GRP (gastrin releasing peptide)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2922
• Gene name: Gastrin releasing peptide
• Gene symbol: GRP
• Synonyms (NCBI Gene): BN, GRP-10, preproGRP, proGRP
• Chromosome: 18
• Chromosome location: 18q21.32
• Summary: This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. The encoded preproprotein is proteolytically processed to generate two peptides, gastrin-releasing peptide and neuromedin-C. These peptides regulate numerous functions o

Gene ontology (GO) Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	NAS	3027901
GO:0005184	Function	Neuropeptide hormone activity	IBA
GO:0005184	Function	Neuropeptide hormone activity	IDA	8756537
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	3211139, 8756537
GO:0007165	Process	Signal transduction	NAS	3027901
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IDA	8756537
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034774	Component	Secretory granule lumen	ISS
GO:0035176	Process	Social behavior	IEA
GO:0036343	Process	Psychomotor behavior	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0043207	Process	Response to external biotic stimulus	IEA
GO:0043303	Process	Mast cell degranulation	IEA
GO:0043303	Process	Mast cell degranulation	ISS
GO:0051970	Process	Negative regulation of transmission of nerve impulse	ISS
GO:0090277	Process	Positive regulation of peptide hormone secretion	ISS
GO:1900738	Process	Positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:1900738	Process	Positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:1903942	Process	Positive regulation of respiratory gaseous exchange	IEA
GO:1903942	Process	Positive regulation of respiratory gaseous exchange	ISS
GO:2000987	Process	Positive regulation of behavioral fear response	IBA
GO:2000987	Process	Positive regulation of behavioral fear response	IEA
GO:2000987	Process	Positive regulation of behavioral fear response	ISS

Other IDs

• MIM: 137260
• HGNC: 4605
• e!Ensembl: ENSG00000134443

Protein

• UniProt ID: P07492
• Protein name: Gastrin-releasing peptide (GRP) [Cleaved into: Neuromedin-C (GRP-10) (GRP18-27)]
• Protein function: Stimulates the release of gastrin and other gastrointestinal hormones (By similarity). Contributes to the perception of prurient stimuli and to the transmission of itch signals in the spinal cord that promote scratching behavior (By similarity).
• PDB: 2N0B , 2N0C , 2N0D , 2N0E , 2N0F , 2N0G , 2N0H , 7W3Z , 8H0Q
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02044	Bombesin	41 → 54	Bombesin-like peptide	Family

• Sequence:

  MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSS
  VSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFK
  DVGSKGKVGRLSAPGSQREGRNPQLNQQ

• Sequence length: 148

Pathways

KEGG Pathway	Reactome Pathway
Neuroactive ligand-receptor interaction	Peptide ligand-binding receptors
	Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)
	G alpha (q) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (14)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
AMNESIA	—	CTD, Disgenet CTD, Disgenet	11564462	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMNESTIC DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	35512400	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	26192919, 37156999	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK NEOPLASMS	—	CTD	15342401	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	26192919, 37156999	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	26098869, 29422604, 30541042	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC DUCTAL ADENOCARCINOMA	—	GWAS catalog	30541042	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROLIFERATIVE DIABETIC RETINOPATHY	—	GWAS catalog	30487263	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRURITUS	—	CTD	29669290	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	30297969, 32541925, 35551307, 38374256, 38685053, 39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	32232851	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SEC11C 2 shared diseasesPancreatic cancer, Proliferative diabetic retinopathy 2 shared evidence sourcesGWAS catalog (Pancreatic cancer), GWAS catalog (Proliferative diabetic retinopathy) Related via 2 shared diseases including Pancreatic cancer, Proliferative diabetic retinopathy — evidence mostly GWAS catalog. NMB 1 shared diseasePruritus 2 shared pathwaysPeptide ligand-binding receptors, G alpha (q) signalling events 1 shared evidence sourceCTD (Pruritus) Related via 2 shared pathways including Peptide ligand-binding receptors, G alpha (q) signalling events — evidence mostly CTD. PROKR1 2 shared pathwaysPeptide ligand-binding receptors, G alpha (q) signalling events Related via 2 shared pathways including Peptide ligand-binding receptors, G alpha (q) signalling events. UTS2 2 shared pathwaysPeptide ligand-binding receptors, G alpha (q) signalling events Related via 2 shared pathways including Peptide ligand-binding receptors, G alpha (q) signalling events. PROKR2 2 shared pathwaysPeptide ligand-binding receptors, G alpha (q) signalling events Related via 2 shared pathways including Peptide ligand-binding receptors, G alpha (q) signalling events.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SEC11C	2	["Pancreatic cancer","Proliferative diabetic retinopathy"]	0	[]	2	["GWAS catalog (Pancreatic cancer)","GWAS catalog (Proliferative diabetic retinopathy)"]
NMB	1	["Pruritus"]	2	["Peptide ligand-binding receptors","G alpha (q) signalling events"]	1	["CTD (Pruritus)"]
PROKR1	0	[]	2	["Peptide ligand-binding receptors","G alpha (q) signalling events"]	0	[]
UTS2	0	[]	2	["Peptide ligand-binding receptors","G alpha (q) signalling events"]	0	[]
PROKR2	0	[]	2	["Peptide ligand-binding receptors","G alpha (q) signalling events"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 1 of 5 related genesSEC11C Prostate cancer Linked via 1 of 5 related genesSEC11C Dilated cardiomyopathy Linked via 1 of 5 related genesNMB Obesity Linked via 1 of 5 related genesNMB Schizophrenia Linked via 1 of 5 related genesNMB

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	1	["SEC11C"]
Prostate cancer	1	["SEC11C"]
Dilated cardiomyopathy	1	["NMB"]
Obesity	1	["NMB"]
Schizophrenia	1	["NMB"]