Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	2246
Gene name	Fibroblast growth factor 1
Gene symbol	FGF1
Synonyms (NCBI Gene)	AFGFECGFECGF-betaECGFAECGFBFGF-1FGF-alphaFGFAGLIO703HBGF-1HBGF1
Chromosome	5
Chromosome location	5q31.3
Summary	The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cel

155 Show/Hide all (155)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022188	hsa-miR-124-3p	Microarray	18668037
MIRT025666	hsa-miR-7-5p	Microarray	17612493
MIRT710282	hsa-miR-7109-3p	HITS-CLIP	19536157
MIRT710281	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT710280	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT710279	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT710278	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT710277	hsa-miR-6069	HITS-CLIP	19536157
MIRT717736	hsa-miR-1295b-5p	HITS-CLIP	19536157
MIRT717735	hsa-miR-1912	HITS-CLIP	19536157
MIRT717734	hsa-miR-4773	HITS-CLIP	19536157
MIRT717733	hsa-miR-500b-3p	HITS-CLIP	19536157
MIRT717732	hsa-miR-589-3p	HITS-CLIP	19536157
MIRT717731	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT717730	hsa-miR-302b-5p	HITS-CLIP	19536157
MIRT717729	hsa-miR-302d-5p	HITS-CLIP	19536157
MIRT717728	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT710282	hsa-miR-7109-3p	HITS-CLIP	19536157
MIRT710281	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT710280	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT710279	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT710278	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT710277	hsa-miR-6069	HITS-CLIP	19536157
MIRT710282	hsa-miR-7109-3p	HITS-CLIP	19536157
MIRT710281	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT710280	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT710279	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT710278	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT710277	hsa-miR-6069	HITS-CLIP	19536157
MIRT446188	hsa-miR-4513	PAR-CLIP	22100165
MIRT446187	hsa-miR-6855-3p	PAR-CLIP	22100165
MIRT446186	hsa-miR-6857-3p	PAR-CLIP	22100165
MIRT446185	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446184	hsa-miR-3136-5p	PAR-CLIP	22100165
MIRT446183	hsa-miR-4439	PAR-CLIP	22100165
MIRT446182	hsa-miR-943	PAR-CLIP	22100165
MIRT731763	hsa-miR-326	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26183397
MIRT731763	hsa-miR-326	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26183397
MIRT732611	hsa-miR-150-3p	qRT-PCR	33909697
MIRT732613	hsa-miR-199a-3p	qRT-PCR	33909697
MIRT732617	hsa-miR-320a	qRT-PCR	33909697
MIRT736193	hsa-miR-18a-5p	Luciferase reporter assayWestern blottingqRT-PCR	32210827
MIRT710282	hsa-miR-7109-3p	HITS-CLIP	19536157
MIRT710281	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT710280	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT710279	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT710278	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT710277	hsa-miR-6069	HITS-CLIP	19536157
MIRT717736	hsa-miR-1295b-5p	HITS-CLIP	19536157
MIRT717735	hsa-miR-1912	HITS-CLIP	19536157
MIRT717734	hsa-miR-4773	HITS-CLIP	19536157
MIRT717733	hsa-miR-500b-3p	HITS-CLIP	19536157
MIRT717732	hsa-miR-589-3p	HITS-CLIP	19536157
MIRT717731	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT717730	hsa-miR-302b-5p	HITS-CLIP	19536157
MIRT717729	hsa-miR-302d-5p	HITS-CLIP	19536157
MIRT717728	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT710282	hsa-miR-7109-3p	HITS-CLIP	19536157
MIRT710281	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT710280	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT710279	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT710278	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT710277	hsa-miR-6069	HITS-CLIP	19536157
MIRT710282	hsa-miR-7109-3p	HITS-CLIP	19536157
MIRT710281	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT710280	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT710279	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT710278	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT710277	hsa-miR-6069	HITS-CLIP	19536157
MIRT446188	hsa-miR-4513	PAR-CLIP	22100165
MIRT446187	hsa-miR-6855-3p	PAR-CLIP	22100165
MIRT446186	hsa-miR-6857-3p	PAR-CLIP	22100165
MIRT446185	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446184	hsa-miR-3136-5p	PAR-CLIP	22100165
MIRT446183	hsa-miR-4439	PAR-CLIP	22100165
MIRT446182	hsa-miR-943	PAR-CLIP	22100165
MIRT995518	hsa-miR-148a	CLIP-seq
MIRT995519	hsa-miR-148b	CLIP-seq
MIRT995520	hsa-miR-152	CLIP-seq
MIRT995521	hsa-miR-1913	CLIP-seq
MIRT995522	hsa-miR-298	CLIP-seq
MIRT995523	hsa-miR-3134	CLIP-seq
MIRT995524	hsa-miR-3158-5p	CLIP-seq
MIRT995525	hsa-miR-3192	CLIP-seq
MIRT995526	hsa-miR-324-3p	CLIP-seq
MIRT995527	hsa-miR-3713	CLIP-seq
MIRT995528	hsa-miR-4264	CLIP-seq
MIRT995529	hsa-miR-4313	CLIP-seq
MIRT995530	hsa-miR-4314	CLIP-seq
MIRT995531	hsa-miR-4418	CLIP-seq
MIRT995532	hsa-miR-4473	CLIP-seq
MIRT995533	hsa-miR-4496	CLIP-seq
MIRT995534	hsa-miR-4534	CLIP-seq
MIRT995535	hsa-miR-4646-5p	CLIP-seq
MIRT995536	hsa-miR-4789-5p	CLIP-seq
MIRT995537	hsa-miR-4797-3p	CLIP-seq
MIRT995538	hsa-miR-509-3-5p	CLIP-seq
MIRT995539	hsa-miR-509-5p	CLIP-seq
MIRT995540	hsa-miR-512-3p	CLIP-seq
MIRT995541	hsa-miR-515-3p	CLIP-seq
MIRT995542	hsa-miR-519e	CLIP-seq
MIRT995543	hsa-miR-520f	CLIP-seq
MIRT995544	hsa-miR-550a	CLIP-seq
MIRT995545	hsa-miR-629	CLIP-seq
MIRT995546	hsa-miR-873	CLIP-seq
MIRT995547	hsa-miR-1343	CLIP-seq
MIRT995521	hsa-miR-1913	CLIP-seq
MIRT995548	hsa-miR-1976	CLIP-seq
MIRT995522	hsa-miR-298	CLIP-seq
MIRT995523	hsa-miR-3134	CLIP-seq
MIRT995549	hsa-miR-3153	CLIP-seq
MIRT995524	hsa-miR-3158-5p	CLIP-seq
MIRT995550	hsa-miR-320b	CLIP-seq
MIRT995551	hsa-miR-320c	CLIP-seq
MIRT995552	hsa-miR-320d	CLIP-seq
MIRT995526	hsa-miR-324-3p	CLIP-seq
MIRT995529	hsa-miR-4313	CLIP-seq
MIRT995531	hsa-miR-4418	CLIP-seq
MIRT995553	hsa-miR-4429	CLIP-seq
MIRT995534	hsa-miR-4534	CLIP-seq
MIRT995535	hsa-miR-4646-5p	CLIP-seq
MIRT995554	hsa-miR-4668-5p	CLIP-seq
MIRT995538	hsa-miR-509-3-5p	CLIP-seq
MIRT995539	hsa-miR-509-5p	CLIP-seq
MIRT995555	hsa-miR-522	CLIP-seq
MIRT995556	hsa-miR-1245b-3p	CLIP-seq
MIRT995557	hsa-miR-1270	CLIP-seq
MIRT995558	hsa-miR-136	CLIP-seq
MIRT995559	hsa-miR-21	CLIP-seq
MIRT995560	hsa-miR-2355-5p	CLIP-seq
MIRT995561	hsa-miR-3174	CLIP-seq
MIRT995562	hsa-miR-361-5p	CLIP-seq
MIRT995563	hsa-miR-4531	CLIP-seq
MIRT995564	hsa-miR-4683	CLIP-seq
MIRT995536	hsa-miR-4789-5p	CLIP-seq
MIRT995565	hsa-miR-590-5p	CLIP-seq
MIRT995566	hsa-miR-620	CLIP-seq
MIRT1548684	hsa-miR-128	CLIP-seq
MIRT1548685	hsa-miR-27a	CLIP-seq
MIRT1548686	hsa-miR-27b	CLIP-seq
MIRT1548687	hsa-miR-342-3p	CLIP-seq
MIRT1548688	hsa-miR-513a-3p	CLIP-seq
MIRT2229333	hsa-miR-193a-3p	CLIP-seq
MIRT2229334	hsa-miR-193b	CLIP-seq
MIRT2229335	hsa-miR-214	CLIP-seq
MIRT2229336	hsa-miR-3194-5p	CLIP-seq
MIRT2229337	hsa-miR-3619-5p	CLIP-seq
MIRT2229338	hsa-miR-4291	CLIP-seq
MIRT2229339	hsa-miR-4435	CLIP-seq
MIRT2229340	hsa-miR-4463	CLIP-seq
MIRT2229341	hsa-miR-4494	CLIP-seq
MIRT2229342	hsa-miR-761	CLIP-seq
MIRT995546	hsa-miR-873	CLIP-seq
MIRT2229343	hsa-miR-922	CLIP-seq
MIRT2387984	hsa-miR-513b	CLIP-seq

Transcription factor	Regulation	Reference
PPARG	Unknown	22522926
RFX1	Unknown	20189986;22415835
RFX2	Unknown	22415835
RFX3	Unknown	22415835
STAT3	Repression	14673954

74 Show/Hide all (74)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001759	Process	Organ induction	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IBA
GO:0005104	Function	Fibroblast growth factor receptor binding	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IMP	18441324
GO:0005104	Function	Fibroblast growth factor receptor binding	IPI	10830168, 12815063
GO:0005178	Function	Integrin binding	IDA	18441324
GO:0005515	Function	Protein binding	IPI	10618369, 10830168, 11069186, 14613973, 14732692, 18441324, 23597563, 25241761, 32296183, 33961781
GO:0005576	Component	Extracellular region	IDA	12746488
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	18400376
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	12746488
GO:0005829	Component	Cytosol	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0007165	Process	Signal transduction	NAS	3778488
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	20145243
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	1693186
GO:0008201	Function	Heparin binding	IDA	20145243
GO:0008201	Function	Heparin binding	IEA
GO:0008201	Function	Heparin binding	IMP	18441324
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	8663044, 18187602
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	18441324, 23469107
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IDA	20145243
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IGI	8663044, 18187602
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IMP	18441324
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IPI	10830168
GO:0009653	Process	Anatomical structure morphogenesis	TAS	1693186
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	23469107
GO:0022008	Process	Neurogenesis	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030324	Process	Lung development	IEA
GO:0030334	Process	Regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IDA	20145243
GO:0030335	Process	Positive regulation of cell migration	IMP	18441324
GO:0031012	Component	Extracellular matrix	IEA
GO:0032148	Process	Activation of protein kinase B activity	IMP	18441324
GO:0034605	Process	Cellular response to heat	IDA	12746488
GO:0042060	Process	Wound healing	IDA	16756958
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	16756958
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0044548	Function	S100 protein binding	IPI	11432880
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IDA	19229075
GO:0045766	Process	Positive regulation of angiogenesis	IDA	20145243
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19229075
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0051781	Process	Positive regulation of cell division	IDA	20145243
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0060681	Process	Branch elongation involved in ureteric bud branching	IDA	11731227
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	18441324
GO:0072163	Process	Mesonephric epithelium development	IDA	11731227
GO:1901509	Process	Regulation of endothelial tube morphogenesis	IMP	23469107
GO:1902533	Process	Positive regulation of intracellular signal transduction	IDA	19229075
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IEA
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IMP	23469107
GO:1905330	Process	Regulation of morphogenesis of an epithelium	IEA
GO:2000544	Process	Regulation of endothelial cell chemotaxis to fibroblast growth factor	IDA	16756958
GO:2000544	Process	Regulation of endothelial cell chemotaxis to fibroblast growth factor	IEA

MIM	HGNC	e!Ensembl
131220	3665	ENSG00000113578

P05230

Protein name

Fibroblast growth factor 1 (FGF-1) (Acidic fibroblast growth factor) (aFGF) (Endothelial cell growth factor) (ECGF) (Heparin-binding growth factor 1) (HBGF-1)

Protein function

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of

PDB

1AXM , 1DJS , 1DZC , 1DZD , 1E0O , 1EVT , 1HKN , 1JQZ , 1JT3 , 1JT4 , 1JT5 , 1JT7 , 1JTC , 1JY0 , 1K5U , 1K5V , 1M16 , 1NZK , 1P63 , 1PZZ , 1Q03 , 1Q04 , 1RG8 , 1RML , 1RY7 , 1YTO , 1Z2V , 1Z4S , 2AFG , 2AQZ , 2AXM , 2ERM , 2HW9 , 2HWA , 2HWM , 2HZ9 , 2K43 , 2K4A , 2K8R , 2KI4 , 2KI6 , 2NTD , 2Q9X , 2RQ9 , 3B9U , 3BA4 , 3BA5 , 3BA7 , 3BAD , 3BAG , 3BAH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00167	FGF	25 → 148	Fibroblast growth factor	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in kidney and brain. Detected at much lower levels in heart and skeletal muscle. {ECO:0000269|PubMed:11964394, ECO:0000269|PubMed:7504343}.

Sequence

MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Sequence length

155

Interactions

View interactions

KEGG Pathway	Reactome Pathway
MAPK signaling pathway	PI3K Cascade
Ras signaling pathway	PIP3 activates AKT signaling
Rap1 signaling pathway	Signaling by activated point mutants of FGFR1
Calcium signaling pathway	Signaling by activated point mutants of FGFR3
PI3K-Akt signaling pathway	FGFR4 ligand binding and activation
Hippo signaling pathway	FGFR1b ligand binding and activation
Regulation of actin cytoskeleton	FGFR3b ligand binding and activation
Pathways in cancer	FGFR3c ligand binding and activation
Melanoma	FGFR1c ligand binding and activation
Breast cancer	FGFR2c ligand binding and activation
Gastric cancer	FGFR2b ligand binding and activation
	FGFR3 mutant receptor activation
	Activated point mutants of FGFR2
	Constitutive Signaling by Aberrant PI3K in Cancer
	Phospholipase C-mediated cascade: FGFR1
	Phospholipase C-mediated cascade; FGFR2
	Phospholipase C-mediated cascade; FGFR3
	Phospholipase C-mediated cascade; FGFR4
	Downstream signaling of activated FGFR1
	SHC-mediated cascade:FGFR1
	PI-3K cascade:FGFR1
	FRS-mediated FGFR1 signaling
	PI-3K cascade:FGFR2
	SHC-mediated cascade:FGFR2
	FRS-mediated FGFR2 signaling
	SHC-mediated cascade:FGFR3
	FRS-mediated FGFR3 signaling
	PI-3K cascade:FGFR3
	FRS-mediated FGFR4 signaling
	SHC-mediated cascade:FGFR4
	PI-3K cascade:FGFR4
	Negative regulation of FGFR1 signaling
	Negative regulation of FGFR2 signaling
	Negative regulation of FGFR3 signaling
	Negative regulation of FGFR4 signaling
	Signaling by FGFR2 in disease
	Signaling by FGFR1 in disease
	RAF/MAP kinase cascade
	PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
	Signaling by FGFR3 point mutants in cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (11)
BRAIN ISCHEMIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT UPPER LIP	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLETE UNILATERAL CLEFT LIP	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	9233905	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA	—	CTD	17219402	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA	—	CTD	15878867	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	16214533	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	25174399	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	16324872	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (182)
5q-syndrome	5q-syndrome	BEFREE	9339364, 9624537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Achondroplasia	Achondroplasia	BEFREE	17561467, 26660953, 27040652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	20881564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10383711, 17538174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	10383711, 9375615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	11316575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	16324872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21990352, 7539161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	11726798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	7507297, 8685603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	26460236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	26460236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29268138, 8881516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	1691192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	23044924	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	17204151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11037874	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17204151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	1691192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	31217885, 31344532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	1938597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29268138, 8881516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	7693761	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	26598068, 31426340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	9375615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	20889570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	31792355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	31792355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	28977836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	1938597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11027428, 12574821, 12841677, 21360642, 23143756, 23912956, 25124967, 29575613, 8519654, 9184170, 9366526, 9443417, 9719443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10862617, 12841677, 23912956, 23981902, 26743380, 39302921, 9184170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38189813, 8519654	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20863990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	29691299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	9375615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	2457020, 25091573, 33275222, 36308081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	20889570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29017078, 29281903, 30217564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28656229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24146310, 25174399, 28718374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	39955869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	2463616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	28977836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28795363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 5q Deletion Syndrome	Chromosome 5q deletion syndrome	Pubtator	9339364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31189876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	24613087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26183471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21356388, 36064310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	28827771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	9385115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	1691192, 26400350, 28343287, 31260189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28281780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28281780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26806193	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28750927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27412358, 28664920, 28750927, 29991637, 30299902, 30523024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	24349248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	33909697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28750927, 28768285, 30320493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30031900, 8685603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	8685603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	12788899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	20504870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	11271786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	18819464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	17727254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20212229, 2474753, 29559295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27138904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27138904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26183397, 3301330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	3301330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	24349248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	8930647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	11271786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	30010249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	27076786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	27076786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30523024, 30796029, 31048370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	21436287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17909102, 21436287, 25918036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	28664920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36064310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	28977836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	26138239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27425145, 27638903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	12750963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28795363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome	Kallmann Syndrome	BEFREE	22842457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome	Kallmann syndrome	Pubtator	22842457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28475003		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	1717925		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	CTD_human_DG	17219402		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia, Mast-Cell	Leukemia	BEFREE	16524673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	1717925, 7514571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23970062, 25091573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	20162567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	20162567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	33115414	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	BEFREE	31488015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular retinal edema	Macular edema	BEFREE	31488015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11027428, 11329138, 12574821, 12841677, 16682955, 21360642, 23143756, 23912956, 25124967, 29575613, 8519654, 9184170, 9443417, 9719443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	8685603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29017078, 29281903, 30217564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24146310, 25174399, 28718374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	25174399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23159584, 9719443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	20889570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16497972, 17415525, 17538174, 18563556, 20723915, 21360642, 21984450, 23469107, 23555185, 24870599, 25091573, 27353029, 28718374, 29017078, 29575613, 30134556, 8519654, 9630568 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26183471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	BEFREE	12841677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12008951, 12841677, 9366526, 9443417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18762812		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19029025, 30237393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	1938597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	15144885		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	CTD_human_DG	15878867		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma Malignant	Mesothelioma	Pubtator	15878867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	7514571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mulibrey Nanism	Mulibrey Nanism	BEFREE	28432469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18458152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	19901323	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28117910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	10716758		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	7514571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndrome with Isolated del(5q)	Myelodysplastic syndrome	BEFREE	9339364, 9624537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16524673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	10527767, 27838293, 29016740		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	9385115		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasal Polyps	Nasal polyposis	BEFREE	16720444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35864158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10519418, 11070152, 11316575, 12237779, 12574821, 15930292, 17538174, 17727254, 19213040, 19962894, 20889570, 21302306, 21665938, 23159584, 23469107 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10329457, 29048426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21990352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26858440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20228166, 27412358, 28303556, 29991637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	23143756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	26400350	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	12145206, 29371290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29371290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17538174		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22990650, 24146310, 25174399, 28718374		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	25174399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22990650, 24146310, 32878513, 35778553	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11401320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	7507297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	7507297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29632659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31849673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	21716303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	21716303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Phosphate Diabetes	Phosphate Diabetes	BEFREE	29514106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	1938597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	28249301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14673954, 23159584, 2463616, 9719443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23159584, 28510269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	17204151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	12397010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	16324872		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27425145, 7511497		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Respiratory Failure	Respiratory Failure	BEFREE	10716758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	15767480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Fever	Rheumatic fever	Pubtator	26400350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11469450, 1691192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	15994966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	7539161		★★★★★ ★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	22187378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	15746061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	17204151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27353029, 28475003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28656229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	27353029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	26858440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	31657648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28469731, 37603701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34326372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20889570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27966750	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	10361120, 27678201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation, Paroxysmal Familial, 1	Ventricular Fibrillation	BEFREE	23426545		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
FGF9	3	["Cleft lip","Complete unilateral cleft lip","Mesothelioma"]	46	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer","PI5P, PP2A and IER3 Regulate PI3K\/AKT Signaling"]	3	["Disgenet (Cleft lip)","Disgenet (Complete unilateral cleft lip)","CTD (Mesothelioma)"]
FGF2	4	["Cleft lip","Complete unilateral cleft lip","Mesothelioma","Pulmonary fibrosis"]	47	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer","PI5P, PP2A and IER3 Regulate PI3K\/AKT Signaling"]	6	["Disgenet (Cleft lip)","Disgenet (Complete unilateral cleft lip)","CTD (Mesothelioma)","CTD (Myocardial ischemia)","CTD (Pulmonary fibrosis)","Disgenet (Pulmonary fibrosis)"]
FGF7	3	["Cleft lip","Complete unilateral cleft lip","Pulmonary fibrosis"]	21	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer","PI5P, PP2A and IER3 Regulate PI3K\/AKT Signaling"]	4	["Disgenet (Cleft lip)","Disgenet (Complete unilateral cleft lip)","CTD (Pulmonary fibrosis)","Disgenet (Pulmonary fibrosis)"]
FGF8	2	["Cleft lip","Complete unilateral cleft lip"]	46	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer","PI5P, PP2A and IER3 Regulate PI3K\/AKT Signaling"]	2	["Disgenet (Cleft lip)","Disgenet (Complete unilateral cleft lip)"]
FGF20	0	[]	46	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer","PI5P, PP2A and IER3 Regulate PI3K\/AKT Signaling"]	0	[]

FGF1 (fibroblast growth factor 1)

Bookmark This Gene