Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	8841
Gene name	Histone deacetylase 3
Gene symbol	HDAC3
Synonyms (NCBI Gene)	HD3KDAC3RPD3RPD3-2
Chromosome	5
Chromosome location	5q31.3
Summary	Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene b

SNP ID	Visualize variation	Clinical significance	Consequence
rs1554216303	C>T	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs1554216308	T>C	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant

62 Show/Hide all (62)

miRTarBase ID	miRNA	Experiments	Reference
MIRT732569	hsa-miR-4286	ImmunofluorescenceLuciferase reporter assayWestern blotting	33973278
MIRT734466	hsa-miR-132-3p	MicroarrayRNA-seq	31669733
MIRT737020	hsa-miR-193b-3p	Western blottingqRT-PCR	32098619
MIRT1042435	hsa-miR-1261	CLIP-seq
MIRT1042436	hsa-miR-1915	CLIP-seq
MIRT1042437	hsa-miR-3124-3p	CLIP-seq
MIRT1042438	hsa-miR-324-5p	CLIP-seq
MIRT1042439	hsa-miR-3925-3p	CLIP-seq
MIRT1042440	hsa-miR-3927	CLIP-seq
MIRT1042441	hsa-miR-4257	CLIP-seq
MIRT1042442	hsa-miR-4690-3p	CLIP-seq
MIRT1042443	hsa-miR-4733-5p	CLIP-seq
MIRT1042444	hsa-miR-548ac	CLIP-seq
MIRT1042445	hsa-miR-548ae	CLIP-seq
MIRT1042446	hsa-miR-548aj	CLIP-seq
MIRT1042447	hsa-miR-548am	CLIP-seq
MIRT1042448	hsa-miR-548d-3p	CLIP-seq
MIRT1042449	hsa-miR-548x	CLIP-seq
MIRT1042450	hsa-miR-548z	CLIP-seq
MIRT1042451	hsa-miR-589	CLIP-seq
MIRT1042452	hsa-miR-765	CLIP-seq
MIRT1042453	hsa-miR-766	CLIP-seq
MIRT2008952	hsa-miR-1225-3p	CLIP-seq
MIRT2008953	hsa-miR-1258	CLIP-seq
MIRT2008954	hsa-miR-1321	CLIP-seq
MIRT2008955	hsa-miR-216a	CLIP-seq
MIRT2008956	hsa-miR-216b	CLIP-seq
MIRT2008957	hsa-miR-3127-3p	CLIP-seq
MIRT2008958	hsa-miR-3152-3p	CLIP-seq
MIRT2008959	hsa-miR-3162-5p	CLIP-seq
MIRT2008960	hsa-miR-4694-5p	CLIP-seq
MIRT2008961	hsa-miR-4739	CLIP-seq
MIRT2008962	hsa-miR-4756-5p	CLIP-seq
MIRT2008963	hsa-miR-4762-5p	CLIP-seq
MIRT2008964	hsa-miR-671-5p	CLIP-seq
MIRT1042453	hsa-miR-766	CLIP-seq
MIRT1042436	hsa-miR-1915	CLIP-seq
MIRT2241315	hsa-miR-3936	CLIP-seq
MIRT2241316	hsa-miR-4688	CLIP-seq
MIRT1042452	hsa-miR-765	CLIP-seq
MIRT2437560	hsa-miR-1236	CLIP-seq
MIRT2008956	hsa-miR-216b	CLIP-seq
MIRT2008963	hsa-miR-4762-5p	CLIP-seq
MIRT2437561	hsa-miR-670	CLIP-seq
MIRT2437560	hsa-miR-1236	CLIP-seq
MIRT2008956	hsa-miR-216b	CLIP-seq
MIRT2008963	hsa-miR-4762-5p	CLIP-seq
MIRT2437561	hsa-miR-670	CLIP-seq
MIRT2545021	hsa-miR-1231	CLIP-seq
MIRT2545022	hsa-miR-362-5p	CLIP-seq
MIRT2545023	hsa-miR-4288	CLIP-seq
MIRT2545024	hsa-miR-4742-3p	CLIP-seq
MIRT2545025	hsa-miR-500b	CLIP-seq
MIRT2545026	hsa-miR-501-5p	CLIP-seq
MIRT2545027	hsa-miR-632	CLIP-seq
MIRT2545021	hsa-miR-1231	CLIP-seq
MIRT2545022	hsa-miR-362-5p	CLIP-seq
MIRT2545023	hsa-miR-4288	CLIP-seq
MIRT2545024	hsa-miR-4742-3p	CLIP-seq
MIRT2545025	hsa-miR-500b	CLIP-seq
MIRT2545026	hsa-miR-501-5p	CLIP-seq
MIRT2545027	hsa-miR-632	CLIP-seq

Transcription factor	Regulation	Reference
HDAC4	Unknown	11804585
YY1	Unknown	19279113

113 Show/Hide all (113)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IBA
GO:0000118	Component	Histone deacetylase complex	IDA	18326024
GO:0000118	Component	Histone deacetylase complex	TAS	12711221
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	16569215, 18417529, 18854353
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	12628926
GO:0000132	Process	Establishment of mitotic spindle orientation	IDA	34608293
GO:0000132	Process	Establishment of mitotic spindle orientation	IDA	34608293
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	IEA
GO:0001222	Function	Transcription corepressor binding	IEA
GO:0001222	Function	Transcription corepressor binding	IPI	10898795, 12535528
GO:0001701	Process	In utero embryonic development	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	25190803
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	16569215, 18417529
GO:0003682	Function	Chromatin binding	IEA
GO:0003714	Function	Transcription corepressor activity	IDA	16569215, 18417529
GO:0003714	Function	Transcription corepressor activity	IMP	12628926
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0004407	Function	Histone deacetylase activity	IBA
GO:0004407	Function	Histone deacetylase activity	IDA	28497810
GO:0004407	Function	Histone deacetylase activity	IEA
GO:0004407	Function	Histone deacetylase activity	IEA
GO:0004407	Function	Histone deacetylase activity	IMP	16924111, 18326024
GO:0004407	Function	Histone deacetylase activity	TAS	10777477, 12711221
GO:0005515	Function	Protein binding	IPI	11006275, 11013263, 11259576, 11641274, 11861901, 15016912, 15194749, 15805470, 16432238, 16461912, 16569215, 16847267, 16917504, 16924111, 16980585, 17053781, 17075044, 17172643, 17895379, 17956988, 18279852, 18854353, 19409814, 20385135, 21030595, 21258344, 21624135, 21914818, 221
GO:0005634	Component	Nucleus	IDA	18326024, 18347167, 21030595
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9501169, 12711221
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	25190803
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	12711221
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA	21030595
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006325	Process	Chromatin organization	TAS	12711221
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006476	Process	Protein deacetylation	IDA	21030595
GO:0007346	Process	Regulation of mitotic cell cycle	IEA
GO:0008544	Process	Epidermis development	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010832	Process	Negative regulation of myotube differentiation	IMP	10983972
GO:0016787	Function	Hydrolase activity	IEA
GO:0017053	Component	Transcription repressor complex	IDA	11804585, 12628926, 16569215, 18417529
GO:0019213	Function	Deacetylase activity	IEA
GO:0019899	Function	Enzyme binding	IPI	11641274
GO:0030332	Function	Cyclin binding	IPI	18417529
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	ISS
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0031647	Process	Regulation of protein stability	IDA	25190803
GO:0031667	Process	Response to nutrient levels	IEA
GO:0032008	Process	Positive regulation of TOR signaling	IMP	25190803
GO:0032692	Process	Negative regulation of interleukin-1 production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0033558	Function	Protein lysine deacetylase activity	IDA	15653507, 17172643, 25301942
GO:0033558	Function	Protein lysine deacetylase activity	IEA
GO:0033558	Function	Protein lysine deacetylase activity	TAS
GO:0036211	Process	Protein modification process	IEA
GO:0040014	Process	Regulation of multicellular organism growth	IEA
GO:0040029	Process	Epigenetic regulation of gene expression	IBA
GO:0042307	Process	Positive regulation of protein import into nucleus	IDA	25190803
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042826	Function	Histone deacetylase binding	IPI	10869435, 12590135, 23867755
GO:0043066	Process	Negative regulation of apoptotic process	TAS	10777477
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	16924111
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	25190803
GO:0046329	Process	Negative regulation of JNK cascade	IMP	11931768
GO:0046826	Process	Negative regulation of protein export from nucleus	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0051020	Function	GTPase binding	IEA
GO:0051059	Function	NF-kappaB binding	IPI	17785205
GO:0051225	Process	Spindle assembly	IMP	18326024
GO:0060816	Process	Random inactivation of X chromosome	IEA
GO:0061351	Process	Neural precursor cell proliferation	IEA
GO:0061436	Process	Establishment of skin barrier	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEA
GO:0071374	Process	Cellular response to parathyroid hormone stimulus	IEA
GO:0071498	Process	Cellular response to fluid shear stress	IDA	25190803
GO:0071548	Process	Response to dexamethasone	IEA
GO:0072686	Component	Mitotic spindle	IDA	18326024
GO:0110076	Process	Negative regulation of ferroptosis	IDA	35922516
GO:0110076	Process	Negative regulation of ferroptosis	IMP	31634899
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	28614293
GO:0140297	Function	DNA-binding transcription factor binding	TAS	12711221
GO:0140861	Process	DNA repair-dependent chromatin remodeling	IDA	25301942
GO:0141221	Function	Histone deacetylase activity, hydrolytic mechanism	IEA
GO:0160008	Function	Protein decrotonylase activity	IDA	34608293
GO:0160008	Function	Protein decrotonylase activity	IEA
GO:0160009	Function	Histone decrotonylase activity	IDA	22230954, 28497810
GO:0160009	Function	Histone decrotonylase activity	IEA
GO:0160010	Function	Protein de-2-hydroxyisobutyrylase activity	IDA	29192674
GO:0160010	Function	Protein de-2-hydroxyisobutyrylase activity	IEA
GO:0160020	Process	Positive regulation of ferroptosis	IMP	39881208
GO:0160216	Function	Protein lysine delactylase activity	IDA	35044827, 38961290
GO:0160216	Function	Protein lysine delactylase activity	IEA
GO:1903575	Process	Cornified envelope assembly	IEA
GO:1990381	Function	Ubiquitin-specific protease binding	IEA
GO:2000676	Process	Positive regulation of type B pancreatic cell apoptotic process	IEA
GO:2000726	Process	Negative regulation of cardiac muscle cell differentiation	IEA

MIM	HGNC	e!Ensembl
605166	4854	ENSG00000171720

O15379

Protein name

Histone deacetylase 3 (HD3) (EC 3.5.1.98) (Protein deacetylase HDAC3) (EC 3.5.1.-) (Protein deacylase HDAC3) (EC 3.5.1.-) (RPD3-2) (SMAP45)

Protein function

Histone deacetylase that catalyzes the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4), and some other non-histone substrates (PubMed:21030595, PubMed:21444723, PubMed:23911289, PubMed:25301942,

PDB

4A69

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00850	Hist_deacetyl	22 → 314	Histone deacetylase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:9464271}.

Sequence

MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI

Sequence length

428

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Neutrophil extracellular trap formation	PPARA activates gene expression
Thyroid hormone signaling pathway	Transcriptional activation of mitochondrial biogenesis
Alcoholism	Constitutive Signaling by NOTCH1 PEST Domain Mutants
Viral carcinogenesis	Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
	HDACs deacetylate histones
	Notch-HLH transcription pathway
	Transcriptional regulation of white adipocyte differentiation
	Regulation of lipid metabolism by PPARalpha
	Circadian Clock
	NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux
	HCMV Early Events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (9)
ATRIAL FIBRILLATION	—	GWAS catalog	40645996	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ependymoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASES	—	CTD, Disgenet CTD, Disgenet	18625706	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	GWAS catalog	39047730	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	39047730	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	34973135	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (198)
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	20636436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16533812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	22116549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28771976, 30397132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	26531724		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30670333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20026773, 25007801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27457515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30402512	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17007107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	21143702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	20026773, 25007801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30321539		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21346816, 27457515		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	22002311, 23079660, 30824609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	31510852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	32686908	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25678599, 28436938, 29680858, 29963106, 31015230, 31084542, 31701491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17699109, 20473547, 23627572, 29680858, 31084542, 32455774, 32686908, 33962648, 37414914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	34658308	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	34980138	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23894374, 37632052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25940092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21206745, 25892518, 32021097, 34319031, 35187863, 37632052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27342975, 27758890	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30258097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	18714364, 24774302	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19099586, 33137873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17387270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	26329135, 28533215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25007801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	31510852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30906786, 31512115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	30347434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28569784, 29245911, 30866966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	28697498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	23893747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	29363667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28416226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22237050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	23275209, 26993378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28729730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30809639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16533812, 18789002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	16533812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	16533812	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17849419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	18769117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27864346, 29233468, 29484387, 29558042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16533812, 18769117, 24324066, 29558042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18347167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	28819194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	27705912, 28569784, 29245911, 29484415, 30866966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	26420484, 30127218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital malrotation of intestine	Congenital malrotation of intestine	BEFREE	26420484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	32513988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	34980138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31481898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	22679019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24811789, 28106794, 28860191, 29464997, 29634312, 30906786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24811789, 28106794, 28860191, 29464997, 29634312, 30906786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27904654	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30139387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24811789, 28533215, 28860191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24120624, 27904654, 30139387, 31101061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	28533215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	33096729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	22116549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenitis	Duodenitis	Pubtator	16533812	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	37373058	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21543766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30626716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25644061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25644061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25644061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	31025088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	25666992, 28916805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30975991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	19778726		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	19778726, 20098685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27632183, 30775317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27632183, 30775317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17007107, 25940092, 30053564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	17007107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17007107, 25940092, 35545840, 37528157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30654849	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	CTD_human_DG	18625706		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Diseases	Hematologic disease	Pubtator	36293392	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	29680858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	37632052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	29481474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	18762557, 22590724, 28729730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	22741533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	22349439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	30323246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	28123935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	37048093	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	27233998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28352664, 28729730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30262728, 31570593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	22679019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	27904654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	30664766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	29680858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	19099586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	31761932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	36497061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	35371279, 36894687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29781401, 34016956, 34665271, 36424383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35371279	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	36894687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27764807, 28462918, 29262547, 29494986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	21406501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20731616, 21075309, 21206745, 22322234, 23954442, 25892518, 26704017, 27179445, 27342975, 29540666, 30328580, 31097476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	25892518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	26993378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20563766, 30258097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24441677	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	25611806	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25521755, 26918727	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	27733359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	34658308	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	23894374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25678599, 28436938, 29680858, 29963106, 31015230, 31084542, 31701491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25644061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	21075309, 23879963, 29540666, 31097476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27986747, 30258097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17387270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25070540, 26745602, 30670333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20568894, 29523594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28951520, 30537988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	30583572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16044157, 18789002, 19430493, 20417177, 22002311, 22006862, 23149916, 24482232, 24594842, 25138213, 27279362, 27986747, 28106794, 29115379, 29464997 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16533812, 18789002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29680858		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25521755, 30936219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25521755, 25836739, 30936219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	29376873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29757434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	29439356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	37655754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	CLINVAR_DG	10491319, 10748092, 10860984, 10944117, 11509652, 11742974, 15837933, 15897262, 17158926, 17416969, 18830415, 19109904, 20691407, 21545841, 22230954 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	20351311, 23913134, 28490812, 31142847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23913134, 25482492, 36846090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21346816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21346816	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16022908, 17007107, 20484017, 21206745, 23402757, 24419085, 25521755, 26745602, 28569784, 29115379, 29540666, 29558042, 30709805, 30824609, 30936219, 31186684, 31192452 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	31561534		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	27662443, 30347434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24419085, 25196196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	38063204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28106794, 29464997, 29486577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	30664766		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuropathy	Neuropathy	BEFREE	30517863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30975991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23867991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	30975991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29689264, 31390528, 31757939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	37174649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	30347434	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31054509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28984297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	17387270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17387270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25070540, 26745602, 30670333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20484017, 25275504, 26918727, 32398667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	31693860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31693860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	22349439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	24895125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20568894, 29523594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18212746, 22531786, 25991668, 27462923, 35468964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37373058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	30692512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	30459282, 31113472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21952924, 27457515, 30402512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17961987, 20471694, 23857786, 25445625, 27573569, 28300292		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	17961987, 20471694, 25196196, 25445625		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	17961987	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	29233468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	24594842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 7	Spinocerebellar Ataxia	BEFREE	24160175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	26531724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25644061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36505439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	31192452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25666992, 28916805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28951520, 30537988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28951520, 34284078	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombosis	Thrombosis	Pubtator	17675290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28923385, 28943357, 30781804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35035776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	27250763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	22029821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	18714364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	35332245	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	36293392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum Complementation Group C	Xeroderma pigmentosum	Pubtator	32527949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HDAC3 (histone deacetylase 3)

Bookmark This Gene