FSTL4 (follistatin like 4)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 23105
• Gene name: Follistatin like 4
• Gene symbol: FSTL4
• Synonyms (NCBI Gene): -
• Chromosome: 5
• Chromosome location: 5q31.1

miRNA Show/Hide all (236)

miRTarBase ID	miRNA	Experiments	Reference
MIRT658054	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT615983	hsa-miR-183-3p	HITS-CLIP	23824327
MIRT615982	hsa-miR-4452	HITS-CLIP	23824327
MIRT658053	hsa-miR-4503	HITS-CLIP	23824327
MIRT658052	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT615989	hsa-miR-4780	HITS-CLIP	23824327
MIRT615988	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT615987	hsa-miR-4742-3p	HITS-CLIP	23824327
MIRT615986	hsa-miR-623	HITS-CLIP	23824327
MIRT615985	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT615984	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT615983	hsa-miR-183-3p	HITS-CLIP	23824327
MIRT615982	hsa-miR-4452	HITS-CLIP	23824327
MIRT615981	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT615980	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT615979	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT490710	hsa-miR-4426	PAR-CLIP	23592263
MIRT490711	hsa-miR-4647	PAR-CLIP	23592263
MIRT490709	hsa-miR-4662b	PAR-CLIP	23592263
MIRT490708	hsa-miR-4475	PAR-CLIP	23592263
MIRT490707	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT490706	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT490705	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT490704	hsa-miR-7515	PAR-CLIP	23592263
MIRT490703	hsa-miR-4533	PAR-CLIP	23592263
MIRT490702	hsa-miR-3202	PAR-CLIP	23592263
MIRT490701	hsa-miR-4434	PAR-CLIP	23592263
MIRT490700	hsa-miR-4516	PAR-CLIP	23592263
MIRT490699	hsa-miR-5703	PAR-CLIP	23592263
MIRT490698	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT490696	hsa-miR-3175	PAR-CLIP	23592263
MIRT490697	hsa-miR-4447	PAR-CLIP	23592263
MIRT490695	hsa-miR-4472	PAR-CLIP	23592263
MIRT460823	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT460822	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT460821	hsa-miR-3681-5p	PAR-CLIP	23592263
MIRT460820	hsa-miR-6849-5p	PAR-CLIP	23592263
MIRT460819	hsa-miR-1193	PAR-CLIP	23592263
MIRT460818	hsa-miR-4640-5p	PAR-CLIP	23592263
MIRT460817	hsa-miR-4726-5p	PAR-CLIP	23592263
MIRT460816	hsa-miR-6508-3p	PAR-CLIP	23592263
MIRT460814	hsa-miR-3691-5p	PAR-CLIP	23592263
MIRT460815	hsa-miR-432-3p	PAR-CLIP	23592263
MIRT658054	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT615983	hsa-miR-183-3p	HITS-CLIP	23824327
MIRT615982	hsa-miR-4452	HITS-CLIP	23824327
MIRT658053	hsa-miR-4503	HITS-CLIP	23824327
MIRT658052	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT615989	hsa-miR-4780	HITS-CLIP	23824327
MIRT615988	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT615987	hsa-miR-4742-3p	HITS-CLIP	23824327
MIRT615986	hsa-miR-623	HITS-CLIP	23824327
MIRT615985	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT615984	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT615983	hsa-miR-183-3p	HITS-CLIP	23824327
MIRT615982	hsa-miR-4452	HITS-CLIP	23824327
MIRT615981	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT615980	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT615979	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT490710	hsa-miR-4426	PAR-CLIP	23592263
MIRT490711	hsa-miR-4647	PAR-CLIP	23592263
MIRT490709	hsa-miR-4662b	PAR-CLIP	23592263
MIRT490708	hsa-miR-4475	PAR-CLIP	23592263
MIRT490707	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT490706	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT490705	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT490704	hsa-miR-7515	PAR-CLIP	23592263
MIRT490703	hsa-miR-4533	PAR-CLIP	23592263
MIRT490702	hsa-miR-3202	PAR-CLIP	23592263
MIRT490701	hsa-miR-4434	PAR-CLIP	23592263
MIRT490700	hsa-miR-4516	PAR-CLIP	23592263
MIRT490699	hsa-miR-5703	PAR-CLIP	23592263
MIRT490698	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT490696	hsa-miR-3175	PAR-CLIP	23592263
MIRT490697	hsa-miR-4447	PAR-CLIP	23592263
MIRT490695	hsa-miR-4472	PAR-CLIP	23592263
MIRT460823	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT460822	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT460821	hsa-miR-3681-5p	PAR-CLIP	23592263
MIRT460820	hsa-miR-6849-5p	PAR-CLIP	23592263
MIRT460819	hsa-miR-1193	PAR-CLIP	23592263
MIRT460818	hsa-miR-4640-5p	PAR-CLIP	23592263
MIRT460817	hsa-miR-4726-5p	PAR-CLIP	23592263
MIRT460816	hsa-miR-6508-3p	PAR-CLIP	23592263
MIRT460814	hsa-miR-3691-5p	PAR-CLIP	23592263
MIRT460815	hsa-miR-432-3p	PAR-CLIP	23592263
MIRT1005568	hsa-miR-103a	CLIP-seq
MIRT1005569	hsa-miR-107	CLIP-seq
MIRT1005570	hsa-miR-1270	CLIP-seq
MIRT1005571	hsa-miR-1271	CLIP-seq
MIRT1005572	hsa-miR-1301	CLIP-seq
MIRT1005573	hsa-miR-1304	CLIP-seq
MIRT1005574	hsa-miR-15a	CLIP-seq
MIRT1005575	hsa-miR-15b	CLIP-seq
MIRT1005576	hsa-miR-16	CLIP-seq
MIRT1005577	hsa-miR-1827	CLIP-seq
MIRT1005578	hsa-miR-185	CLIP-seq
MIRT1005579	hsa-miR-188-5p	CLIP-seq
MIRT1005580	hsa-miR-195	CLIP-seq
MIRT1005581	hsa-miR-204	CLIP-seq
MIRT1005582	hsa-miR-211	CLIP-seq
MIRT1005583	hsa-miR-2117	CLIP-seq
MIRT1005584	hsa-miR-3121-3p	CLIP-seq
MIRT1005585	hsa-miR-3148	CLIP-seq
MIRT1005586	hsa-miR-3160-5p	CLIP-seq
MIRT1005587	hsa-miR-3184	CLIP-seq
MIRT1005588	hsa-miR-346	CLIP-seq
MIRT1005589	hsa-miR-3660	CLIP-seq
MIRT1005590	hsa-miR-3682-3p	CLIP-seq
MIRT1005591	hsa-miR-3910	CLIP-seq
MIRT1005592	hsa-miR-3922-5p	CLIP-seq
MIRT1005593	hsa-miR-3941	CLIP-seq
MIRT1005594	hsa-miR-3944-5p	CLIP-seq
MIRT1005595	hsa-miR-410	CLIP-seq
MIRT1005596	hsa-miR-423-5p	CLIP-seq
MIRT1005597	hsa-miR-424	CLIP-seq
MIRT1005598	hsa-miR-4257	CLIP-seq
MIRT1005599	hsa-miR-4273	CLIP-seq
MIRT1005600	hsa-miR-4288	CLIP-seq
MIRT1005601	hsa-miR-4306	CLIP-seq
MIRT1005602	hsa-miR-432	CLIP-seq
MIRT1005603	hsa-miR-4453	CLIP-seq
MIRT1005604	hsa-miR-4461	CLIP-seq
MIRT1005605	hsa-miR-4526	CLIP-seq
MIRT1005606	hsa-miR-4531	CLIP-seq
MIRT1005607	hsa-miR-4538	CLIP-seq
MIRT1005608	hsa-miR-4644	CLIP-seq
MIRT1005609	hsa-miR-466	CLIP-seq
MIRT1005610	hsa-miR-4660	CLIP-seq
MIRT1005611	hsa-miR-4672	CLIP-seq
MIRT1005612	hsa-miR-497	CLIP-seq
MIRT1005613	hsa-miR-5047	CLIP-seq
MIRT1005614	hsa-miR-526b	CLIP-seq
MIRT1005615	hsa-miR-578	CLIP-seq
MIRT1005616	hsa-miR-620	CLIP-seq
MIRT1005617	hsa-miR-629	CLIP-seq
MIRT1005618	hsa-miR-632	CLIP-seq
MIRT1005619	hsa-miR-940	CLIP-seq
MIRT1005620	hsa-miR-96	CLIP-seq
MIRT1998018	hsa-miR-1237	CLIP-seq
MIRT1005570	hsa-miR-1270	CLIP-seq
MIRT1998019	hsa-miR-140-3p	CLIP-seq
MIRT1998020	hsa-miR-149	CLIP-seq
MIRT1005579	hsa-miR-188-5p	CLIP-seq
MIRT1998021	hsa-miR-197	CLIP-seq
MIRT1998022	hsa-miR-223	CLIP-seq
MIRT1998023	hsa-miR-299-3p	CLIP-seq
MIRT1998024	hsa-miR-3064-5p	CLIP-seq
MIRT1005584	hsa-miR-3121-3p	CLIP-seq
MIRT1998025	hsa-miR-3607-5p	CLIP-seq
MIRT1005595	hsa-miR-410	CLIP-seq
MIRT1998026	hsa-miR-4293	CLIP-seq
MIRT1005602	hsa-miR-432	CLIP-seq
MIRT1998027	hsa-miR-4324	CLIP-seq
MIRT1998028	hsa-miR-4329	CLIP-seq
MIRT1005606	hsa-miR-4531	CLIP-seq
MIRT1998029	hsa-miR-4648	CLIP-seq
MIRT1998030	hsa-miR-4654	CLIP-seq
MIRT1998031	hsa-miR-4687-3p	CLIP-seq
MIRT1998032	hsa-miR-4693-3p	CLIP-seq
MIRT1998033	hsa-miR-4697-3p	CLIP-seq
MIRT1998034	hsa-miR-4764-5p	CLIP-seq
MIRT1998035	hsa-miR-4769-5p	CLIP-seq
MIRT1998036	hsa-miR-4794	CLIP-seq
MIRT1998037	hsa-miR-488	CLIP-seq
MIRT1005616	hsa-miR-620	CLIP-seq
MIRT1005617	hsa-miR-629	CLIP-seq
MIRT1005568	hsa-miR-103a	CLIP-seq
MIRT1005569	hsa-miR-107	CLIP-seq
MIRT2231627	hsa-miR-1197	CLIP-seq
MIRT1005570	hsa-miR-1270	CLIP-seq
MIRT1005574	hsa-miR-15a	CLIP-seq
MIRT1005575	hsa-miR-15b	CLIP-seq
MIRT1005576	hsa-miR-16	CLIP-seq
MIRT1005578	hsa-miR-185	CLIP-seq
MIRT1005579	hsa-miR-188-5p	CLIP-seq
MIRT1005580	hsa-miR-195	CLIP-seq
MIRT1005581	hsa-miR-204	CLIP-seq
MIRT1005582	hsa-miR-211	CLIP-seq
MIRT1005583	hsa-miR-2117	CLIP-seq
MIRT1005588	hsa-miR-346	CLIP-seq
MIRT2231628	hsa-miR-34a	CLIP-seq
MIRT2231629	hsa-miR-34c-5p	CLIP-seq
MIRT1005593	hsa-miR-3941	CLIP-seq
MIRT1005597	hsa-miR-424	CLIP-seq
MIRT1005598	hsa-miR-4257	CLIP-seq
MIRT2231630	hsa-miR-4269	CLIP-seq
MIRT1005599	hsa-miR-4273	CLIP-seq
MIRT1005600	hsa-miR-4288	CLIP-seq
MIRT1998026	hsa-miR-4293	CLIP-seq
MIRT1005601	hsa-miR-4306	CLIP-seq
MIRT1005602	hsa-miR-432	CLIP-seq
MIRT1998027	hsa-miR-4324	CLIP-seq
MIRT1998028	hsa-miR-4329	CLIP-seq
MIRT2231631	hsa-miR-4433	CLIP-seq
MIRT2231632	hsa-miR-4436a	CLIP-seq
MIRT2231633	hsa-miR-449a	CLIP-seq
MIRT2231634	hsa-miR-449b	CLIP-seq
MIRT2231635	hsa-miR-4514	CLIP-seq
MIRT1005606	hsa-miR-4531	CLIP-seq
MIRT2231636	hsa-miR-4643	CLIP-seq
MIRT1005608	hsa-miR-4644	CLIP-seq
MIRT1005609	hsa-miR-466	CLIP-seq
MIRT1005611	hsa-miR-4672	CLIP-seq
MIRT2231637	hsa-miR-4692	CLIP-seq
MIRT2231638	hsa-miR-4714-5p	CLIP-seq
MIRT2231639	hsa-miR-4722-5p	CLIP-seq
MIRT2231640	hsa-miR-4742-5p	CLIP-seq
MIRT2231641	hsa-miR-487a	CLIP-seq
MIRT1005612	hsa-miR-497	CLIP-seq
MIRT2231642	hsa-miR-548ac	CLIP-seq
MIRT2231643	hsa-miR-548d-3p	CLIP-seq
MIRT2231644	hsa-miR-548z	CLIP-seq
MIRT1005616	hsa-miR-620	CLIP-seq
MIRT1005618	hsa-miR-632	CLIP-seq
MIRT2231645	hsa-miR-642b	CLIP-seq
MIRT1005619	hsa-miR-940	CLIP-seq
MIRT2388239	hsa-miR-1184	CLIP-seq
MIRT2388240	hsa-miR-1205	CLIP-seq
MIRT2388241	hsa-miR-3158-5p	CLIP-seq
MIRT2449920	hsa-miR-1224-3p	CLIP-seq
MIRT2449921	hsa-miR-1260	CLIP-seq
MIRT2449922	hsa-miR-1260b	CLIP-seq
MIRT2449923	hsa-miR-1280	CLIP-seq
MIRT2449924	hsa-miR-345	CLIP-seq
MIRT2449925	hsa-miR-4286	CLIP-seq
MIRT2449926	hsa-miR-4732-3p	CLIP-seq
MIRT2449927	hsa-miR-532-3p	CLIP-seq
MIRT2681218	hsa-miR-1245b-3p	CLIP-seq
MIRT1998020	hsa-miR-149	CLIP-seq
MIRT2681219	hsa-miR-2116	CLIP-seq
MIRT1998024	hsa-miR-3064-5p	CLIP-seq
MIRT1005599	hsa-miR-4273	CLIP-seq
MIRT2681220	hsa-miR-4677-5p	CLIP-seq
MIRT1998036	hsa-miR-4794	CLIP-seq
MIRT2681221	hsa-miR-591	CLIP-seq

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IEA
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0030141	Component	Secretory granule	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030510	Process	Regulation of BMP signaling pathway	IBA
GO:0031549	Process	Negative regulation of brain-derived neurotrophic factor receptor signaling pathway	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048403	Function	Brain-derived neurotrophic factor binding	IEA
GO:0048670	Process	Regulation of collateral sprouting	IEA
GO:0048671	Process	Negative regulation of collateral sprouting	IEA
GO:0061000	Process	Negative regulation of dendritic spine development	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q6MZW2
• Protein name: Follistatin-related protein 4 (Follistatin-like protein 4)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07648	Kazal_2	87 → 133	Kazal-type serine protease inhibitor domain	Domain
  PF13927	Ig_3	340 → 417		Domain
  PF13927	Ig_3	250 → 324		Domain

• Sequence:

  MKPGGFWLHLTLLGASLPAALGWMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNE
  LLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGSDGRFYENHCKLHRAACL
  LGKRITVIHSKDCFLKGDTCTMAGYARLKNVLLALQTRLQPLQEGDSRQDPASQKRLLVE
  SLFRDLDADGNGHLSSSELAQHVLKKQDLDEDLLGCSPGDLLRFDDYNSDSSLTLREFYM
  AFQVVQLSLAPEDRVSVTTVTVGLSTVLTCAVHGDLRPPIIWKRNGLTLNFLDLEDINDF
  GEDDSLYITKVTTIHMGNYTCHASGHEQLFQTHVLQVNVPPVIRVYPESQAQEPGVAASL
  RCHAEGIPMPRITWLKNGVDVSTQMSKQLSLLANGSELHISSVRYEDTGAYTCIAKNEVG
  VDEDISSLFIEDSARKTLANILWREEGLSVGNMFYVFSDDGIIVIHPVDCEIQRHLKPTE
  KIFMSYEEICPQREKNATQPCQWVSAVNVRNRYIYVAQPALSRVLVVDIQAQKVLQSIGV
  DPLPAKLSYDKSHDQVWVLSWGDVHKSRPSLQVITEASTGQSQHLIRTPFAGVDDFFIPP
  TNLIINHIRFGFIFNKSDPAVHKVDLETMMPLKTIGLHHHGCVPQAMAHTHLGGYFFIQC
  RQDSPASAARQLLVDSVTDSVLGPNGDVTGTPHTSPDGRFIVSAAADSPWLHVQEITVRG
  EIQTLYDLQINSGISDLAFQRSFTESNQYNIYAALHTEPDLLFLELSTGKVGMLKNLKEP
  PAGPAQPWGGTHRIMRDSGLFGQYLLTPARESLFLINGRQNTLRCEVSGIKGGTTVVWVG
  EV

• Sequence length: 842

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (18)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	18951430	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONDUCT DISORDER	—	GWAS catalog	18951430	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	32121467	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	22179738	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	22384028	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	27622933	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	32121467	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	27622933	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOYAMOYA DISEASE	—	GWAS catalog	29273593	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	37344610	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY DENTAL CARIES	—	GWAS catalog	34749984	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	38538606	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	38538606	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	30891314	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CARCINOMA	—	GWAS catalog	28604730	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPORADIC AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	24529757	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	17554300, 39749473	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	17554300, 39749473	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (7)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis, Gouty	Gouty arthritis	GWASCAT_DG	22179738		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	39930364	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASCAT_DG	22179738		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	GWASCAT_DG	27622933		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	GWASCAT_DG	27622933		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30747226	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	19023099	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

HMGN4 3 shared diseasesDental caries, Post-traumatic stress disorder, Small cell lung carcinoma 3 shared evidence sourcesGWAS catalog (Dental caries), GWAS catalog (Post-traumatic stress disorder), GWAS catalog (Small cell lung carcinoma) Related via 3 shared diseases including Dental caries, Post-traumatic stress disorder — evidence mostly GWAS catalog. IP6K1 2 shared diseasesDental caries, Post-traumatic stress disorder 3 shared evidence sourcesGWAS catalog (Dental caries), GWAS catalog (Endometriosis), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Dental caries, Post-traumatic stress disorder — evidence mostly GWAS catalog. BBX 2 shared diseasesMood disorder, Small cell lung carcinoma 2 shared evidence sourcesGWAS catalog (Mood disorder), GWAS catalog (Small cell lung carcinoma) Related via 2 shared diseases including Mood disorder, Small cell lung carcinoma — evidence mostly GWAS catalog. CSE1L 2 shared diseasesMood disorder, Post-traumatic stress disorder 2 shared evidence sourcesGWAS catalog (Mood disorder), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Mood disorder, Post-traumatic stress disorder — evidence mostly GWAS catalog. CDC42BPG 2 shared diseasesMoyamoya disease, Post-traumatic stress disorder 2 shared evidence sourcesGWAS catalog (Moyamoya disease), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Moyamoya disease, Post-traumatic stress disorder — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
HMGN4	3	["Dental caries","Post-traumatic stress disorder","Small cell lung carcinoma"]	0	[]	3	["GWAS catalog (Dental caries)","GWAS catalog (Post-traumatic stress disorder)","GWAS catalog (Small cell lung carcinoma)"]
IP6K1	2	["Dental caries","Post-traumatic stress disorder"]	0	[]	3	["GWAS catalog (Dental caries)","GWAS catalog (Endometriosis)","GWAS catalog (Post-traumatic stress disorder)"]
BBX	2	["Mood disorder","Small cell lung carcinoma"]	0	[]	2	["GWAS catalog (Mood disorder)","GWAS catalog (Small cell lung carcinoma)"]
CSE1L	2	["Mood disorder","Post-traumatic stress disorder"]	0	[]	2	["GWAS catalog (Mood disorder)","GWAS catalog (Post-traumatic stress disorder)"]
CDC42BPG	2	["Moyamoya disease","Post-traumatic stress disorder"]	0	[]	2	["GWAS catalog (Moyamoya disease)","GWAS catalog (Post-traumatic stress disorder)"]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 3 of 5 related genesHMGN4, IP6K1, CSE1L Multiple sclerosis Linked via 2 of 5 related genesHMGN4, BBX Schizophrenia Linked via 2 of 5 related genesHMGN4, BBX Autism Linked via 1 of 5 related genesHMGN4 Cannabis abuse Linked via 1 of 5 related genesHMGN4

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	3	["HMGN4","IP6K1","CSE1L"]
Multiple sclerosis	2	["HMGN4","BBX"]
Schizophrenia	2	["HMGN4","BBX"]
Autism	1	["HMGN4"]
Cannabis abuse	1	["HMGN4"]