factors, Viral carcinogenesis. TAF5 7 shared pathwaysBasal transcription factors, RNA Polymerase II Pre-transcription Events, RNA polymerase II transcribes snRNA genes, RNA Polymerase II Promoter Escape, RNA Polymerase II Transcription Pre-Initiation And Promoter Opening, RNA Polymerase II Transcription Initiation, RNA Polymerase II Transcription Initiation And Promoter Clearance Related via 7 shared pathways including Basal transcription factors, RNA Polymerase II Pre-transcription Events.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GTF2A1	0	[]	9	["Basal transcription factors","Viral carcinogenesis","RNA Polymerase II Pre-transcription Events","RNA polymerase II transcribes snRNA genes","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance","Estrogen-dependent gene expression"]	0	[]
GTF2E1	0	[]	8	["Basal transcription factors","Viral carcinogenesis","RNA Polymerase II Pre-transcription Events","RNA polymerase II transcribes snRNA genes","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	0	[]
GTF2E2	0	[]	8	["Basal transcription factors","Viral carcinogenesis","RNA Polymerase II Pre-transcription Events","RNA polymerase II transcribes snRNA genes","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	0	[]
GTF2B	0	[]	8	["Basal transcription factors","Viral carcinogenesis","RNA Polymerase II Pre-transcription Events","RNA polymerase II transcribes snRNA genes","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	0	[]
TAF5	0	[]	7	["Basal transcription factors","RNA Polymerase II Pre-transcription Events","RNA polymerase II transcribes snRNA genes","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	0	[]

Diseases Linked via Similar Genes

Dandy-walker syndrome Linked via 1 of 5 related genesGTF2A1 Schizophrenia Linked via 1 of 5 related genesGTF2A1 Open angle glaucoma Linked via 1 of 5 related genesGTF2E2 Trichothiodystrophy Linked via 1 of 5 related genesGTF2E2 Cardiovascular disease Linked via 1 of 5 related genesGTF2B

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Dandy-walker syndrome	1	["GTF2A1"]
Schizophrenia	1	["GTF2A1"]
Open angle glaucoma	1	["GTF2E2"]
Trichothiodystrophy	1	["GTF2E2"]
Cardiovascular disease	1	["GTF2B"]