GPR119 (G protein-coupled receptor 119)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 139760
Gene name G protein-coupled receptor 119
Gene symbol GPR119
Synonyms (NCBI Gene)
GPCR2
Chromosome X
Chromosome location Xq26.1
Summary This gene encodes a member of the rhodopsin subfamily of G-protein-coupled receptors that is expressed in the pancreas and gastrointestinal tract. The encoded protein is activated by lipid amides including lysophosphatidylcholine and oleoylethanolamide an
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16 Show/Hide all (16)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004930 Function G protein-coupled receptor activity IBA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IBA
GO:0005886 Component Plasma membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300513 19060 ENSG00000147262
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TDV5
Protein name Glucose-dependent insulinotropic receptor (G-protein coupled receptor 119)
Protein function Receptor for the endogenous fatty-acid ethanolamide oleoylethanolamide (OEA) and lysophosphatidylcholine (LPC). Functions as a glucose-dependent insulinotropic receptor. The activity of this receptor is mediated by G proteins which activate aden
PDB 7WCM , 7WCN , 7XZ5 , 7XZ6 , 8VHF , 8ZR5 , 8ZRK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 21 → 279 7 transmembrane receptor (rhodopsin family) Family
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in the pancreas, especially in the islets. {ECO:0000269|PubMed:15607732}.
Sequence 
MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISG
LLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGF
VAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLL
FVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTP
FLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKV
LTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG
Sequence length 335
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
cAMP signaling pathway Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)
Insulin secretion Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP)
Sort by:
FFAR1 3 shared pathwaysInsulin secretion, Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1), Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP) Related via 3 shared pathways including Insulin secretion, Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1). GIP 3 shared pathwayscAMP signaling pathway, Insulin secretion, Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP) Related via 3 shared pathways including cAMP signaling pathway, Insulin secretion. DPP4 2 shared pathwaysSynthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1), Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP) Related via 2 shared pathways including Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1), Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP). PAX6 2 shared pathwaysSynthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1), Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP) Related via 2 shared pathways including Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1), Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP). ADCYAP1 2 shared pathwayscAMP signaling pathway, Insulin secretion Related via 2 shared pathways including cAMP signaling pathway, Insulin secretion.
Diabetes mellitus type 2 Linked via 4 of 5 related genesFFAR1, GIP, DPP4, PAX6 Major depressive disorder Linked via 3 of 5 related genesDPP4, PAX6, ADCYAP1 Schizophrenia Linked via 3 of 5 related genesDPP4, PAX6, ADCYAP1 Insomnia Linked via 2 of 5 related genesGIP, PAX6 Obesity Linked via 2 of 5 related genesGIP, ADCYAP1