Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	2874
Gene name	G protein pathway suppressor 2
Gene symbol	GPS2
Synonyms (NCBI Gene)	AMF-1
Chromosome	17
Chromosome location	17p13.1
Summary	This gene encodes a protein involved in G protein-mitogen-activated protein kinase (MAPK) signaling cascades. When overexpressed in mammalian cells, this gene could potently suppress a RAS- and MAPK-mediated signal and interfere with JNK activity, suggest

8 Show/Hide all (8)

miRTarBase ID	miRNA	Experiments
MIRT1032364	hsa-miR-1207-5p	CLIP-seq
MIRT1032365	hsa-miR-34a	CLIP-seq
MIRT1032366	hsa-miR-34c-5p	CLIP-seq
MIRT1032367	hsa-miR-3927	CLIP-seq
MIRT1032368	hsa-miR-449a	CLIP-seq
MIRT1032369	hsa-miR-449b	CLIP-seq
MIRT1032370	hsa-miR-4736	CLIP-seq
MIRT1032371	hsa-miR-4763-3p	CLIP-seq

51 Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11931768, 19858209
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	19481530
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003714	Function	Transcription corepressor activity	IDA	11931768, 19858209
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0005095	Function	GTPase inhibitor activity	TAS	8943324
GO:0005515	Function	Protein binding	IPI	11931768, 16189514, 16980585, 17895379, 18985028, 19481530, 21240272, 21258344, 22190034, 22666460, 23752268, 25416956, 26070566, 28514442, 29892012, 31515488, 31980649, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	19858209, 29499132
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	29499132
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA	29499132
GO:0005829	Component	Cytosol	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007254	Process	JNK cascade	TAS	8943324
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IEA
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	ISS
GO:0010875	Process	Positive regulation of cholesterol efflux	IDA	19481530
GO:0017053	Component	Transcription repressor complex	IDA	12628926, 19858209
GO:0017053	Component	Transcription repressor complex	IEA
GO:0019216	Process	Regulation of lipid metabolic process	IEA
GO:0019216	Process	Regulation of lipid metabolic process	ISS
GO:0030183	Process	B cell differentiation	IEA
GO:0030183	Process	B cell differentiation	ISS
GO:0030332	Function	Cyclin binding	IPI	15159402
GO:0034122	Process	Negative regulation of toll-like receptor signaling pathway	IEA
GO:0034122	Process	Negative regulation of toll-like receptor signaling pathway	ISS
GO:0035360	Process	Positive regulation of peroxisome proliferator activated receptor signaling pathway	IEA
GO:0035360	Process	Positive regulation of peroxisome proliferator activated receptor signaling pathway	ISS
GO:0045598	Process	Regulation of fat cell differentiation	IEA
GO:0045598	Process	Regulation of fat cell differentiation	ISS
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19481530
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046329	Process	Negative regulation of JNK cascade	IDA	11931768
GO:0046329	Process	Negative regulation of JNK cascade	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IEA
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	ISS
GO:0098780	Process	Response to mitochondrial depolarisation	IEA
GO:0098780	Process	Response to mitochondrial depolarisation	ISS
GO:1900045	Process	Negative regulation of protein K63-linked ubiquitination	IEA
GO:1900045	Process	Negative regulation of protein K63-linked ubiquitination	ISS

MIM	HGNC	e!Ensembl
601935	4550	ENSG00000132522

Q13227

Protein name

G protein pathway suppressor 2 (GPS-2)

Protein function

Key regulator of inflammation, lipid metabolism and mitochondrion homeostasis that acts by inhibiting the activity of the ubiquitin-conjugating enzyme UBE2N/Ubc13, thereby inhibiting 'Lys-63'-linked ubiquitination (By similarity). In the nucleus

PDB

2L5G

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15991	G_path_suppress	5 → 294	G-protein pathway suppressor	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:8943324}.

Sequence

MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERM
SLEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSL
TVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQF
QGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQ
TGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGK
SGFAATSQPGPRLPFIQHSQNPRFYHK

Sequence length

327

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Human T-cell leukemia virus 1 infection	PPARA activates gene expression
	HDACs deacetylate histones
	NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux
	HCMV Early Events

GPS2 (G protein pathway suppressor 2)

Bookmark This Gene