Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	79913
Gene name	Actin related protein 5
Gene symbol	ACTR5
Synonyms (NCBI Gene)	Arp5INO80M
Chromosome	20
Chromosome location	20q11.23

77 Show/Hide all (77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022807	hsa-miR-124-3p	Proteomics	18668037
MIRT029776	hsa-miR-26b-5p	Microarray	19088304
MIRT707037	hsa-miR-140-5p	HITS-CLIP	21572407
MIRT707036	hsa-miR-4781-3p	HITS-CLIP	21572407
MIRT707035	hsa-miR-6499-3p	HITS-CLIP	21572407
MIRT707034	hsa-miR-3135b	HITS-CLIP	21572407
MIRT707033	hsa-miR-504-3p	HITS-CLIP	21572407
MIRT707032	hsa-miR-122-5p	HITS-CLIP	21572407
MIRT707030	hsa-miR-3652	HITS-CLIP	21572407
MIRT707031	hsa-miR-4430	HITS-CLIP	21572407
MIRT707029	hsa-miR-143-5p	HITS-CLIP	21572407
MIRT707028	hsa-miR-6501-5p	HITS-CLIP	21572407
MIRT707027	hsa-miR-4423-5p	HITS-CLIP	21572407
MIRT707026	hsa-miR-337-3p	HITS-CLIP	21572407
MIRT707025	hsa-miR-202-5p	HITS-CLIP	21572407
MIRT707024	hsa-miR-487a-5p	HITS-CLIP	21572407
MIRT707023	hsa-miR-487b-5p	HITS-CLIP	21572407
MIRT707022	hsa-miR-744-3p	HITS-CLIP	21572407
MIRT707021	hsa-miR-5698	HITS-CLIP	21572407
MIRT707037	hsa-miR-140-5p	HITS-CLIP	21572407
MIRT707036	hsa-miR-4781-3p	HITS-CLIP	21572407
MIRT707035	hsa-miR-6499-3p	HITS-CLIP	21572407
MIRT707034	hsa-miR-3135b	HITS-CLIP	21572407
MIRT707033	hsa-miR-504-3p	HITS-CLIP	21572407
MIRT707032	hsa-miR-122-5p	HITS-CLIP	21572407
MIRT707030	hsa-miR-3652	HITS-CLIP	21572407
MIRT707031	hsa-miR-4430	HITS-CLIP	21572407
MIRT707029	hsa-miR-143-5p	HITS-CLIP	21572407
MIRT707028	hsa-miR-6501-5p	HITS-CLIP	21572407
MIRT707027	hsa-miR-4423-5p	HITS-CLIP	21572407
MIRT707026	hsa-miR-337-3p	HITS-CLIP	21572407
MIRT707025	hsa-miR-202-5p	HITS-CLIP	21572407
MIRT707024	hsa-miR-487a-5p	HITS-CLIP	21572407
MIRT707023	hsa-miR-487b-5p	HITS-CLIP	21572407
MIRT707022	hsa-miR-744-3p	HITS-CLIP	21572407
MIRT707021	hsa-miR-5698	HITS-CLIP	21572407
MIRT764730	hsa-miR-122	CLIP-seq
MIRT764731	hsa-miR-1227	CLIP-seq
MIRT764732	hsa-miR-186	CLIP-seq
MIRT764733	hsa-miR-1909	CLIP-seq
MIRT764734	hsa-miR-27a	CLIP-seq
MIRT764735	hsa-miR-27b	CLIP-seq
MIRT764736	hsa-miR-326	CLIP-seq
MIRT764737	hsa-miR-330-5p	CLIP-seq
MIRT764738	hsa-miR-3662	CLIP-seq
MIRT764739	hsa-miR-4252	CLIP-seq
MIRT764740	hsa-miR-4436b-3p	CLIP-seq
MIRT764741	hsa-miR-513a-5p	CLIP-seq
MIRT764742	hsa-miR-548u	CLIP-seq
MIRT764743	hsa-miR-552	CLIP-seq
MIRT764744	hsa-miR-764	CLIP-seq
MIRT764730	hsa-miR-122	CLIP-seq
MIRT764734	hsa-miR-27a	CLIP-seq
MIRT764735	hsa-miR-27b	CLIP-seq
MIRT764741	hsa-miR-513a-5p	CLIP-seq
MIRT764730	hsa-miR-122	CLIP-seq
MIRT764734	hsa-miR-27a	CLIP-seq
MIRT764735	hsa-miR-27b	CLIP-seq
MIRT764741	hsa-miR-513a-5p	CLIP-seq
MIRT764730	hsa-miR-122	CLIP-seq
MIRT764734	hsa-miR-27a	CLIP-seq
MIRT764735	hsa-miR-27b	CLIP-seq
MIRT1925298	hsa-miR-3657	CLIP-seq
MIRT1925299	hsa-miR-3664-5p	CLIP-seq
MIRT1925300	hsa-miR-3909	CLIP-seq
MIRT1925301	hsa-miR-4669	CLIP-seq
MIRT1925302	hsa-miR-4691-5p	CLIP-seq
MIRT764741	hsa-miR-513a-5p	CLIP-seq
MIRT1925303	hsa-miR-592	CLIP-seq
MIRT1925304	hsa-miR-599	CLIP-seq
MIRT1925305	hsa-miR-665	CLIP-seq
MIRT764730	hsa-miR-122	CLIP-seq
MIRT764734	hsa-miR-27a	CLIP-seq
MIRT764735	hsa-miR-27b	CLIP-seq
MIRT764741	hsa-miR-513a-5p	CLIP-seq
MIRT764743	hsa-miR-552	CLIP-seq
MIRT764744	hsa-miR-764	CLIP-seq

31 Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000723	Process	Telomere maintenance	ISO
GO:0005515	Function	Protein binding	IPI	16230350, 18163988, 19014934, 20855601, 26496610, 29643506, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	18026119, 19014934
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19014934
GO:0005737	Component	Cytoplasm	IEA
GO:0006259	Process	DNA metabolic process	IEA
GO:0006275	Process	Regulation of DNA replication	IMP	25016522
GO:0006281	Process	DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	ISO
GO:0006302	Process	Double-strand break repair	IMP	19014934
GO:0006310	Process	DNA recombination	IEA
GO:0006338	Process	Chromatin remodeling	IDA	21303910
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006974	Process	DNA damage response	IEA
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0031011	Component	Ino80 complex	IBA
GO:0031011	Component	Ino80 complex	IDA	18026119, 21303910
GO:0033044	Process	Regulation of chromosome organization	IEA
GO:0033044	Process	Regulation of chromosome organization	IMP	26340092
GO:0045739	Process	Positive regulation of DNA repair	ISO
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	27641337
GO:0045935	Process	Positive regulation of nucleobase-containing compound metabolic process	IEA
GO:0045995	Process	Regulation of embryonic development	ISO
GO:0051052	Process	Regulation of DNA metabolic process	IEA
GO:0051726	Process	Regulation of cell cycle	IMP	26340092
GO:0060382	Process	Regulation of DNA strand elongation	IMP	25016522
GO:0070914	Process	UV-damage excision repair	IMP	20855601
GO:1904507	Process	Positive regulation of telomere maintenance in response to DNA damage	ISO

MIM	HGNC	e!Ensembl
619730	14671	ENSG00000101442

Q9H9F9

Protein name

Actin-related protein 5 (hARP5) (Sarcoma antigen NY-SAR-16)

Protein function

Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. Involved in DNA double-strand break repair and UV-damage excision repair. {ECO:0000269|Pu

PDB

6HTS , 7ZI4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00022	Actin	30 → 570	Actin	Family

Sequence

MAANVFPFRDARAAPDPVLEAGPVAHGPLPVPLVLDNGSFQVRAGWACPGQDPGPEPRLQ
FRAVCARGRGGARGASGPQVGNALGSLEPLRWMLRSPFDRNVPVNLELQELLLDYSFQHL
GVSSQGCVDHPIVLTEAVCNPLYSRQMMSELLFECYGIPKVAYGIDSLFSFYHNKPKNSM
CSGLIISSGYQCTHVLPILEGRLDAKNCKRINLGGSQAAGYLQRLLQLKYPGHLAAITLS
RMEEILHEHSYIAEDYVEELHKWRCPDYYENNVHKMQLPFSSKLLGSTLTSEEKQERRQQ
QLRRLQELNARRREEKLQLDQERLDRLLYVQELLEDGQMDQFHKALIELNMDSPEELQSY
IQKLSIAVEQAKQKILQAEVNLEVDVVDSKPETPDLEQLEPSLEDVESMNDFDPLFSEET
PGVEKPVTTVQPVFNLAAYHQLFVGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYP
KDIQEMLVQNVFLTGGNTMYPGMKARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDW
ALNHLDDNEVWITRKEYEEKGGEYLKEHCASNIYVPIRLPKQASRSSDAQASSKGSAAGG
GGAGEQA

Sequence length

607

Interactions

View interactions

KEGG Pathway	Reactome Pathway
ATP-dependent chromatin remodeling	UCH proteinases
	DNA Damage Recognition in GG-NER

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (10)
ANOREXIA NERVOSA	—	GWAS catalog	31835028, 33686288, 36137488	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	31835028, 33686288	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	28540026, 31835028	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	31835028	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	30643256, 31835028, 33483693, 38177345	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	36137488	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	31835028, 36137488	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	38839884	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	28540026, 30285260, 31740837, 31835028, 32606422, 33686288, 36137488, 39753749	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	31835028	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Glioblastoma Multiforme	Glioblastoma	BEFREE	19941032	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	GWASCAT_DG	28918882	★★★★★ ★☆☆☆☆ Found in Text Mining only

ACTR5 (actin related protein 5)

Save This Analysis