FUT6 (fucosyltransferase 6)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2528
• Gene name: Fucosyltransferase 6
• Gene symbol: FUT6
• Synonyms (NCBI Gene): FCT3A, FT1A, Fuc-TVI, FucT-VI
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same p

miRNA Show/Hide all (173)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047444	hsa-miR-10b-5p	CLASH	23622248
MIRT642970	hsa-miR-4475	HITS-CLIP	23824327
MIRT642969	hsa-miR-7845-5p	HITS-CLIP	23824327
MIRT642968	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT642967	hsa-miR-5681a	HITS-CLIP	23824327
MIRT642970	hsa-miR-4475	HITS-CLIP	23824327
MIRT642969	hsa-miR-7845-5p	HITS-CLIP	23824327
MIRT642968	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT642967	hsa-miR-5681a	HITS-CLIP	23824327
MIRT642966	hsa-miR-526b-5p	HITS-CLIP	23824327
MIRT642965	hsa-miR-3672	HITS-CLIP	23824327
MIRT642964	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT642963	hsa-miR-578	HITS-CLIP	23824327
MIRT642970	hsa-miR-4475	HITS-CLIP	23824327
MIRT642969	hsa-miR-7845-5p	HITS-CLIP	23824327
MIRT642968	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT642967	hsa-miR-5681a	HITS-CLIP	23824327
MIRT642970	hsa-miR-4475	HITS-CLIP	23824327
MIRT642969	hsa-miR-7845-5p	HITS-CLIP	23824327
MIRT642968	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT642967	hsa-miR-5681a	HITS-CLIP	23824327
MIRT642966	hsa-miR-526b-5p	HITS-CLIP	23824327
MIRT642965	hsa-miR-3672	HITS-CLIP	23824327
MIRT642964	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT642963	hsa-miR-578	HITS-CLIP	23824327
MIRT1006746	hsa-miR-1193	CLIP-seq
MIRT1006747	hsa-miR-122	CLIP-seq
MIRT1006748	hsa-miR-1279	CLIP-seq
MIRT1006749	hsa-miR-1307	CLIP-seq
MIRT1006750	hsa-miR-1915	CLIP-seq
MIRT1006751	hsa-miR-197	CLIP-seq
MIRT1006752	hsa-miR-1976	CLIP-seq
MIRT1006753	hsa-miR-217	CLIP-seq
MIRT1006754	hsa-miR-2392	CLIP-seq
MIRT1006755	hsa-miR-3135b	CLIP-seq
MIRT1006756	hsa-miR-3187-3p	CLIP-seq
MIRT1006757	hsa-miR-3652	CLIP-seq
MIRT1006758	hsa-miR-3918	CLIP-seq
MIRT1006759	hsa-miR-411	CLIP-seq
MIRT1006760	hsa-miR-4418	CLIP-seq
MIRT1006761	hsa-miR-4430	CLIP-seq
MIRT1006762	hsa-miR-4431	CLIP-seq
MIRT1006763	hsa-miR-4435	CLIP-seq
MIRT1006764	hsa-miR-4454	CLIP-seq
MIRT1006765	hsa-miR-4638-5p	CLIP-seq
MIRT1006766	hsa-miR-4685-5p	CLIP-seq
MIRT1006767	hsa-miR-4701-5p	CLIP-seq
MIRT1006768	hsa-miR-4726-3p	CLIP-seq
MIRT1006769	hsa-miR-4755-3p	CLIP-seq
MIRT1006770	hsa-miR-4763-5p	CLIP-seq
MIRT1006771	hsa-miR-4772-3p	CLIP-seq
MIRT1006772	hsa-miR-4797-5p	CLIP-seq
MIRT1006773	hsa-miR-483-5p	CLIP-seq
MIRT1006774	hsa-miR-509-3-5p	CLIP-seq
MIRT1006775	hsa-miR-509-5p	CLIP-seq
MIRT1006776	hsa-miR-5096	CLIP-seq
MIRT1006777	hsa-miR-548s	CLIP-seq
MIRT1006778	hsa-miR-588	CLIP-seq
MIRT1006779	hsa-miR-720	CLIP-seq
MIRT1006746	hsa-miR-1193	CLIP-seq
MIRT1006747	hsa-miR-122	CLIP-seq
MIRT1006748	hsa-miR-1279	CLIP-seq
MIRT1006751	hsa-miR-197	CLIP-seq
MIRT1006752	hsa-miR-1976	CLIP-seq
MIRT1006754	hsa-miR-2392	CLIP-seq
MIRT1006755	hsa-miR-3135b	CLIP-seq
MIRT1998283	hsa-miR-326	CLIP-seq
MIRT1998284	hsa-miR-330-5p	CLIP-seq
MIRT1006757	hsa-miR-3652	CLIP-seq
MIRT1006759	hsa-miR-411	CLIP-seq
MIRT1006761	hsa-miR-4430	CLIP-seq
MIRT1006764	hsa-miR-4454	CLIP-seq
MIRT1998285	hsa-miR-4634	CLIP-seq
MIRT1006769	hsa-miR-4755-3p	CLIP-seq
MIRT1006770	hsa-miR-4763-5p	CLIP-seq
MIRT1006773	hsa-miR-483-5p	CLIP-seq
MIRT1998286	hsa-miR-5095	CLIP-seq
MIRT1006776	hsa-miR-5096	CLIP-seq
MIRT2231956	hsa-miR-106a	CLIP-seq
MIRT2231957	hsa-miR-106b	CLIP-seq
MIRT1006747	hsa-miR-122	CLIP-seq
MIRT2231958	hsa-miR-1234	CLIP-seq
MIRT1006748	hsa-miR-1279	CLIP-seq
MIRT1006749	hsa-miR-1307	CLIP-seq
MIRT2231959	hsa-miR-150	CLIP-seq
MIRT2231960	hsa-miR-17	CLIP-seq
MIRT1006751	hsa-miR-197	CLIP-seq
MIRT1006752	hsa-miR-1976	CLIP-seq
MIRT2231961	hsa-miR-20a	CLIP-seq
MIRT2231962	hsa-miR-20b	CLIP-seq
MIRT1006753	hsa-miR-217	CLIP-seq
MIRT2231963	hsa-miR-302a	CLIP-seq
MIRT2231964	hsa-miR-302b	CLIP-seq
MIRT2231965	hsa-miR-302c	CLIP-seq
MIRT2231966	hsa-miR-302d	CLIP-seq
MIRT2231967	hsa-miR-302e	CLIP-seq
MIRT1006755	hsa-miR-3135b	CLIP-seq
MIRT1998283	hsa-miR-326	CLIP-seq
MIRT1998284	hsa-miR-330-5p	CLIP-seq
MIRT1006757	hsa-miR-3652	CLIP-seq
MIRT2231968	hsa-miR-372	CLIP-seq
MIRT2231969	hsa-miR-373	CLIP-seq
MIRT1006759	hsa-miR-411	CLIP-seq
MIRT1006760	hsa-miR-4418	CLIP-seq
MIRT1006761	hsa-miR-4430	CLIP-seq
MIRT1006764	hsa-miR-4454	CLIP-seq
MIRT1998285	hsa-miR-4634	CLIP-seq
MIRT1006765	hsa-miR-4638-5p	CLIP-seq
MIRT2231970	hsa-miR-4731-5p	CLIP-seq
MIRT1006769	hsa-miR-4755-3p	CLIP-seq
MIRT1006770	hsa-miR-4763-5p	CLIP-seq
MIRT1006772	hsa-miR-4797-5p	CLIP-seq
MIRT1006773	hsa-miR-483-5p	CLIP-seq
MIRT1006774	hsa-miR-509-3-5p	CLIP-seq
MIRT1998286	hsa-miR-5095	CLIP-seq
MIRT1006775	hsa-miR-509-5p	CLIP-seq
MIRT1006776	hsa-miR-5096	CLIP-seq
MIRT2231971	hsa-miR-512-3p	CLIP-seq
MIRT2231972	hsa-miR-519d	CLIP-seq
MIRT2231973	hsa-miR-520a-3p	CLIP-seq
MIRT2231974	hsa-miR-520b	CLIP-seq
MIRT2231975	hsa-miR-520c-3p	CLIP-seq
MIRT2231976	hsa-miR-520d-3p	CLIP-seq
MIRT2231977	hsa-miR-520e	CLIP-seq
MIRT2231978	hsa-miR-520g	CLIP-seq
MIRT2231979	hsa-miR-520h	CLIP-seq
MIRT2231980	hsa-miR-562	CLIP-seq
MIRT1006779	hsa-miR-720	CLIP-seq
MIRT2231981	hsa-miR-93	CLIP-seq
MIRT1006749	hsa-miR-1307	CLIP-seq
MIRT1998285	hsa-miR-4634	CLIP-seq
MIRT1006765	hsa-miR-4638-5p	CLIP-seq
MIRT1006747	hsa-miR-122	CLIP-seq
MIRT2449943	hsa-miR-1226	CLIP-seq
MIRT1006755	hsa-miR-3135b	CLIP-seq
MIRT1006757	hsa-miR-3652	CLIP-seq
MIRT1006761	hsa-miR-4430	CLIP-seq
MIRT2449944	hsa-miR-4690-3p	CLIP-seq
MIRT1006769	hsa-miR-4755-3p	CLIP-seq
MIRT2449945	hsa-miR-4758-3p	CLIP-seq
MIRT1006772	hsa-miR-4797-5p	CLIP-seq
MIRT1006779	hsa-miR-720	CLIP-seq
MIRT1006747	hsa-miR-122	CLIP-seq
MIRT1006755	hsa-miR-3135b	CLIP-seq
MIRT1006757	hsa-miR-3652	CLIP-seq
MIRT1006761	hsa-miR-4430	CLIP-seq
MIRT1006769	hsa-miR-4755-3p	CLIP-seq
MIRT1006772	hsa-miR-4797-5p	CLIP-seq
MIRT1006779	hsa-miR-720	CLIP-seq
MIRT1006747	hsa-miR-122	CLIP-seq
MIRT1006755	hsa-miR-3135b	CLIP-seq
MIRT1998283	hsa-miR-326	CLIP-seq
MIRT1998284	hsa-miR-330-5p	CLIP-seq
MIRT1006757	hsa-miR-3652	CLIP-seq
MIRT1006761	hsa-miR-4430	CLIP-seq
MIRT1006762	hsa-miR-4431	CLIP-seq
MIRT1998285	hsa-miR-4634	CLIP-seq
MIRT1006769	hsa-miR-4755-3p	CLIP-seq
MIRT1006772	hsa-miR-4797-5p	CLIP-seq
MIRT2535884	hsa-miR-498	CLIP-seq
MIRT1006779	hsa-miR-720	CLIP-seq
MIRT1006747	hsa-miR-122	CLIP-seq
MIRT1006755	hsa-miR-3135b	CLIP-seq
MIRT1998283	hsa-miR-326	CLIP-seq
MIRT1998284	hsa-miR-330-5p	CLIP-seq
MIRT1006757	hsa-miR-3652	CLIP-seq
MIRT1006761	hsa-miR-4430	CLIP-seq
MIRT1006762	hsa-miR-4431	CLIP-seq
MIRT1998285	hsa-miR-4634	CLIP-seq
MIRT1006769	hsa-miR-4755-3p	CLIP-seq
MIRT1006772	hsa-miR-4797-5p	CLIP-seq
MIRT2535884	hsa-miR-498	CLIP-seq
MIRT1006779	hsa-miR-720	CLIP-seq

Gene ontology (GO) Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0005576	Component	Extracellular region	IDA	9451035
GO:0005576	Component	Extracellular region	IEA
GO:0005794	Component	Golgi apparatus	IDA	9451035
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	TAS	11698403
GO:0006486	Process	Protein glycosylation	IEA
GO:0006486	Process	Protein glycosylation	TAS	11698403
GO:0006487	Process	Protein N-linked glycosylation	IDA	29593094
GO:0006493	Process	Protein O-linked glycosylation	IDA	29593094
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006665	Process	Sphingolipid metabolic process	IEA
GO:0006672	Process	Ceramide metabolic process	IDA	17604274
GO:0006688	Process	Glycosphingolipid biosynthetic process	IDA	29593094
GO:0007309	Process	Oocyte axis specification	IBA
GO:0008417	Function	Fucosyltransferase activity	IDA	17604274
GO:0008417	Function	Fucosyltransferase activity	IEA
GO:0008417	Function	Fucosyltransferase activity	TAS	8175676
GO:0009312	Process	Oligosaccharide biosynthetic process	IEA
GO:0009312	Process	Oligosaccharide biosynthetic process	TAS
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0017083	Function	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	9363434, 17604274, 29593094
GO:0017083	Function	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IEA
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0034709	Component	Methylosome	IBA
GO:0036071	Process	N-glycan fucosylation	IDA	9363434
GO:0042355	Process	L-fucose catabolic process	NAS	11698403
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	TAS	11698403
GO:0070062	Component	Extracellular exosome	HDA	19199708

Other IDs

• MIM: 136836
• HGNC: 4017
• e!Ensembl: ENSG00000156413

Protein

• UniProt ID: P51993
• Protein name: 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6 (EC 2.4.1.152) (Fucosyltransferase 6) (Fucosyltransferase VI) (Fuc-TVI) (FucT-VI) (Galactoside 3-L-fucosyltransferase)
• Protein function: [Isoform 1]: Catalyzes the transfer of L-fucose, from a guanosine diphosphate-beta-L-fucose, to the N-acetyl glucosamine (GlcNAc) of a distal alpha2,3 sialylated lactosamine unit of a glycoprotein- or a glycolipid-linked sialopolylactosamines ch
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00852	Glyco_transf_10	188 → 358	Glycosyltransferase family 10 (fucosyltransferase) C-term	Family
  PF17039	Glyco_tran_10_N	59 → 169	Fucosyltransferase, N-terminal	Domain

• Tissue specificity: TISSUE SPECIFICITY: Kidney, liver, colon, small intestine, bladder, uterus and salivary gland.
• Sequence:

  MDPLGPAKPQWSWRCCLTTLLFQLLMAVCFFSYLRVSQDDPTVYPNGSRFPDSTGTPAHS
  IPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQL
  PRSPRRQGQRWIWFSMESPSHCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAH
  PPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRY
  KFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKD
  LARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT

• Sequence length: 359

Pathways

KEGG Pathway	Reactome Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series	Lewis blood group biosynthesis
Metabolic pathways

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (11)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ATROPHIC MACULAR DEGENERATION	—	GWAS catalog	26691988	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	30504769, 34594039, 34651315, 37965154	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	36539618	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEFICIENCY ANEMIA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fucosyltransferase 6 deficiency	Conflicting classifications of pathogenicity; Uncertain significance; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FUT6-related disorder	Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	30504769, 34651315	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	GWAS catalog	36777997	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITAMIN B DEFICIENCY	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitamin B12 deficiency	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WET MACULAR DEGENERATION	—	GWAS catalog	26691988	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (32)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	30589515		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	GWASCAT_DG	26691988		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27519168		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27519168	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	9690558		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24232099	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31860772	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35955933	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12670495, 20965272		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	30589515	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24253505, 28771224, 30742932, 9690558		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24253505, 28771224, 33167483	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27374856	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27374856		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	39375968	Inhibit	★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	GWASCAT_DG	26691988		★☆☆☆☆ Found in Text Mining only
exudative macular degeneration	Exudative macular degeneration	GWASCAT_DG	26691988		★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	31941930	Associate	★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Geographic Atrophy	GWASCAT_DG	26691988		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31209266		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10536043, 17054948, 18274891, 22155250, 24232099		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10536043		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27519168		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24178760		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24947433		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24253505		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20965272		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24253505		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24178760		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19889975	Stimulate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	24253505		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24947433		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

FUT3 5 shared diseasesCholecystolithiasis, Deficiency anemia, Gallstones, Idiopathic pulmonary fibrosis, Vitamin b12 deficiency 2 shared pathwaysGlycosphingolipid biosynthesis - lacto and neolacto series, Lewis blood group biosynthesis 5 shared evidence sourcesGWAS catalog (Cholecystolithiasis), GWAS catalog (Deficiency anemia), GWAS catalog (Gallstones), GWAS catalog (Idiopathic pulmonary fibrosis), GWAS catalog (Vitamin b12 deficiency) Related via 5 shared diseases including Cholecystolithiasis, Deficiency anemia — evidence mostly GWAS catalog. FUT2 5 shared diseasesCholecystolithiasis, Deficiency anemia, Gallstones, Vitamin b deficiency, Vitamin b12 deficiency 2 shared pathwaysGlycosphingolipid biosynthesis - lacto and neolacto series, Lewis blood group biosynthesis 5 shared evidence sourcesGWAS catalog (Cholecystolithiasis), GWAS catalog (Deficiency anemia), GWAS catalog (Gallstones), GWAS catalog (Vitamin b deficiency), GWAS catalog (Vitamin b12 deficiency) Related via 5 shared diseases including Cholecystolithiasis, Deficiency anemia — evidence mostly GWAS catalog. OOSP3 3 shared diseasesDeficiency anemia, Vitamin b deficiency, Vitamin b12 deficiency 3 shared evidence sourcesGWAS catalog (Deficiency anemia), GWAS catalog (Vitamin b deficiency), GWAS catalog (Vitamin b12 deficiency) Related via 3 shared diseases including Deficiency anemia, Vitamin b deficiency — evidence mostly GWAS catalog. FUT5 2 shared pathwaysGlycosphingolipid biosynthesis - lacto and neolacto series, Lewis blood group biosynthesis Related via 2 shared pathways including Glycosphingolipid biosynthesis - lacto and neolacto series, Lewis blood group biosynthesis. FUT7 2 shared pathwaysGlycosphingolipid biosynthesis - lacto and neolacto series, Lewis blood group biosynthesis Related via 2 shared pathways including Glycosphingolipid biosynthesis - lacto and neolacto series, Lewis blood group biosynthesis.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
FUT3	5	["Cholecystolithiasis","Deficiency anemia","Gallstones","Idiopathic pulmonary fibrosis","Vitamin b12 deficiency"]	2	["Glycosphingolipid biosynthesis - lacto and neolacto series","Lewis blood group biosynthesis"]	5	["GWAS catalog (Cholecystolithiasis)","GWAS catalog (Deficiency anemia)","GWAS catalog (Gallstones)","GWAS catalog (Idiopathic pulmonary fibrosis)","GWAS catalog (Vitamin b12 deficiency)"]
FUT2	5	["Cholecystolithiasis","Deficiency anemia","Gallstones","Vitamin b deficiency","Vitamin b12 deficiency"]	2	["Glycosphingolipid biosynthesis - lacto and neolacto series","Lewis blood group biosynthesis"]	5	["GWAS catalog (Cholecystolithiasis)","GWAS catalog (Deficiency anemia)","GWAS catalog (Gallstones)","GWAS catalog (Vitamin b deficiency)","GWAS catalog (Vitamin b12 deficiency)"]
OOSP3	3	["Deficiency anemia","Vitamin b deficiency","Vitamin b12 deficiency"]	0	[]	3	["GWAS catalog (Deficiency anemia)","GWAS catalog (Vitamin b deficiency)","GWAS catalog (Vitamin b12 deficiency)"]
FUT5	0	[]	2	["Glycosphingolipid biosynthesis - lacto and neolacto series","Lewis blood group biosynthesis"]	0	[]
FUT7	0	[]	2	["Glycosphingolipid biosynthesis - lacto and neolacto series","Lewis blood group biosynthesis"]	0	[]

Diseases Linked via Similar Genes

Megaloblastic anemia Linked via 2 of 5 related genesFUT2, OOSP3 Vitamin deficiency disorder Linked via 2 of 5 related genesFUT2, OOSP3 Alzheimer disease Linked via 1 of 5 related genesFUT2 Ankylosing spondylitis Linked via 1 of 5 related genesFUT2 Attention deficit hyperactivity disorder Linked via 1 of 5 related genesFUT2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Megaloblastic anemia	2	["FUT2","OOSP3"]
Vitamin deficiency disorder	2	["FUT2","OOSP3"]
Alzheimer disease	1	["FUT2"]
Ankylosing spondylitis	1	["FUT2"]
Attention deficit hyperactivity disorder	1	["FUT2"]