ABO (ABO, alpha 1-3-N-acetylgalactosaminyltransferase and alpha 1-3-galactosyltransferase)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 28
• Gene name: ABO, alpha 1-3-N-acetylgalactosaminyltransferase and alpha 1-3-galactosyltransferase
• Gene symbol: ABO
• Synonyms (NCBI Gene): A3GALNT, A3GALT1, GTB, NAGAT
• Chromosome: 9
• Chromosome location: 9q34.2
• Summary: This gene encodes proteins related to the first discovered blood group system, ABO. Variation in the ABO gene (chromosome 9q34.2) is the basis of the ABO blood group, thus the presence of an allele determines the blood group in an individual. The `O` bloo

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs55722397	G>C	Affects	Missense variant, coding sequence variant
rs56392308	G>-	Affects	Frameshift variant, coding sequence variant

miRNA Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1924317	hsa-miR-1908	CLIP-seq
MIRT1924318	hsa-miR-3650	CLIP-seq
MIRT1924319	hsa-miR-4455	CLIP-seq
MIRT1924320	hsa-miR-4706	CLIP-seq
MIRT1924321	hsa-miR-4728-5p	CLIP-seq
MIRT1924322	hsa-miR-4749-5p	CLIP-seq
MIRT1924323	hsa-miR-663	CLIP-seq
MIRT1924321	hsa-miR-4728-5p	CLIP-seq
MIRT2442974	hsa-miR-297	CLIP-seq
MIRT2442975	hsa-miR-4652-3p	CLIP-seq
MIRT2442976	hsa-miR-4711-3p	CLIP-seq
MIRT2442977	hsa-miR-511	CLIP-seq
MIRT2442978	hsa-miR-567	CLIP-seq

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0000166	Function	Nucleotide binding	IMP	12198488
GO:0003823	Function	Antigen binding	IMP	12198488
GO:0004380	Function	Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase activity	IBA
GO:0004380	Function	Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase activity	IEA
GO:0004381	Function	Fucosylgalactoside 3-alpha-galactosyltransferase activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005975	Process	Carbohydrate metabolic process	IEA
GO:0006486	Process	Protein glycosylation	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016758	Function	Hexosyltransferase activity	IEA
GO:0030145	Function	Manganese ion binding	IMP	12198488
GO:0031982	Component	Vesicle	IBA
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 110300
• HGNC: 79
• e!Ensembl: ENSG00000175164

Protein

• UniProt ID: P16442
• Protein name: Histo-blood group ABO system transferase (Fucosylglycoprotein 3-alpha-galactosyltransferase) (Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase) (Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase) (EC 2.4.1.40) (Glycoprotei
• Protein function: This protein is the basis of the ABO blood group system. The histo-blood group ABO involves three carbohydrate antigens: A, B, and H. A, B, and AB individuals express a glycosyltransferase activity that converts the H antigen to the A antigen (b
• PDB: 1LZ0 , 1LZ7 , 1LZI , 1LZJ , 1R7T , 1R7U , 1R7V , 1R7X , 1R7Y , 1R80 , 1R81 , 1R82 , 1WSZ , 1WT0 , 1WT1 , 1WT2 , 1WT3 , 1XZ6 , 1ZHJ , 1ZI1 , 1ZI3 , 1ZI4 , 1ZI5 , 1ZIZ , 1ZJ0 , 1ZJ1 , 1ZJ2 , 1ZJ3 , 1ZJO , 1ZJP , 2A8U , 2A8W , 2I7B , 2O1F , 2O1G , 2O1H , 2PGV , 2PGY , 2RIT , 2RIX , 2RIY , 2RIZ , 2RJ0 , 2RJ1 , 2RJ4 , 2RJ5 , 2RJ6 , 2RJ7 , 2RJ8 , 2RJ9 , 2Y7A
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03414	Glyco_transf_6	35 → 353	Glycosyltransferase family 6	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in testis. Also expressed in pancreas, uterus and lung and salivary gland. {ECO:0000269|PubMed:7598760}.
• Sequence:

  MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDH
  LQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTV
  FAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKR
  WQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSS
  REAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVW
  HDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP

• Sequence length: 354

Pathways

KEGG Pathway	Reactome Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series	ABO blood group biosynthesis
Glycosphingolipid biosynthesis - globo and isoglobo series
Metabolic pathways

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (88)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ABO blood group system	association; Affects; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ABO-related disorder	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, HEMOLYTIC	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	29679657, 32296059, 35386719, 35472084	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	40645996	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLOOD COAGULATION DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	36819030, 37636041	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, OVARIAN EPITHELIAL	—	CTD	25581431	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC EMBOLISM	—	GWAS catalog	29531354	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	29531354, 35872910, 36180795	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	34594039, 34651315	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC THROMBOEMBOLIC PULMONARY HYPERTENSION	—	GWAS catalog	38470220	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC VENOUS INSUFFICIENCY	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COR PULMONALE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	21378990, 24262325, 26343387, 28714975, 29212778, 32469254, 33020668, 35285134, 36187959, 36474045, 37390107, 37705021, 38062574, 39024449, 39537608	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	37156999	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CURLING ULCER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	38965376, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHY	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE GASTRIC ADENOCARCINOMA	—	GWAS catalog	37209533	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM DISEASE	—	GWAS catalog	35173190	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM INFECTIOUS DISORDER	—	GWAS catalog	32152699	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF PHARYNX	—	GWAS catalog	36653354	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	30177863, 37492107, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASES	—	CTD	30177863	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULITIS	—	GWAS catalog	37196047, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUODENAL ULCER	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	22387998, 37965154, 38036781	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	37636041	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	35472084, 36914876, 37544299, 40262193	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	34651315, 37705021	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	30281874, 37209533, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CARCINOMA	—	GWAS catalog	30281874, 37209533, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	GWAS catalog	37965154, 38036781	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	39024449, 39406924	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT-VS-HOST DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	GWAS catalog	21841780, 23612905	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	31919418, 34594039, 36376295, 36777996, 37429843, 40195560, 41184235	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	33888516, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	36187959, 38965376	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	39024449, 39266554	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	37156999	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACRANIAL THROMBOSIS	—	GWAS catalog	34459509	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARGE ARTERY STROKE	—	GWAS catalog	24262325, 36180795	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	37390107	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	25134534	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	33893285	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	36808568	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	21239051, 26343387, 33532862, 34594039, 38072966, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	33627673, 36777996, 37386247, 38382466, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	25134534, 36819030, 37636041	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	19648918, 25086665, 26098869, 29422604, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	19648918, 26098869	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATITIS	—	GWAS catalog	38491158	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	33608531, 38036781, 38102678, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	31285632, 34601942	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL VASCULAR DISEASE	—	GWAS catalog	33893285, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	39358599	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	39358599	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	17013881	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	36653354	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS, PULMONARY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30395268	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	30013184	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severely weakened expression of A on erythrocytes	Affects; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA	—	GWAS catalog	36525587	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD, GWAS catalog CTD, GWAS catalog	24262325, 26908601, 27997041, 29531354, 35185750, 37705021	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Three Vessel Coronary Disease	Benign; Uncertain significance	ClinVar Disgenet	—	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
THROMBOPHILIA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	28566273, 29358691, 30054458, 30297969, 32499647, 32541925, 34594039, 35551307, 37390107, 38062574, 38374256, 38685053, 39024449, 39379762, 40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	37156999	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DISEASE	—	GWAS catalog	33893285, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	19278955, 21980494, 22672568, 23650146, 25772935, 26908601, 28373160, 30659681, 31420334, 31676865, 33592630, 34777790, 35285134, 36777996, 38561338	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (355)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	29531354		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	26600159		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	10391104, 17065136, 28963906, 6127543		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	17065136, 29334169		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	28939368, 30324575		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	28963906		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	22642827		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17065136, 29334169		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	22670181		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	23300138		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

FUT1 3 shared pathwaysGlycosphingolipid biosynthesis - lacto and neolacto series, Glycosphingolipid biosynthesis - globo and isoglobo series, ABO blood group biosynthesis Related via 3 shared pathways including Glycosphingolipid biosynthesis - lacto and neolacto series, Glycosphingolipid biosynthesis - globo and isoglobo series. FUT2 5 shared diseasesCholecystolithiasis, Duodenal ulcer, Gallstones, Gastric ulcer, Peptic ulcer disease 3 shared pathwaysGlycosphingolipid biosynthesis - lacto and neolacto series, Glycosphingolipid biosynthesis - globo and isoglobo series, ABO blood group biosynthesis 5 shared evidence sourcesGWAS catalog (Cholecystolithiasis), GWAS catalog (Duodenal ulcer), GWAS catalog (Gallstones), GWAS catalog (Gastric ulcer), GWAS catalog (Peptic ulcer disease) Related via 5 shared diseases including Cholecystolithiasis, Duodenal ulcer — evidence mostly GWAS catalog. A4GALT 2 shared pathwaysGlycosphingolipid biosynthesis - lacto and neolacto series, Glycosphingolipid biosynthesis - globo and isoglobo series Related via 2 shared pathways including Glycosphingolipid biosynthesis - lacto and neolacto series, Glycosphingolipid biosynthesis - globo and isoglobo series. CELSR2 9 shared diseasesCerebrovascular disorder, Ischemic heart disease, Diabetes mellitus, Hyperlipidemia, Heart disease, Large artery stroke, Peripheral arterial disease, Peripheral vascular disease, Vascular disease 13 shared evidence sourcesDisgenet (Ischemic heart disease), Disgenet (Coronary artery disease), CTD (Coronary artery disease), GWAS catalog (Diabetes mellitus), GWAS catalog (Hyperlipidemia), GWAS catalog (Heart disease), GWAS catalog (Heart failure), GWAS catalog (Large artery stroke), GWAS catalog (Myocardial ischemia), GWAS catalog (Peripheral arterial disease), GWAS catalog (Peripheral vascular disease), GWAS catalog (Stroke) +1 more Related via 9 shared diseases including Cerebrovascular disorder, Ischemic heart disease — evidence mostly GWAS catalog. FTO 13 shared diseasesAnemia, Cataract, Cholecystolithiasis, Ischemic heart disease, Venous insufficiency, Diabetes mellitus, Diabetic neuropathy, Mood disorder, Edema, Hyperlipidemia, Heart disease, Seasonal allergic rhinitis +1 more 17 shared evidence sourcesGWAS catalog (Anemia), GWAS catalog (Cataract), GWAS catalog (Cholecystolithiasis), Disgenet (Ischemic heart disease), GWAS catalog (Venous insufficiency), Disgenet (Coronary artery disease), GWAS catalog (Diabetes mellitus), GWAS catalog (Diabetic neuropathy), Disgenet (Mood disorder), GWAS catalog (Edema), GWAS catalog (Hyperlipidemia), GWAS catalog (Heart disease) +5 more Related via 13 shared diseases including Anemia, Cataract — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
FUT1	0	[]	3	["Glycosphingolipid biosynthesis - lacto and neolacto series","Glycosphingolipid biosynthesis - globo and isoglobo series","ABO blood group biosynthesis"]	0	[]
FUT2	5	["Cholecystolithiasis","Duodenal ulcer","Gallstones","Gastric ulcer","Peptic ulcer disease"]	3	["Glycosphingolipid biosynthesis - lacto and neolacto series","Glycosphingolipid biosynthesis - globo and isoglobo series","ABO blood group biosynthesis"]	5	["GWAS catalog (Cholecystolithiasis)","GWAS catalog (Duodenal ulcer)","GWAS catalog (Gallstones)","GWAS catalog (Gastric ulcer)","GWAS catalog (Peptic ulcer disease)"]
A4GALT	0	[]	2	["Glycosphingolipid biosynthesis - lacto and neolacto series","Glycosphingolipid biosynthesis - globo and isoglobo series"]	0	[]
CELSR2	9	["Cerebrovascular disorder","Ischemic heart disease","Diabetes mellitus","Hyperlipidemia","Heart disease","Large artery stroke","Peripheral arterial disease","Peripheral vascular disease","Vascular disease"]	0	[]	13	["Disgenet (Ischemic heart disease)","Disgenet (Coronary artery disease)","CTD (Coronary artery disease)","GWAS catalog (Diabetes mellitus)","GWAS catalog (Hyperlipidemia)","GWAS catalog (Heart disease)","GWAS catalog (Heart failure)","GWAS catalog (Large artery stroke)","GWAS catalog (Myocardial ischemia)","GWAS catalog (Peripheral arterial disease)","GWAS catalog (Peripheral vascular disease)","GWAS catalog (Stroke)"]
FTO	13	["Anemia","Cataract","Cholecystolithiasis","Ischemic heart disease","Venous insufficiency","Diabetes mellitus","Diabetic neuropathy","Mood disorder","Edema","Hyperlipidemia","Heart disease","Seasonal allergic rhinitis"]	0	[]	17	["GWAS catalog (Anemia)","GWAS catalog (Cataract)","GWAS catalog (Cholecystolithiasis)","Disgenet (Ischemic heart disease)","GWAS catalog (Venous insufficiency)","Disgenet (Coronary artery disease)","GWAS catalog (Diabetes mellitus)","GWAS catalog (Diabetic neuropathy)","Disgenet (Mood disorder)","GWAS catalog (Edema)","GWAS catalog (Hyperlipidemia)","GWAS catalog (Heart disease)"]

Diseases Linked via Similar Genes

Cardiovascular disease Linked via 3 of 5 related genesFUT2, CELSR2, FTO Bombay phenotype Linked via 2 of 5 related genesFUT1, FUT2 Lung cancer Linked via 2 of 5 related genesFUT2, FTO Nonalcoholic fatty liver disease Linked via 2 of 5 related genesFUT2, FTO Osteoarthritis Linked via 2 of 5 related genesFUT2, FTO

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Cardiovascular disease	3	["FUT2","CELSR2","FTO"]
Bombay phenotype	2	["FUT1","FUT2"]
Lung cancer	2	["FUT2","FTO"]
Nonalcoholic fatty liver disease	2	["FUT2","FTO"]
Osteoarthritis	2	["FUT2","FTO"]