Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	2254
Gene name	Fibroblast growth factor 9
Gene symbol	FGF9
Synonyms (NCBI Gene)	FGF-9GAFHBFG-9HBGF-9SYNS3
Chromosome	13
Chromosome location	13q12.11
Summary	The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cel

SNP ID	Visualize variation	Clinical significance	Consequence
rs121918322	G>A	Pathogenic	Missense variant, coding sequence variant
rs1555223925	A>G	Pathogenic	Genic upstream transcript variant, coding sequence variant, missense variant

451 Show/Hide all (451)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006823	hsa-miR-182-5p	Luciferase reporter assayWestern blot	22917588
MIRT006823	hsa-miR-182-5p	Luciferase reporter assayWestern blot	22917588
MIRT007378	hsa-miR-140-5p	Luciferase reporter assay	23401231
MIRT029384	hsa-miR-26b-5p	Microarray	19088304
MIRT053574	hsa-miR-26a-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	24015269
MIRT053574	hsa-miR-26a-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	24015269
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT632936	hsa-miR-622	HITS-CLIP	23824327
MIRT632935	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT632934	hsa-miR-4264	HITS-CLIP	23824327
MIRT632933	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT632932	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT632931	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT632930	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT632929	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT632928	hsa-miR-433-3p	HITS-CLIP	23824327
MIRT632927	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT632926	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT632925	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT632924	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT632936	hsa-miR-622	HITS-CLIP	23824327
MIRT632934	hsa-miR-4264	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT632936	hsa-miR-622	HITS-CLIP	23824327
MIRT632935	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT632934	hsa-miR-4264	HITS-CLIP	23824327
MIRT632933	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT632932	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT632931	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT632930	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT632929	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT632928	hsa-miR-433-3p	HITS-CLIP	23824327
MIRT632927	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT632926	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT632925	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT632924	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	24906430
MIRT608296	hsa-miR-329-3p	HITS-CLIP	24906430
MIRT608294	hsa-miR-362-3p	HITS-CLIP	24906430
MIRT608293	hsa-miR-603	HITS-CLIP	24906430
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	24906430
MIRT608291	hsa-miR-3941	HITS-CLIP	24906430
MIRT441715	hsa-miR-1279	PAR-CLIP	22100165
MIRT441714	hsa-miR-4480	PAR-CLIP	22100165
MIRT441713	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT441712	hsa-miR-5007-3p	PAR-CLIP	22100165
MIRT441711	hsa-miR-599	PAR-CLIP	22100165
MIRT608296	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT608296	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT608296	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT608296	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT608296	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT608294	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT608294	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT608294	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT608294	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT608294	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT608291	hsa-miR-3941	HITS-CLIP	27418678
MIRT608291	hsa-miR-3941	HITS-CLIP	27418678
MIRT608291	hsa-miR-3941	HITS-CLIP	27418678
MIRT608291	hsa-miR-3941	HITS-CLIP	27418678
MIRT608291	hsa-miR-3941	HITS-CLIP	27418678
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT613055	hsa-miR-483-3p	HITS-CLIP	27418678
MIRT613055	hsa-miR-483-3p	HITS-CLIP	27418678
MIRT608293	hsa-miR-603	HITS-CLIP	27418678
MIRT608293	hsa-miR-603	HITS-CLIP	27418678
MIRT608293	hsa-miR-603	HITS-CLIP	27418678
MIRT608293	hsa-miR-603	HITS-CLIP	27418678
MIRT608293	hsa-miR-603	HITS-CLIP	27418678
MIRT608295	hsa-miR-8485	HITS-CLIP	27418678
MIRT608295	hsa-miR-8485	HITS-CLIP	27418678
MIRT608295	hsa-miR-8485	HITS-CLIP	27418678
MIRT608295	hsa-miR-8485	HITS-CLIP	27418678
MIRT608295	hsa-miR-8485	HITS-CLIP	27418678
MIRT006823	hsa-miR-182-5p	Microarray	32102688
MIRT007378	hsa-miR-140-5p	Luciferase reporter assayImmunofluorescenceELISA	33234721
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT632936	hsa-miR-622	HITS-CLIP	23824327
MIRT632935	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT632934	hsa-miR-4264	HITS-CLIP	23824327
MIRT632933	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT632932	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT632931	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT632930	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT632929	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT632928	hsa-miR-433-3p	HITS-CLIP	23824327
MIRT632927	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT632926	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT632925	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT632924	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT632936	hsa-miR-622	HITS-CLIP	23824327
MIRT632934	hsa-miR-4264	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT632936	hsa-miR-622	HITS-CLIP	23824327
MIRT632935	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT632934	hsa-miR-4264	HITS-CLIP	23824327
MIRT632933	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT632932	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT632931	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT632930	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT632929	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT632928	hsa-miR-433-3p	HITS-CLIP	23824327
MIRT632927	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT632926	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT632925	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT632924	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT608295	hsa-miR-8485	HITS-CLIP	23824327
MIRT608296	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT608294	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT608293	hsa-miR-603	HITS-CLIP	23824327
MIRT608292	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613055	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT608291	hsa-miR-3941	HITS-CLIP	23824327
MIRT441715	hsa-miR-1279	PAR-CLIP	22100165
MIRT441714	hsa-miR-4480	PAR-CLIP	22100165
MIRT441713	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT441712	hsa-miR-5007-3p	PAR-CLIP	22100165
MIRT441711	hsa-miR-599	PAR-CLIP	22100165
MIRT995829	hsa-miR-128	CLIP-seq
MIRT995830	hsa-miR-1289	CLIP-seq
MIRT995831	hsa-miR-1297	CLIP-seq
MIRT995832	hsa-miR-130a	CLIP-seq
MIRT995833	hsa-miR-130b	CLIP-seq
MIRT995834	hsa-miR-140-3p	CLIP-seq
MIRT995835	hsa-miR-148a	CLIP-seq
MIRT995836	hsa-miR-148b	CLIP-seq
MIRT995837	hsa-miR-152	CLIP-seq
MIRT995838	hsa-miR-26a	CLIP-seq
MIRT995839	hsa-miR-26b	CLIP-seq
MIRT995840	hsa-miR-301a	CLIP-seq
MIRT995841	hsa-miR-301b	CLIP-seq
MIRT995842	hsa-miR-3125	CLIP-seq
MIRT995843	hsa-miR-3126-3p	CLIP-seq
MIRT995844	hsa-miR-3130-5p	CLIP-seq
MIRT995845	hsa-miR-3148	CLIP-seq
MIRT995846	hsa-miR-3160-3p	CLIP-seq
MIRT995847	hsa-miR-3176	CLIP-seq
MIRT995848	hsa-miR-3198	CLIP-seq
MIRT995849	hsa-miR-3646	CLIP-seq
MIRT995850	hsa-miR-3666	CLIP-seq
MIRT995851	hsa-miR-3672	CLIP-seq
MIRT995852	hsa-miR-3916	CLIP-seq
MIRT995853	hsa-miR-3922-3p	CLIP-seq
MIRT995854	hsa-miR-3973	CLIP-seq
MIRT995855	hsa-miR-3978	CLIP-seq
MIRT995856	hsa-miR-425	CLIP-seq
MIRT995857	hsa-miR-4275	CLIP-seq
MIRT995858	hsa-miR-4294	CLIP-seq
MIRT995859	hsa-miR-4295	CLIP-seq
MIRT995860	hsa-miR-4309	CLIP-seq
MIRT995861	hsa-miR-4465	CLIP-seq
MIRT995862	hsa-miR-4482	CLIP-seq
MIRT995863	hsa-miR-454	CLIP-seq
MIRT995864	hsa-miR-4633-3p	CLIP-seq
MIRT995865	hsa-miR-4666-5p	CLIP-seq
MIRT995866	hsa-miR-4712-3p	CLIP-seq
MIRT995867	hsa-miR-4786-5p	CLIP-seq
MIRT995868	hsa-miR-486-5p	CLIP-seq
MIRT995869	hsa-miR-520g	CLIP-seq
MIRT995870	hsa-miR-520h	CLIP-seq
MIRT995871	hsa-miR-532-5p	CLIP-seq
MIRT995872	hsa-miR-548ae	CLIP-seq
MIRT995873	hsa-miR-548aj	CLIP-seq
MIRT995874	hsa-miR-548am	CLIP-seq
MIRT995875	hsa-miR-548x	CLIP-seq
MIRT995876	hsa-miR-561	CLIP-seq
MIRT995877	hsa-miR-642b	CLIP-seq
MIRT995878	hsa-miR-769-5p	CLIP-seq
MIRT995834	hsa-miR-140-3p	CLIP-seq
MIRT1995323	hsa-miR-3140-5p	CLIP-seq
MIRT1995324	hsa-miR-4293	CLIP-seq
MIRT1995325	hsa-miR-4427	CLIP-seq
MIRT1995326	hsa-miR-455-5p	CLIP-seq
MIRT1995327	hsa-miR-4652-3p	CLIP-seq
MIRT1995328	hsa-miR-4699-3p	CLIP-seq
MIRT2229390	hsa-miR-141	CLIP-seq
MIRT2229391	hsa-miR-15a	CLIP-seq
MIRT2229392	hsa-miR-15b	CLIP-seq
MIRT2229393	hsa-miR-16	CLIP-seq
MIRT2229394	hsa-miR-192	CLIP-seq
MIRT2229395	hsa-miR-195	CLIP-seq
MIRT2229396	hsa-miR-200a	CLIP-seq
MIRT2229397	hsa-miR-215	CLIP-seq
MIRT2229398	hsa-miR-2355-5p	CLIP-seq
MIRT2229399	hsa-miR-329	CLIP-seq
MIRT2229400	hsa-miR-3613-3p	CLIP-seq
MIRT2229401	hsa-miR-424	CLIP-seq
MIRT2229402	hsa-miR-4291	CLIP-seq
MIRT2229403	hsa-miR-4459	CLIP-seq
MIRT2229404	hsa-miR-4524	CLIP-seq
MIRT2229405	hsa-miR-497	CLIP-seq
MIRT2229406	hsa-miR-503	CLIP-seq
MIRT2229407	hsa-miR-545	CLIP-seq
MIRT2229408	hsa-miR-646	CLIP-seq
MIRT2229399	hsa-miR-329	CLIP-seq

Transcription factor	Regulation	Reference
FUBP3	Unknown	21252297

67 Show/Hide all (67)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001654	Process	Eye development	IEA
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	IEA
GO:0002062	Process	Chondrocyte differentiation	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	8321227
GO:0005615	Component	Extracellular space	TAS	8321227
GO:0005737	Component	Cytoplasm	IBA
GO:0006606	Process	Protein import into nucleus	IEA
GO:0007165	Process	Signal transduction	TAS	8575785
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0007267	Process	Cell-cell signaling	IEA
GO:0007267	Process	Cell-cell signaling	TAS	8575785
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	8321227
GO:0008201	Function	Heparin binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	8321227
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IGI	8663044
GO:0008584	Process	Male gonad development	IEA
GO:0008584	Process	Male gonad development	IEP	17848411
GO:0010463	Process	Mesenchymal cell proliferation	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0022008	Process	Neurogenesis	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030238	Process	Male sex determination	IEA
GO:0030324	Process	Lung development	IEA
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0030334	Process	Regulation of cell migration	IBA
GO:0030949	Process	Positive regulation of vascular endothelial growth factor receptor signaling pathway	IEA
GO:0032924	Process	Activin receptor signaling pathway	IEA
GO:0032927	Process	Positive regulation of activin receptor signaling pathway	IEA
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0045880	Process	Positive regulation of smoothened signaling pathway	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IEA
GO:0048505	Process	Regulation of timing of cell differentiation	IEA
GO:0048566	Process	Embryonic digestive tract development	IEA
GO:0048706	Process	Embryonic skeletal system development	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0060011	Process	Sertoli cell proliferation	IEA
GO:0060038	Process	Cardiac muscle cell proliferation	IEA
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060484	Process	Lung-associated mesenchyme development	IEA
GO:0072089	Process	Stem cell proliferation	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IGI	29118903
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	ISS
GO:1904754	Process	Positive regulation of vascular associated smooth muscle cell migration	ISS
GO:1905931	Process	Negative regulation of vascular associated smooth muscle cell differentiation involved in phenotypic switching	ISS
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA

MIM	HGNC	e!Ensembl
600921	3687	ENSG00000102678

P31371

Protein name

Fibroblast growth factor 9 (FGF-9) (Glia-activating factor) (GAF) (Heparin-binding growth factor 9) (HBGF-9)

Protein function

Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration

PDB

1G82 , 1IHK , 5W59

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00167	FGF	62 → 188	Fibroblast growth factor	Domain

Tissue specificity

TISSUE SPECIFICITY: Glial cells.

Sequence

MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS

Sequence length

208

Interactions

View interactions

KEGG Pathway	Reactome Pathway
MAPK signaling pathway	PI3K Cascade
Ras signaling pathway	PIP3 activates AKT signaling
Rap1 signaling pathway	Signaling by activated point mutants of FGFR1
Calcium signaling pathway	Signaling by activated point mutants of FGFR3
PI3K-Akt signaling pathway	FGFR4 ligand binding and activation
Regulation of actin cytoskeleton	FGFR3b ligand binding and activation
Pathways in cancer	FGFR3c ligand binding and activation
Chemical carcinogenesis - receptor activation	FGFR1c ligand binding and activation
Melanoma	FGFR2c ligand binding and activation
Breast cancer	FGFR3 mutant receptor activation
Gastric cancer	Activated point mutants of FGFR2
	Constitutive Signaling by Aberrant PI3K in Cancer
	Phospholipase C-mediated cascade: FGFR1
	Phospholipase C-mediated cascade; FGFR2
	Phospholipase C-mediated cascade; FGFR3
	Phospholipase C-mediated cascade; FGFR4
	Downstream signaling of activated FGFR1
	SHC-mediated cascade:FGFR1
	PI-3K cascade:FGFR1
	FRS-mediated FGFR1 signaling
	PI-3K cascade:FGFR2
	SHC-mediated cascade:FGFR2
	FRS-mediated FGFR2 signaling
	SHC-mediated cascade:FGFR3
	FRS-mediated FGFR3 signaling
	PI-3K cascade:FGFR3
	FRS-mediated FGFR4 signaling
	SHC-mediated cascade:FGFR4
	PI-3K cascade:FGFR4
	Negative regulation of FGFR1 signaling
	Negative regulation of FGFR2 signaling
	Negative regulation of FGFR3 signaling
	Negative regulation of FGFR4 signaling
	Signaling by FGFR2 in disease
	Signaling by FGFR1 in disease
	RAF/MAP kinase cascade
	PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
	Signaling by FGFR3 point mutants in cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Multiple synostoses syndrome 3	Likely pathogenic; Pathogenic	rs2542485459, rs121918322, rs2542511852, rs1555223925	RCV002471381 RCV000009242 RCV003223356 RCV000513493	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (19)
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	19358281	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	30595370	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT LIP	—	CTD	17963255	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT PALATE	—	CTD, Disgenet CTD, Disgenet	17963255	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT UPPER LIP	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLETE UNILATERAL CLEFT LIP	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FGF9-related disorder	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	38965376, 39789286	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	20464547	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	25756049	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SYNOSTOSES SYNDROME	—	ClinGen, GWAS catalog, Orphanet ClinGen, GWAS catalog, Orphanet	11165488, 19219044, 19589401, 21402782, 22123828, 28169396, 28730625, 33140402, 33174625, 35316564, 36980996	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SYNOSTOSES SYNDROME 1	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SYNOSTOSIS SYNDROME	—	Disgenet, ClinGen	19589401, ClinGen report	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Symphalangism-brachydactyly syndrome	Uncertain significance; Likely benign; Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR NEOPLASMS	—	CTD	33172093	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (145)
Acquired cubitus valgus	Cubitus valgus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19358281, 29656749, 31090071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	20464547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16002475, 19358281, 23867472, 29656749, 31090071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	20464547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	16452189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	20464547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	20464547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28259995, 31220553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	26351673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	26351673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30123050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	BEFREE	19621416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15129425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	28531646, 28882405, 28891527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31805343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	18618013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	30179577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	15691381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	9696088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21098263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21098263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27166269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32161315, 32378800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31805343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29656749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34061869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28440022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	20464547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	20464547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29904943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilaginous exostosis	Osteochondroma	BEFREE	11518409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	22074045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	36980996	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon Carcinoma	Colon Carcinoma	BEFREE	24334956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36221049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18165946, 26916220, 28749961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28749961, 32366371, 33779485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	38105623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	14613973, 28730625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Adenomatoid Malformation of Lung, Congenital	Congenital Cystic Adenomatoid Malformation Of Lung	BEFREE	18558180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30791342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	32572726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	23554969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysequilibrium syndrome	Dysequilibrium Syndrome	BEFREE	24807585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectrodactyly	Ectrodactyly	Pubtator	32269565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	18165946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	14602803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	16982695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	18978176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	18978176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	18978176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eye Abnormalities	Eye abnormalities	Pubtator	31078532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Hypophosphatemic Rickets	Hypophosphatemic Rickets	BEFREE	19621416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	28481834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	25793394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	9696088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	9696088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	7656983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gonadal Dysgenesis	Gonadal Dysgenesis	BEFREE	17154280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gonadal Dysgenesis	Gonadal Dysgenesis	LHGDN	17154280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gonadal Dysgenesis, 46,XY	Gonadal Dysgenesis	BEFREE	22939835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Multiple Exostoses	Multiple congenital exostosis	BEFREE	11518409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	30021209, 30391672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	23797050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	19621416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets	Hypophosphatemic Rickets	BEFREE	19621416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	38105623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	23797050, 26773067, 40024445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28729349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	38173028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	26183774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28921304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	30123050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	20464547		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	29656749		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31174436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	26351673, 29553848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25756049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21098263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	20464547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29656749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29904943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15691381, 18618013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24015269, 25925261, 27166269, 30646925, 31805343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31805343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24334956, 28921304, 31805343, 9696088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21853123, 24334956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	28531646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	18981889, 9696088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30791342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mobius Syndrome	Mobius Syndrome	BEFREE	19460469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	26351673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	39922722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33174625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple synostoses syndrome	Multiple Synostoses Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple synostoses syndrome 1	Multiple Synostoses Syndrome	ORPHANET_DG	19589401		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Synostoses Syndrome 3	Multiple Synostoses Syndrome	UNIPROT_DG	19589401		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple Synostoses Syndrome 3	Multiple Synostoses Syndrome	GENOMICS_ENGLAND_DG	19589401		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple Synostoses Syndrome 3	Multiple Synostoses Syndrome	BEFREE	28169396, 28730625		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple Synostoses Syndrome 3	Multiple synostoses syndrome	Pubtator	33174625, 36980996	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple Synostoses Syndrome 3	Multiple Synostoses Syndrome	CTD_human_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple Synostoses Syndrome 3	Multiple Synostoses Syndrome	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple synostosis syndrome	Multiple Synostoses Syndrome	BEFREE	19589401, 28169396		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple synostosis syndrome	Multiple Synostoses Syndrome	ORPHANET_DG	19589401		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	29198068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	38105623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16002475, 18165946, 21666490, 23867472, 25089899, 25793394, 26183774, 28409700, 28849071, 29656749, 30227870, 30646925, 31090071, 31805343, 9696088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30021209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18849352, 19358281, 23867472, 24239165, 30227870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	19358281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	30099276, 31722018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	27511275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33782454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29904943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21666490, 33545926, 35190498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30021209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	30785239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Personality Disorders	Personality Disorders	BEFREE	29252927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleuropulmonary blastoma	Pleuropulmonary blastoma	BEFREE	25978641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	30791342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15691381, 18618013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15691381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18618013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31174436	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	29055567, 30099276, 31722018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ramer Ladda syndrome	Ramer Ladda Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	40024445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	30191630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30123050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31351243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	26020126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16700662, 19358281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28440022		★★★★★ ★☆☆☆☆ Found in Text Mining only
STAPES ANKYLOSIS WITH BROAD THUMB AND TOES (disorder)	Teunissen Cremers syndrome	BEFREE	25391606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24015269, 25925261, 27166269, 30646925, 31805343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24015269, 25925261, 27166269, 30646925, 34490480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25793394	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	30760287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular regression syndrome	Testicular regression syndrome	BEFREE	29218779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thanatophoric Dysplasia	Thanatophoric dysplasia	Pubtator	9582336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thanatophoric Dysplasia Type I	Thanatophoric dysplasia	Pubtator	9582336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	17154280		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
FGF1	3	["Cleft lip","Complete unilateral cleft lip","Mesothelioma"]	46	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer","PI5P, PP2A and IER3 Regulate PI3K\/AKT Signaling"]	3	["Disgenet (Cleft lip)","Disgenet (Complete unilateral cleft lip)","CTD (Mesothelioma)"]
FGF8	3	["Cleft lip","Cleft palate","Complete unilateral cleft lip"]	47	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Chemical carcinogenesis - receptor activation","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer"]	5	["CTD (Cleft lip)","Disgenet (Cleft palate)","CTD (Cleft palate)","Disgenet (Cleft lip)","Disgenet (Complete unilateral cleft lip)"]
FGF3	3	["Cleft lip","Cleft palate","Complete unilateral cleft lip"]	27	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Chemical carcinogenesis - receptor activation","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer"]	5	["CTD (Cleft lip)","Disgenet (Cleft palate)","CTD (Cleft palate)","Disgenet (Cleft lip)","Disgenet (Complete unilateral cleft lip)"]
FGF2	4	["Cleft lip","Cleft palate","Complete unilateral cleft lip","Mesothelioma"]	46	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Chemical carcinogenesis - receptor activation","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer"]	6	["CTD (Cleft lip)","Disgenet (Cleft palate)","CTD (Cleft palate)","Disgenet (Cleft lip)","Disgenet (Complete unilateral cleft lip)","CTD (Mesothelioma)"]
MTHFS	3	["Cleft lip","Cleft palate","Complete unilateral cleft lip"]	0	[]	5	["CTD (Cleft lip)","Disgenet (Cleft palate)","CTD (Cleft palate)","Disgenet (Cleft lip)","Disgenet (Complete unilateral cleft lip)"]

FGF9 (fibroblast growth factor 9)

Bookmark This Gene