Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	2524
Gene name	Fucosyltransferase 2 (H blood group)
Gene symbol	FUT2
Synonyms (NCBI Gene)	B12QTL1SESEC2Se2sej
Chromosome	19
Chromosome location	19q13.33
Summary	The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding th

258 Show/Hide all (258)

miRTarBase ID	miRNA	Experiments	Reference
MIRT437485	hsa-miR-15b-5p	Luciferase reporter assayqRT-PCRWestern blot	24122375
MIRT690897	hsa-miR-21-3p	HITS-CLIP	23313552
MIRT690896	hsa-miR-3591-3p	HITS-CLIP	23313552
MIRT690895	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT690894	hsa-miR-5693	HITS-CLIP	23313552
MIRT690893	hsa-miR-7977	HITS-CLIP	23313552
MIRT690892	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT690891	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT690890	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT690889	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT690888	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT690887	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT690886	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT690885	hsa-miR-3689c	HITS-CLIP	23313552
MIRT690884	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT690883	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT690882	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT690881	hsa-miR-3122	HITS-CLIP	23313552
MIRT690880	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT690879	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT690878	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT674211	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT674210	hsa-miR-6808-5p	HITS-CLIP	23824327
MIRT674209	hsa-miR-6893-5p	HITS-CLIP	23824327
MIRT674208	hsa-miR-940	HITS-CLIP	23824327
MIRT674207	hsa-miR-3929	HITS-CLIP	23824327
MIRT674206	hsa-miR-4419b	HITS-CLIP	23824327
MIRT674205	hsa-miR-4478	HITS-CLIP	23824327
MIRT674204	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT674203	hsa-miR-6746-5p	HITS-CLIP	23824327
MIRT674202	hsa-miR-4649-3p	HITS-CLIP	23824327
MIRT674201	hsa-miR-1827	HITS-CLIP	23824327
MIRT674200	hsa-miR-4722-5p	HITS-CLIP	23824327
MIRT674199	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT674198	hsa-miR-6771-5p	HITS-CLIP	23824327
MIRT674197	hsa-miR-665	HITS-CLIP	23824327
MIRT662037	hsa-miR-504-5p	HITS-CLIP	23824327
MIRT662036	hsa-miR-1245a	HITS-CLIP	23824327
MIRT662035	hsa-miR-8079	HITS-CLIP	23824327
MIRT662034	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT662033	hsa-miR-3176	HITS-CLIP	23824327
MIRT662032	hsa-miR-3922-3p	HITS-CLIP	23824327
MIRT662031	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT662030	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT662029	hsa-miR-640	HITS-CLIP	23824327
MIRT662028	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT690897	hsa-miR-21-3p	HITS-CLIP	23313552
MIRT690896	hsa-miR-3591-3p	HITS-CLIP	23313552
MIRT690895	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT690894	hsa-miR-5693	HITS-CLIP	23313552
MIRT690893	hsa-miR-7977	HITS-CLIP	23313552
MIRT690892	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT690891	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT690890	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT690889	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT690888	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT690887	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT690886	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT690885	hsa-miR-3689c	HITS-CLIP	23313552
MIRT690884	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT690883	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT690882	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT690881	hsa-miR-3122	HITS-CLIP	23313552
MIRT690880	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT690879	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT690878	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT674211	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT674210	hsa-miR-6808-5p	HITS-CLIP	23824327
MIRT674209	hsa-miR-6893-5p	HITS-CLIP	23824327
MIRT674208	hsa-miR-940	HITS-CLIP	23824327
MIRT674207	hsa-miR-3929	HITS-CLIP	23824327
MIRT674206	hsa-miR-4419b	HITS-CLIP	23824327
MIRT674205	hsa-miR-4478	HITS-CLIP	23824327
MIRT674204	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT674203	hsa-miR-6746-5p	HITS-CLIP	23824327
MIRT674202	hsa-miR-4649-3p	HITS-CLIP	23824327
MIRT674201	hsa-miR-1827	HITS-CLIP	23824327
MIRT674200	hsa-miR-4722-5p	HITS-CLIP	23824327
MIRT674199	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT674198	hsa-miR-6771-5p	HITS-CLIP	23824327
MIRT674197	hsa-miR-665	HITS-CLIP	23824327
MIRT662037	hsa-miR-504-5p	HITS-CLIP	23824327
MIRT662036	hsa-miR-1245a	HITS-CLIP	23824327
MIRT662035	hsa-miR-8079	HITS-CLIP	23824327
MIRT662034	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT662033	hsa-miR-3176	HITS-CLIP	23824327
MIRT662032	hsa-miR-3922-3p	HITS-CLIP	23824327
MIRT662031	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT662030	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT662029	hsa-miR-640	HITS-CLIP	23824327
MIRT662028	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT1006528	hsa-miR-1208	CLIP-seq
MIRT1006529	hsa-miR-1245	CLIP-seq
MIRT1006530	hsa-miR-136	CLIP-seq
MIRT1006531	hsa-miR-1972	CLIP-seq
MIRT1006532	hsa-miR-3152-5p	CLIP-seq
MIRT1006533	hsa-miR-3192	CLIP-seq
MIRT1006534	hsa-miR-3545-3p	CLIP-seq
MIRT1006535	hsa-miR-3672	CLIP-seq
MIRT1006536	hsa-miR-3934	CLIP-seq
MIRT1006537	hsa-miR-4252	CLIP-seq
MIRT1006538	hsa-miR-4293	CLIP-seq
MIRT1006539	hsa-miR-4476	CLIP-seq
MIRT1006540	hsa-miR-4635	CLIP-seq
MIRT1006541	hsa-miR-4680-5p	CLIP-seq
MIRT1006542	hsa-miR-4717-5p	CLIP-seq
MIRT1006543	hsa-miR-4728-5p	CLIP-seq
MIRT1006544	hsa-miR-4738-3p	CLIP-seq
MIRT1006545	hsa-miR-4740-3p	CLIP-seq
MIRT1006546	hsa-miR-4755-3p	CLIP-seq
MIRT1006547	hsa-miR-4786-5p	CLIP-seq
MIRT1006548	hsa-miR-485-5p	CLIP-seq
MIRT1006549	hsa-miR-490-3p	CLIP-seq
MIRT1006550	hsa-miR-5095	CLIP-seq
MIRT1006551	hsa-miR-5096	CLIP-seq
MIRT1006552	hsa-miR-552	CLIP-seq
MIRT1006553	hsa-miR-658	CLIP-seq
MIRT1006554	hsa-miR-767-5p	CLIP-seq
MIRT1006555	hsa-miR-769-5p	CLIP-seq
MIRT1006535	hsa-miR-3672	CLIP-seq
MIRT1006556	hsa-miR-4433	CLIP-seq
MIRT1006557	hsa-miR-4459	CLIP-seq
MIRT1006539	hsa-miR-4476	CLIP-seq
MIRT1006543	hsa-miR-4728-5p	CLIP-seq
MIRT1006547	hsa-miR-4786-5p	CLIP-seq
MIRT1006555	hsa-miR-769-5p	CLIP-seq
MIRT1998256	hsa-miR-3187-3p	CLIP-seq
MIRT1006533	hsa-miR-3192	CLIP-seq
MIRT1006534	hsa-miR-3545-3p	CLIP-seq
MIRT1998257	hsa-miR-4435	CLIP-seq
MIRT1006539	hsa-miR-4476	CLIP-seq
MIRT1006540	hsa-miR-4635	CLIP-seq
MIRT1006541	hsa-miR-4680-5p	CLIP-seq
MIRT1998258	hsa-miR-4701-5p	CLIP-seq
MIRT1998259	hsa-miR-4716-5p	CLIP-seq
MIRT1006543	hsa-miR-4728-5p	CLIP-seq
MIRT1006546	hsa-miR-4755-3p	CLIP-seq
MIRT1998260	hsa-miR-4781-3p	CLIP-seq
MIRT1006548	hsa-miR-485-5p	CLIP-seq
MIRT1006549	hsa-miR-490-3p	CLIP-seq
MIRT1998261	hsa-miR-548s	CLIP-seq
MIRT1998262	hsa-miR-588	CLIP-seq
MIRT1006553	hsa-miR-658	CLIP-seq
MIRT2231893	hsa-miR-122	CLIP-seq
MIRT2231894	hsa-miR-1281	CLIP-seq
MIRT2231895	hsa-miR-1289	CLIP-seq
MIRT2231896	hsa-miR-1297	CLIP-seq
MIRT2231897	hsa-miR-1343	CLIP-seq
MIRT2231898	hsa-miR-1912	CLIP-seq
MIRT2231899	hsa-miR-26a	CLIP-seq
MIRT2231900	hsa-miR-26b	CLIP-seq
MIRT1006532	hsa-miR-3152-5p	CLIP-seq
MIRT1006533	hsa-miR-3192	CLIP-seq
MIRT2231901	hsa-miR-3198	CLIP-seq
MIRT1006536	hsa-miR-3934	CLIP-seq
MIRT2231902	hsa-miR-3944-5p	CLIP-seq
MIRT2231903	hsa-miR-4294	CLIP-seq
MIRT2231904	hsa-miR-4309	CLIP-seq
MIRT2231905	hsa-miR-431	CLIP-seq
MIRT2231906	hsa-miR-4463	CLIP-seq
MIRT2231907	hsa-miR-4465	CLIP-seq
MIRT2231908	hsa-miR-4494	CLIP-seq
MIRT2231909	hsa-miR-4534	CLIP-seq
MIRT1006543	hsa-miR-4728-5p	CLIP-seq
MIRT1006545	hsa-miR-4740-3p	CLIP-seq
MIRT2231910	hsa-miR-4753-3p	CLIP-seq
MIRT1006546	hsa-miR-4755-3p	CLIP-seq
MIRT2231911	hsa-miR-4772-3p	CLIP-seq
MIRT1006548	hsa-miR-485-5p	CLIP-seq
MIRT1006549	hsa-miR-490-3p	CLIP-seq
MIRT2231912	hsa-miR-500a	CLIP-seq
MIRT1006550	hsa-miR-5095	CLIP-seq
MIRT1006551	hsa-miR-5096	CLIP-seq
MIRT1006552	hsa-miR-552	CLIP-seq
MIRT2231913	hsa-miR-592	CLIP-seq
MIRT2231914	hsa-miR-597	CLIP-seq
MIRT1006553	hsa-miR-658	CLIP-seq
MIRT1006554	hsa-miR-767-5p	CLIP-seq
MIRT2231915	hsa-miR-924	CLIP-seq
MIRT2231894	hsa-miR-1281	CLIP-seq
MIRT2231896	hsa-miR-1297	CLIP-seq
MIRT2231897	hsa-miR-1343	CLIP-seq
MIRT2231899	hsa-miR-26a	CLIP-seq
MIRT2231900	hsa-miR-26b	CLIP-seq
MIRT2449932	hsa-miR-3149	CLIP-seq
MIRT1006532	hsa-miR-3152-5p	CLIP-seq
MIRT2449933	hsa-miR-3619-3p	CLIP-seq
MIRT2449934	hsa-miR-3682-3p	CLIP-seq
MIRT2231907	hsa-miR-4465	CLIP-seq
MIRT1006539	hsa-miR-4476	CLIP-seq
MIRT1006543	hsa-miR-4728-5p	CLIP-seq
MIRT2449935	hsa-miR-4735-5p	CLIP-seq
MIRT1006545	hsa-miR-4740-3p	CLIP-seq
MIRT2231910	hsa-miR-4753-3p	CLIP-seq
MIRT2449936	hsa-miR-4775	CLIP-seq
MIRT2449937	hsa-miR-4794	CLIP-seq
MIRT2449938	hsa-miR-590-3p	CLIP-seq
MIRT2449939	hsa-miR-591	CLIP-seq
MIRT1006554	hsa-miR-767-5p	CLIP-seq
MIRT2231894	hsa-miR-1281	CLIP-seq
MIRT2535873	hsa-miR-1287	CLIP-seq
MIRT2231896	hsa-miR-1297	CLIP-seq
MIRT2231897	hsa-miR-1343	CLIP-seq
MIRT2231899	hsa-miR-26a	CLIP-seq
MIRT2231900	hsa-miR-26b	CLIP-seq
MIRT2449932	hsa-miR-3149	CLIP-seq
MIRT1006532	hsa-miR-3152-5p	CLIP-seq
MIRT1006533	hsa-miR-3192	CLIP-seq
MIRT2535874	hsa-miR-3607-5p	CLIP-seq
MIRT2535875	hsa-miR-3652	CLIP-seq
MIRT1006536	hsa-miR-3934	CLIP-seq
MIRT2535876	hsa-miR-4430	CLIP-seq
MIRT2231907	hsa-miR-4465	CLIP-seq
MIRT1006539	hsa-miR-4476	CLIP-seq
MIRT2535877	hsa-miR-4505	CLIP-seq
MIRT2535878	hsa-miR-4686	CLIP-seq
MIRT1006543	hsa-miR-4728-5p	CLIP-seq
MIRT2449935	hsa-miR-4735-5p	CLIP-seq
MIRT2231910	hsa-miR-4753-3p	CLIP-seq
MIRT2449936	hsa-miR-4775	CLIP-seq
MIRT2449937	hsa-miR-4794	CLIP-seq
MIRT1006548	hsa-miR-485-5p	CLIP-seq
MIRT1006549	hsa-miR-490-3p	CLIP-seq
MIRT1006550	hsa-miR-5095	CLIP-seq
MIRT1006552	hsa-miR-552	CLIP-seq
MIRT2449938	hsa-miR-590-3p	CLIP-seq
MIRT1006553	hsa-miR-658	CLIP-seq
MIRT1006554	hsa-miR-767-5p	CLIP-seq
MIRT2231894	hsa-miR-1281	CLIP-seq
MIRT2535873	hsa-miR-1287	CLIP-seq
MIRT2231896	hsa-miR-1297	CLIP-seq
MIRT2231897	hsa-miR-1343	CLIP-seq
MIRT2231899	hsa-miR-26a	CLIP-seq
MIRT2231900	hsa-miR-26b	CLIP-seq
MIRT2449932	hsa-miR-3149	CLIP-seq
MIRT1006532	hsa-miR-3152-5p	CLIP-seq
MIRT1006533	hsa-miR-3192	CLIP-seq
MIRT2535874	hsa-miR-3607-5p	CLIP-seq
MIRT2535875	hsa-miR-3652	CLIP-seq
MIRT1006536	hsa-miR-3934	CLIP-seq
MIRT2535876	hsa-miR-4430	CLIP-seq
MIRT2231907	hsa-miR-4465	CLIP-seq
MIRT1006539	hsa-miR-4476	CLIP-seq
MIRT2535877	hsa-miR-4505	CLIP-seq
MIRT2535878	hsa-miR-4686	CLIP-seq
MIRT1006543	hsa-miR-4728-5p	CLIP-seq
MIRT2449935	hsa-miR-4735-5p	CLIP-seq
MIRT1006545	hsa-miR-4740-3p	CLIP-seq
MIRT2231910	hsa-miR-4753-3p	CLIP-seq
MIRT2449936	hsa-miR-4775	CLIP-seq
MIRT2449937	hsa-miR-4794	CLIP-seq
MIRT1006548	hsa-miR-485-5p	CLIP-seq
MIRT1006549	hsa-miR-490-3p	CLIP-seq
MIRT1006550	hsa-miR-5095	CLIP-seq
MIRT1006552	hsa-miR-552	CLIP-seq
MIRT2449938	hsa-miR-590-3p	CLIP-seq
MIRT1006553	hsa-miR-658	CLIP-seq
MIRT1006554	hsa-miR-767-5p	CLIP-seq

Transcription factor	Regulation	Reference
CDX2	Activation	22547830

34 Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0001936	Process	Regulation of endothelial cell proliferation	ISS
GO:0005515	Function	Protein binding	IPI	32814053, 36739428
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	TAS	11698403
GO:0005975	Process	Carbohydrate metabolic process	IEA
GO:0005975	Process	Carbohydrate metabolic process	TAS	7876235
GO:0006486	Process	Protein glycosylation	IBA
GO:0006486	Process	Protein glycosylation	IEA
GO:0006486	Process	Protein glycosylation	IEA
GO:0006486	Process	Protein glycosylation	TAS	11698403
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006664	Process	Glycolipid metabolic process	IEA
GO:0006664	Process	Glycolipid metabolic process	ISS
GO:0006688	Process	Glycosphingolipid biosynthetic process	TAS
GO:0008107	Function	Galactoside 2-alpha-L-fucosyltransferase activity	IBA
GO:0008107	Function	Galactoside 2-alpha-L-fucosyltransferase activity	IEA
GO:0008107	Function	Galactoside 2-alpha-L-fucosyltransferase activity	TAS	11698403
GO:0008417	Function	Fucosyltransferase activity	IEA
GO:0008417	Function	Fucosyltransferase activity	TAS	7876235
GO:0009312	Process	Oligosaccharide biosynthetic process	IEA
GO:0009312	Process	Oligosaccharide biosynthetic process	TAS
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0030155	Process	Regulation of cell adhesion	ISS
GO:0031127	Function	Alpha-(1,2)-fucosyltransferase activity	IEA
GO:0031127	Function	Alpha-(1,2)-fucosyltransferase activity	ISS
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0036065	Process	Fucosylation	IBA
GO:0036065	Process	Fucosylation	IEA
GO:0036065	Process	Fucosylation	ISS
GO:0042355	Process	L-fucose catabolic process	NAS	11698403
GO:0070062	Component	Extracellular exosome	HDA	19199708

MIM	HGNC	e!Ensembl
182100	4013	ENSG00000176920

Q10981

Protein name

Galactoside alpha-(1,2)-fucosyltransferase 2 (Alpha(1,2)FT 2) (Fucosyltransferase 2) (GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2) (SE2) (Secretor blood group alpha-2-fucosyltransferase) (Secretor factor) (Se) (Type 1 galactoside alpha-

Protein function

Catalyzes the transfer of L-fucose, from a guanosine diphosphate-beta-L-fucose, to the terminal galactose on both O- and N-linked glycans chains of cell surface glycoproteins and glycolipids and the resulting epitope regulates several processes

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01531	Glyco_transf_11	21 → 334	Glycosyl transferase family 11	Family

Tissue specificity

TISSUE SPECIFICITY: Small intestine, colon and lung.

Sequence

MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQL
RGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATAS
RIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQK
FLRGLQVNGSRPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSLIFV
VTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTG
GDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH

Sequence length

343

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series	ABO blood group biosynthesis
Glycosphingolipid biosynthesis - globo and isoglobo series	Lewis blood group biosynthesis
Metabolic pathways

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (53)
ALZHEIMER DISEASE	—	GWAS catalog	34493870, 39998322	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	26301688, 26974007	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	33686288, 36753304	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET'S SYNDROME	—	GWAS catalog	24326010	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bombay phenotype	Conflicting classifications of pathogenicity; Benign	ClinVar ClinVar, HPO ClinVar, HPO	—	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
BREAST CARCINOMA	—	GWAS catalog	33037222	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	30595370	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	30504769, 34594039, 34651315, 37965154, 39789286, 40465716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	21102463	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	20570966, 21102463, 23128233, 26192919, 26301688, 26974007, 28067908, 37156999	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEFICIENCY ANEMIA	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	39192244	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUODENAL ULCER	—	GWAS catalog	37965154, 38036781	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial Otitis Media	Conflicting classifications of pathogenicity; Benign; confers sensitivity; other	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fucosyltransferase 6 deficiency	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FUT2-related disorder	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	30504769, 34651315	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	GWAS catalog	34594039, 37965154	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	38965376	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	20570966, 21102463, 23128233, 26192919, 28067908, 37156999	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	34493870	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Levothyroxine response	confers sensitivity; other	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	28604730	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEGALOBLASTIC ANEMIA	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	33893285	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	21833088	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL DISORDER	—	GWAS catalog	36653354	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	35047847	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	40205036	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	40205036	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	33608531, 36753304, 38036781, 38102678, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	25574825, 26301688, 26974007, 28537254	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	33169155, 33686288, 36753304	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	26974007, 27992413	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SECRETOR/NONSECRETOR POLYMORPHISM	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SECRETOR/NONSECRETOR POLYMORPHISM, JAPANESE TYPE	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SINUSITIS	—	GWAS catalog	34594039	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	26301688, 36762574	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	25751624, 26301688	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	25751624	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	26192919, 26301688, 26974007, 28067908, 37156999	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITAMIN B 12 DEFICIENCY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITAMIN B DEFICIENCY	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitamin B12 deficiency	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITAMIN B12 PLASMA LEVEL QUANTITATIVE TRAIT LOCUS 1	Conflicting classifications of pathogenicity; Benign	ClinVar CTD, ClinVar CTD, ClinVar	—	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
VITAMIN DEFICIENCY DISORDER	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (133)
Acute pancreatitis	Pancreatitis	BEFREE	25028398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	9760191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29228607, 30031128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	23402911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Megaloblastic	Megaloblastic anemia	Pubtator	39350204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26301688, 26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	31125592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	33328473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	31595719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	Autoimmune Diseases	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
FUT6	5	["Cholecystolithiasis","Deficiency anemia","Gallstones","Vitamin b deficiency","Vitamin b12 deficiency"]	2	["Glycosphingolipid biosynthesis - lacto and neolacto series","Lewis blood group biosynthesis"]	5	["GWAS catalog (Cholecystolithiasis)","GWAS catalog (Deficiency anemia)","GWAS catalog (Gallstones)","GWAS catalog (Vitamin b deficiency)","GWAS catalog (Vitamin b12 deficiency)"]
ABO	5	["Cholecystolithiasis","Duodenal ulcer","Gallstones","Gastric ulcer","Peptic ulcer disease"]	3	["Glycosphingolipid biosynthesis - lacto and neolacto series","Glycosphingolipid biosynthesis - globo and isoglobo series","ABO blood group biosynthesis"]	5	["GWAS catalog (Cholecystolithiasis)","GWAS catalog (Duodenal ulcer)","GWAS catalog (Gallstones)","GWAS catalog (Gastric ulcer)","GWAS catalog (Peptic ulcer disease)"]
ATG16L1	6	["Autoimmune disease","Autoimmune thyroid disease","Celiac disease","Common variable immunodeficiency","Juvenile idiopathic arthritis","Sclerosing cholangitis"]	0	[]	9	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Celiac disease)","GWAS catalog (Common variable immunodeficiency)","CTD (Crohn disease)","Disgenet (Crohn disease)","GWAS catalog (Juvenile idiopathic arthritis)","GWAS catalog (Sclerosing cholangitis)"]
FUT3	4	["Cholecystolithiasis","Deficiency anemia","Gallstones","Vitamin b12 deficiency"]	2	["Glycosphingolipid biosynthesis - lacto and neolacto series","Lewis blood group biosynthesis"]	4	["GWAS catalog (Cholecystolithiasis)","GWAS catalog (Deficiency anemia)","GWAS catalog (Gallstones)","GWAS catalog (Vitamin b12 deficiency)"]
ERAP2	6	["Autoimmune disease","Autoimmune thyroid disease","Celiac disease","Common variable immunodeficiency","Juvenile idiopathic arthritis","Sclerosing cholangitis"]	0	[]	8	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Celiac disease)","GWAS catalog (Common variable immunodeficiency)","CTD (Crohn disease)","GWAS catalog (Juvenile idiopathic arthritis)","GWAS catalog (Sclerosing cholangitis)"]

FUT2 (fucosyltransferase 2 (H blood group))

Bookmark This Gene