Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	2788
Gene name	G protein subunit gamma 7
Gene symbol	GNG7
Synonyms (NCBI Gene)	HG3B
Chromosome	19
Chromosome location	19p13.3

220 Show/Hide all (220)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049296	hsa-miR-92a-3p	CLASH	23622248
MIRT734968	hsa-miR-183-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)	33139493
MIRT735086	hsa-miR-876-5p	Luciferase reporter assayWestern blottingqRT-PCR	34221006
MIRT755527	hsa-miR-146a-3p	qRT-PCRRNA-seqELISA	34728702
MIRT1024550	hsa-miR-1224-5p	CLIP-seq
MIRT1024551	hsa-miR-127-3p	CLIP-seq
MIRT1024552	hsa-miR-129-5p	CLIP-seq
MIRT1024553	hsa-miR-1827	CLIP-seq
MIRT1024554	hsa-miR-1908	CLIP-seq
MIRT1024555	hsa-miR-22	CLIP-seq
MIRT1024556	hsa-miR-2467-3p	CLIP-seq
MIRT1024557	hsa-miR-3122	CLIP-seq
MIRT1024558	hsa-miR-3136-3p	CLIP-seq
MIRT1024559	hsa-miR-3150b-3p	CLIP-seq
MIRT1024560	hsa-miR-3160-3p	CLIP-seq
MIRT1024561	hsa-miR-3167	CLIP-seq
MIRT1024562	hsa-miR-3175	CLIP-seq
MIRT1024563	hsa-miR-328	CLIP-seq
MIRT1024564	hsa-miR-3612	CLIP-seq
MIRT1024565	hsa-miR-3613-3p	CLIP-seq
MIRT1024566	hsa-miR-3650	CLIP-seq
MIRT1024567	hsa-miR-3689a-3p	CLIP-seq
MIRT1024568	hsa-miR-3689c	CLIP-seq
MIRT1024569	hsa-miR-371-5p	CLIP-seq
MIRT1024570	hsa-miR-371b-5p	CLIP-seq
MIRT1024571	hsa-miR-3913-5p	CLIP-seq
MIRT1024572	hsa-miR-3915	CLIP-seq
MIRT1024573	hsa-miR-3929	CLIP-seq
MIRT1024574	hsa-miR-3934	CLIP-seq
MIRT1024575	hsa-miR-3942-3p	CLIP-seq
MIRT1024576	hsa-miR-4257	CLIP-seq
MIRT1024577	hsa-miR-4258	CLIP-seq
MIRT1024578	hsa-miR-4267	CLIP-seq
MIRT1024579	hsa-miR-4300	CLIP-seq
MIRT1024580	hsa-miR-4324	CLIP-seq
MIRT1024581	hsa-miR-4329	CLIP-seq
MIRT1024582	hsa-miR-4419b	CLIP-seq
MIRT1024583	hsa-miR-4450	CLIP-seq
MIRT1024584	hsa-miR-4474-5p	CLIP-seq
MIRT1024585	hsa-miR-4478	CLIP-seq
MIRT1024586	hsa-miR-4487	CLIP-seq
MIRT1024587	hsa-miR-4525	CLIP-seq
MIRT1024588	hsa-miR-4648	CLIP-seq
MIRT1024589	hsa-miR-4649-3p	CLIP-seq
MIRT1024590	hsa-miR-4654	CLIP-seq
MIRT1024591	hsa-miR-4655-5p	CLIP-seq
MIRT1024592	hsa-miR-4689	CLIP-seq
MIRT1024593	hsa-miR-4706	CLIP-seq
MIRT1024594	hsa-miR-4707-3p	CLIP-seq
MIRT1024595	hsa-miR-4720-3p	CLIP-seq
MIRT1024596	hsa-miR-4722-5p	CLIP-seq
MIRT1024597	hsa-miR-4728-5p	CLIP-seq
MIRT1024598	hsa-miR-4730	CLIP-seq
MIRT1024599	hsa-miR-4738-3p	CLIP-seq
MIRT1024600	hsa-miR-4740-3p	CLIP-seq
MIRT1024601	hsa-miR-4746-3p	CLIP-seq
MIRT1024602	hsa-miR-4749-5p	CLIP-seq
MIRT1024603	hsa-miR-4768-3p	CLIP-seq
MIRT1024604	hsa-miR-4769-5p	CLIP-seq
MIRT1024605	hsa-miR-4784	CLIP-seq
MIRT1024606	hsa-miR-4792	CLIP-seq
MIRT1024607	hsa-miR-4798-3p	CLIP-seq
MIRT1024608	hsa-miR-4804-3p	CLIP-seq
MIRT1024609	hsa-miR-485-5p	CLIP-seq
MIRT1024610	hsa-miR-541	CLIP-seq
MIRT1024611	hsa-miR-548c-3p	CLIP-seq
MIRT1024612	hsa-miR-552	CLIP-seq
MIRT1024613	hsa-miR-558	CLIP-seq
MIRT1024614	hsa-miR-603	CLIP-seq
MIRT1024615	hsa-miR-650	CLIP-seq
MIRT1024616	hsa-miR-654-5p	CLIP-seq
MIRT1024617	hsa-miR-663	CLIP-seq
MIRT1024618	hsa-miR-668	CLIP-seq
MIRT1024619	hsa-miR-920	CLIP-seq
MIRT1024620	hsa-miR-940	CLIP-seq
MIRT1024551	hsa-miR-127-3p	CLIP-seq
MIRT1024553	hsa-miR-1827	CLIP-seq
MIRT2003860	hsa-miR-24	CLIP-seq
MIRT1024556	hsa-miR-2467-3p	CLIP-seq
MIRT1024557	hsa-miR-3122	CLIP-seq
MIRT2003861	hsa-miR-3150a-3p	CLIP-seq
MIRT1024562	hsa-miR-3175	CLIP-seq
MIRT2003862	hsa-miR-3178	CLIP-seq
MIRT1024564	hsa-miR-3612	CLIP-seq
MIRT1024567	hsa-miR-3689a-3p	CLIP-seq
MIRT1024568	hsa-miR-3689c	CLIP-seq
MIRT1024571	hsa-miR-3913-5p	CLIP-seq
MIRT2003863	hsa-miR-3926	CLIP-seq
MIRT1024573	hsa-miR-3929	CLIP-seq
MIRT1024576	hsa-miR-4257	CLIP-seq
MIRT1024577	hsa-miR-4258	CLIP-seq
MIRT1024578	hsa-miR-4267	CLIP-seq
MIRT2003864	hsa-miR-4284	CLIP-seq
MIRT2003865	hsa-miR-4292	CLIP-seq
MIRT2003866	hsa-miR-4308	CLIP-seq
MIRT1024582	hsa-miR-4419b	CLIP-seq
MIRT1024584	hsa-miR-4474-5p	CLIP-seq
MIRT1024585	hsa-miR-4478	CLIP-seq
MIRT2003867	hsa-miR-4486	CLIP-seq
MIRT2003868	hsa-miR-4497	CLIP-seq
MIRT1024589	hsa-miR-4649-3p	CLIP-seq
MIRT1024591	hsa-miR-4655-5p	CLIP-seq
MIRT1024594	hsa-miR-4707-3p	CLIP-seq
MIRT2003869	hsa-miR-4715-3p	CLIP-seq
MIRT1024595	hsa-miR-4720-3p	CLIP-seq
MIRT1024596	hsa-miR-4722-5p	CLIP-seq
MIRT1024597	hsa-miR-4728-5p	CLIP-seq
MIRT1024600	hsa-miR-4740-3p	CLIP-seq
MIRT1024601	hsa-miR-4746-3p	CLIP-seq
MIRT1024603	hsa-miR-4768-3p	CLIP-seq
MIRT1024608	hsa-miR-4804-3p	CLIP-seq
MIRT1024609	hsa-miR-485-5p	CLIP-seq
MIRT1024610	hsa-miR-541	CLIP-seq
MIRT2003870	hsa-miR-548s	CLIP-seq
MIRT1024613	hsa-miR-558	CLIP-seq
MIRT1024614	hsa-miR-603	CLIP-seq
MIRT1024615	hsa-miR-650	CLIP-seq
MIRT1024616	hsa-miR-654-5p	CLIP-seq
MIRT2003871	hsa-miR-661	CLIP-seq
MIRT2003872	hsa-miR-939	CLIP-seq
MIRT1024620	hsa-miR-940	CLIP-seq
MIRT2236631	hsa-miR-1179	CLIP-seq
MIRT2236632	hsa-miR-1234	CLIP-seq
MIRT1024553	hsa-miR-1827	CLIP-seq
MIRT1024556	hsa-miR-2467-3p	CLIP-seq
MIRT1024560	hsa-miR-3160-3p	CLIP-seq
MIRT2236633	hsa-miR-323b-3p	CLIP-seq
MIRT2236634	hsa-miR-330-3p	CLIP-seq
MIRT1024564	hsa-miR-3612	CLIP-seq
MIRT2003863	hsa-miR-3926	CLIP-seq
MIRT1024573	hsa-miR-3929	CLIP-seq
MIRT1024576	hsa-miR-4257	CLIP-seq
MIRT1024578	hsa-miR-4267	CLIP-seq
MIRT1024582	hsa-miR-4419b	CLIP-seq
MIRT2236635	hsa-miR-4422	CLIP-seq
MIRT2236636	hsa-miR-4433	CLIP-seq
MIRT2236637	hsa-miR-4459	CLIP-seq
MIRT1024584	hsa-miR-4474-5p	CLIP-seq
MIRT1024585	hsa-miR-4478	CLIP-seq
MIRT1024586	hsa-miR-4487	CLIP-seq
MIRT1024589	hsa-miR-4649-3p	CLIP-seq
MIRT1024591	hsa-miR-4655-5p	CLIP-seq
MIRT1024596	hsa-miR-4722-5p	CLIP-seq
MIRT1024601	hsa-miR-4746-3p	CLIP-seq
MIRT1024603	hsa-miR-4768-3p	CLIP-seq
MIRT1024606	hsa-miR-4792	CLIP-seq
MIRT1024609	hsa-miR-485-5p	CLIP-seq
MIRT2236638	hsa-miR-548ac	CLIP-seq
MIRT2236639	hsa-miR-548ae	CLIP-seq
MIRT2236640	hsa-miR-548aj	CLIP-seq
MIRT2236641	hsa-miR-548am	CLIP-seq
MIRT2236642	hsa-miR-548d-3p	CLIP-seq
MIRT2003870	hsa-miR-548s	CLIP-seq
MIRT2236643	hsa-miR-548x	CLIP-seq
MIRT2236644	hsa-miR-548z	CLIP-seq
MIRT1024613	hsa-miR-558	CLIP-seq
MIRT1024615	hsa-miR-650	CLIP-seq
MIRT2236645	hsa-miR-873	CLIP-seq
MIRT1024620	hsa-miR-940	CLIP-seq
MIRT1024577	hsa-miR-4258	CLIP-seq
MIRT1024578	hsa-miR-4267	CLIP-seq
MIRT1024584	hsa-miR-4474-5p	CLIP-seq
MIRT1024594	hsa-miR-4707-3p	CLIP-seq
MIRT1024595	hsa-miR-4720-3p	CLIP-seq
MIRT1024608	hsa-miR-4804-3p	CLIP-seq
MIRT1024614	hsa-miR-603	CLIP-seq
MIRT2437450	hsa-miR-615-5p	CLIP-seq
MIRT1024553	hsa-miR-1827	CLIP-seq
MIRT1024564	hsa-miR-3612	CLIP-seq
MIRT1024591	hsa-miR-4655-5p	CLIP-seq
MIRT2450457	hsa-miR-4684-5p	CLIP-seq
MIRT1024596	hsa-miR-4722-5p	CLIP-seq
MIRT1024603	hsa-miR-4768-3p	CLIP-seq
MIRT1024611	hsa-miR-548c-3p	CLIP-seq
MIRT1024615	hsa-miR-650	CLIP-seq
MIRT1024620	hsa-miR-940	CLIP-seq
MIRT2540545	hsa-miR-1256	CLIP-seq
MIRT1024553	hsa-miR-1827	CLIP-seq
MIRT1024564	hsa-miR-3612	CLIP-seq
MIRT1024565	hsa-miR-3613-3p	CLIP-seq
MIRT2540546	hsa-miR-370	CLIP-seq
MIRT1024569	hsa-miR-371-5p	CLIP-seq
MIRT1024570	hsa-miR-371b-5p	CLIP-seq
MIRT2540547	hsa-miR-4314	CLIP-seq
MIRT1024591	hsa-miR-4655-5p	CLIP-seq
MIRT2540548	hsa-miR-4667-5p	CLIP-seq
MIRT2450457	hsa-miR-4684-5p	CLIP-seq
MIRT2540549	hsa-miR-4700-5p	CLIP-seq
MIRT2540550	hsa-miR-4720-5p	CLIP-seq
MIRT1024596	hsa-miR-4722-5p	CLIP-seq
MIRT1024599	hsa-miR-4738-3p	CLIP-seq
MIRT1024603	hsa-miR-4768-3p	CLIP-seq
MIRT2540551	hsa-miR-4799-3p	CLIP-seq
MIRT1024611	hsa-miR-548c-3p	CLIP-seq
MIRT2540552	hsa-miR-637	CLIP-seq
MIRT1024615	hsa-miR-650	CLIP-seq
MIRT2540553	hsa-miR-670	CLIP-seq
MIRT1024620	hsa-miR-940	CLIP-seq
MIRT2540545	hsa-miR-1256	CLIP-seq
MIRT1024553	hsa-miR-1827	CLIP-seq
MIRT1024564	hsa-miR-3612	CLIP-seq
MIRT1024565	hsa-miR-3613-3p	CLIP-seq
MIRT2540546	hsa-miR-370	CLIP-seq
MIRT1024569	hsa-miR-371-5p	CLIP-seq
MIRT1024570	hsa-miR-371b-5p	CLIP-seq
MIRT2540547	hsa-miR-4314	CLIP-seq
MIRT1024591	hsa-miR-4655-5p	CLIP-seq
MIRT2540548	hsa-miR-4667-5p	CLIP-seq
MIRT2450457	hsa-miR-4684-5p	CLIP-seq
MIRT2540549	hsa-miR-4700-5p	CLIP-seq
MIRT2540550	hsa-miR-4720-5p	CLIP-seq
MIRT1024596	hsa-miR-4722-5p	CLIP-seq
MIRT1024599	hsa-miR-4738-3p	CLIP-seq
MIRT1024603	hsa-miR-4768-3p	CLIP-seq
MIRT2540551	hsa-miR-4799-3p	CLIP-seq
MIRT1024611	hsa-miR-548c-3p	CLIP-seq
MIRT2540552	hsa-miR-637	CLIP-seq
MIRT1024615	hsa-miR-650	CLIP-seq
MIRT2540553	hsa-miR-670	CLIP-seq
MIRT1024620	hsa-miR-940	CLIP-seq

17 Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001662	Process	Behavioral fear response	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005834	Component	Heterotrimeric G-protein complex	IBA
GO:0005834	Component	Heterotrimeric G-protein complex	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	9600093
GO:0016020	Component	Membrane	IEA
GO:0031681	Function	G-protein beta-subunit binding	IBA
GO:0031681	Function	G-protein beta-subunit binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145

MIM	HGNC	e!Ensembl
604430	4410	ENSG00000176533

O60262

Protein name

Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7

Protein function

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G prote

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00631	G-gamma	3 → 68	GGL domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a variety of tissues. Down-regulated in pancreatic and esophageal cancer. {ECO:0000269|PubMed:18219292}.

Sequence

MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFK
DKKPCIIL

Sequence length

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Ras signaling pathway	Activation of G protein gated Potassium channels
Chemokine signaling pathway	Glucagon signaling in metabolic regulation
Hormone signaling	G-protein activation
PI3K-Akt signaling pathway	Glucagon-like Peptide-1 (GLP1) regulates insulin secretion
Apelin signaling pathway	ADP signalling through P2Y purinoceptor 12
Circadian entrainment	G beta:gamma signalling through PI3Kgamma
Retrograde endocannabinoid signaling	Prostacyclin signalling through prostacyclin receptor
Glutamatergic synapse	Adrenaline,noradrenaline inhibits insulin secretion
Cholinergic synapse	Ca2+ pathway
Serotonergic synapse	G alpha (q) signalling events
GABAergic synapse	G alpha (12/13) signalling events
Dopaminergic synapse	G beta:gamma signalling through PLC beta
Olfactory transduction	G alpha (s) signalling events
Relaxin signaling pathway	ADP signalling through P2Y purinoceptor 1
Morphine addiction	G alpha (i) signalling events
Alcoholism	G alpha (z) signalling events
Human cytomegalovirus infection	Glucagon-type ligand receptors
Kaposi sarcoma-associated herpesvirus infection	Thromboxane signalling through TP receptor
Human immunodeficiency virus 1 infection	Vasopressin regulates renal water homeostasis via Aquaporins
Pathways in cancer	Thrombin signalling through proteinase activated receptors (PARs)
	Presynaptic function of Kainate receptors
	Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding
	G beta:gamma signalling through BTK
	G beta:gamma signalling through CDC42
	Extra-nuclear estrogen signaling
	ADORA2B mediated anti-inflammatory cytokines production
	Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (8)
ALZHEIMER DISEASE	—	GWAS catalog	39998322	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASM	—	GWAS catalog	36077729	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	18219292	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLBLADDER DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	38104120	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	26198764, 31740837, 35396580	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (29)
Alzheimer Disease	Alzheimer disease	Pubtator	32525932	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30945310, 37704946	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36938730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	31092297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	32525932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35545337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30945310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	18219292		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	18219292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	22183866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22183866	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23403885	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Hematuria	Pubtator	37704946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	18671701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	31092297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	22183866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	18219292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	18219292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	18219292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22183866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	35572732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22183866, 30945310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34650124	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	35432200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22183866	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23403885, 35240924	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	22183866, 23403885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36863706	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
GNB2	[]	44	["Ras signaling pathway","Chemokine signaling pathway","Hormone signaling","Apelin signaling pathway","Circadian entrainment","Retrograde endocannabinoid signaling","Glutamatergic synapse","Cholinergic synapse","Serotonergic synapse","GABAergic synapse","Dopaminergic synapse","Relaxin signaling pathway"]	[]
GNG3	[]	44	["Ras signaling pathway","Chemokine signaling pathway","Hormone signaling","Apelin signaling pathway","Circadian entrainment","Retrograde endocannabinoid signaling","Glutamatergic synapse","Cholinergic synapse","Serotonergic synapse","GABAergic synapse","Dopaminergic synapse","Relaxin signaling pathway"]	[]
GNG4	[]	44	["Ras signaling pathway","Chemokine signaling pathway","Hormone signaling","Apelin signaling pathway","Circadian entrainment","Retrograde endocannabinoid signaling","Glutamatergic synapse","Cholinergic synapse","Serotonergic synapse","GABAergic synapse","Dopaminergic synapse","Relaxin signaling pathway"]	[]
GNG5	[]	44	["Ras signaling pathway","Chemokine signaling pathway","Hormone signaling","Apelin signaling pathway","Circadian entrainment","Retrograde endocannabinoid signaling","Glutamatergic synapse","Cholinergic synapse","Serotonergic synapse","GABAergic synapse","Dopaminergic synapse","Relaxin signaling pathway"]	[]
GNG10	[]	44	["Ras signaling pathway","Chemokine signaling pathway","Hormone signaling","Apelin signaling pathway","Circadian entrainment","Retrograde endocannabinoid signaling","Glutamatergic synapse","Cholinergic synapse","Serotonergic synapse","GABAergic synapse","Dopaminergic synapse","Relaxin signaling pathway"]	[]

GNG7 (G protein subunit gamma 7)

Bookmark This Gene