GPR139 (G protein-coupled receptor 139)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 124274
Gene name G protein-coupled receptor 139
Gene symbol GPR139
Synonyms (NCBI Gene)
GPRg1PGR3
Chromosome 16
Chromosome location 16p12.3
Summary This gene encodes a member of the rhodopsin family of G-protein-coupled receptors. The encoded protein is almost exclusively expressed in the central nervous system. L-tryptophan and L-phenylalanine may act as the physiologic ligands of the encoded protei
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0007165 Process Signal transduction IEA
GO:0007186 Process G protein-coupled receptor signaling pathway IDA 15845401
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618448 19995 ENSG00000180269
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6DWJ6
Protein name Probable G-protein coupled receptor 139 (G(q)-coupled orphan receptor GPRg1) (G-protein-coupled receptor PGR3)
Protein function Orphan receptor. Seems to act through a G(q/11)-mediated pathway.
PDB 7VUG , 7VUH , 7VUI , 7VUJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 43 → 285 7 transmembrane receptor (rhodopsin family) Family
Tissue specificity TISSUE SPECIFICITY: Expressed almost exclusively in the brain. Detected at very low levels in the peripheral tissues. {ECO:0000269|PubMed:15845401}.
Sequence 
MEHTHAHLAANSSLSWWSPGSACGLGFVPVVYYSLLLCLGLPANILTVIILSQLVARRQK
SSYNYLLALAAADILVLFFIVFVDFLLEDFILNMQMPQVPDKIIEVLEFSSIHTSIWITV
PLTIDRYIAVCHPLKYHTVSYPARTRKVIVSVYITCFLTSIPYYWWPNIWTEDYISTSVH
HVLIWIHCFTVYLVPCSIFFILNSIIVYKLRRKSNFRLRGYSTGKTTAILFTITSIFATL
WAPRIIMILYHLYGAPIQNRWLVHIMSDIANMLALLNTAINFFLYCFISKRFRTMAAATL
KAFFKCQKQPVQFYTNHNFSITSSPWISPANSHCIKMLVYQYDKNGKPIKVSP
Sequence length 353
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
14
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (14)
Phenotype Name Clinical Significance Source Reference Evidence Score
ANAL POLYP — GWAS catalog 39024449
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS — GWAS catalog 39024449
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER — GWAS catalog 23527680
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS — GWAS catalog 38965376
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
INSOMNIA — GWAS catalog 30804565, 35835914, 37106081
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Auditory Perceptual Disorders Auditory perceptual disorder Pubtator 23527680 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma Pubtator 34238116 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Metabolic Diseases Metabolic Diseases BEFREE 28442765
★★★★★
★☆☆☆☆
Found in Text Mining only
Parkinson Disease Parkinson disease BEFREE 28442765
★★★★★
★☆☆☆☆
Found in Text Mining only
Squamous cell carcinoma of esophagus Esophagus Neoplasm BEFREE 31303787
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
GPRC5B 2 shared diseasesAnal polyp, Obsessive-compulsive disorder 2 shared evidence sourcesGWAS catalog (Anal polyp), GWAS catalog (Obsessive-compulsive disorder) Related via 2 shared diseases including Anal polyp, Obsessive-compulsive disorder — evidence mostly GWAS catalog. GRHL1 2 shared diseasesDiabetes mellitus, Obsessive-compulsive disorder 2 shared evidence sourcesGWAS catalog (Diabetes mellitus), GWAS catalog (Obsessive-compulsive disorder) Related via 2 shared diseases including Diabetes mellitus, Obsessive-compulsive disorder — evidence mostly GWAS catalog. ACTR5 2 shared diseasesObsessive-compulsive disorder, Willis-ekbom disease 2 shared evidence sourcesGWAS catalog (Obsessive-compulsive disorder), GWAS catalog (Willis-ekbom disease) Related via 2 shared diseases including Obsessive-compulsive disorder, Willis-ekbom disease — evidence mostly GWAS catalog. ENOX1 2 shared diseasesObsessive-compulsive disorder, Willis-ekbom disease 2 shared evidence sourcesGWAS catalog (Obsessive-compulsive disorder), GWAS catalog (Willis-ekbom disease) Related via 2 shared diseases including Obsessive-compulsive disorder, Willis-ekbom disease — evidence mostly GWAS catalog. RFLNA 2 shared diseasesDiabetes mellitus, Willis-ekbom disease 2 shared evidence sourcesGWAS catalog (Diabetes mellitus), GWAS catalog (Willis-ekbom disease) Related via 2 shared diseases including Diabetes mellitus, Willis-ekbom disease — evidence mostly GWAS catalog.
Major depressive disorder Linked via 3 of 5 related genesACTR5, ENOX1, RFLNA Schizophrenia Linked via 3 of 5 related genesACTR5, ENOX1, RFLNA Atrial fibrillation Linked via 2 of 5 related genesGRHL1, RFLNA Coronary artery disease Linked via 2 of 5 related genesGRHL1, RFLNA Anorexia nervosa Linked via 2 of 5 related genesACTR5, ENOX1