Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	2252
Gene name	Fibroblast growth factor 7
Gene symbol	FGF7
Synonyms (NCBI Gene)	HBGF-7KGF
Chromosome	15
Chromosome location	15q21.2
Summary	The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cel

799 Show/Hide all (799)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003482	hsa-miR-155-5p	Luciferase reporter assay	19701459
MIRT003482	hsa-miR-155-5p	Luciferase reporter assay	19701459
MIRT003482	hsa-miR-155-5p	Luciferase reporter assay	19701459
MIRT003482	hsa-miR-155-5p	Luciferase reporter assay	19177201
MIRT003482	hsa-miR-155-5p	Review	20026422
MIRT006027	hsa-miR-15a-5p	Luciferase reporter assayqRT-PCR	21106054
MIRT006027	hsa-miR-15a-5p	Luciferase reporter assayqRT-PCR	21106054
MIRT006027	hsa-miR-15a-5p	Luciferase reporter assayqRT-PCR	21106054
MIRT003482	hsa-miR-155-5p	Proteomics	18668040
MIRT050488	hsa-miR-20a-5p	CLASH	23622248
MIRT003482	hsa-miR-155-5p	Microarray	23807165
MIRT442459	hsa-miR-3156-5p	PAR-CLIP	22291592
MIRT442458	hsa-miR-302a-3p	PAR-CLIP	22291592
MIRT442457	hsa-miR-302b-3p	PAR-CLIP	22291592
MIRT442456	hsa-miR-302c-3p	PAR-CLIP	22291592
MIRT442455	hsa-miR-302d-3p	PAR-CLIP	22291592
MIRT442454	hsa-miR-302e	PAR-CLIP	22291592
MIRT442453	hsa-miR-372-3p	PAR-CLIP	22291592
MIRT442452	hsa-miR-373-3p	PAR-CLIP	22291592
MIRT442451	hsa-miR-520a-3p	PAR-CLIP	22291592
MIRT442450	hsa-miR-520b	PAR-CLIP	22291592
MIRT442449	hsa-miR-520c-3p	PAR-CLIP	22291592
MIRT442448	hsa-miR-520d-3p	PAR-CLIP	22291592
MIRT442447	hsa-miR-520e	PAR-CLIP	22291592
MIRT442446	hsa-miR-4769-3p	PAR-CLIP	22291592
MIRT442445	hsa-miR-6817-5p	PAR-CLIP	22291592
MIRT442444	hsa-miR-4727-5p	PAR-CLIP	22291592
MIRT442443	hsa-miR-192-3p	PAR-CLIP	22291592
MIRT442459	hsa-miR-3156-5p	PAR-CLIP	22291592
MIRT442458	hsa-miR-302a-3p	PAR-CLIP	22291592
MIRT442457	hsa-miR-302b-3p	PAR-CLIP	22291592
MIRT442456	hsa-miR-302c-3p	PAR-CLIP	22291592
MIRT442455	hsa-miR-302d-3p	PAR-CLIP	22291592
MIRT442454	hsa-miR-302e	PAR-CLIP	22291592
MIRT442453	hsa-miR-372-3p	PAR-CLIP	22291592
MIRT442452	hsa-miR-373-3p	PAR-CLIP	22291592
MIRT442451	hsa-miR-520a-3p	PAR-CLIP	22291592
MIRT442450	hsa-miR-520b	PAR-CLIP	22291592
MIRT442449	hsa-miR-520c-3p	PAR-CLIP	22291592
MIRT442448	hsa-miR-520d-3p	PAR-CLIP	22291592
MIRT442447	hsa-miR-520e	PAR-CLIP	22291592
MIRT442446	hsa-miR-4769-3p	PAR-CLIP	22291592
MIRT442445	hsa-miR-6817-5p	PAR-CLIP	22291592
MIRT442444	hsa-miR-4727-5p	PAR-CLIP	22291592
MIRT442443	hsa-miR-192-3p	PAR-CLIP	22291592
MIRT442459	hsa-miR-3156-5p	PAR-CLIP	23708386
MIRT442458	hsa-miR-302a-3p	PAR-CLIP	23708386
MIRT442457	hsa-miR-302b-3p	PAR-CLIP	23708386
MIRT442456	hsa-miR-302c-3p	PAR-CLIP	23708386
MIRT442455	hsa-miR-302d-3p	PAR-CLIP	23708386
MIRT442454	hsa-miR-302e	PAR-CLIP	23708386
MIRT442453	hsa-miR-372-3p	PAR-CLIP	23708386
MIRT442452	hsa-miR-373-3p	PAR-CLIP	23708386
MIRT442451	hsa-miR-520a-3p	PAR-CLIP	23708386
MIRT442450	hsa-miR-520b	PAR-CLIP	23708386
MIRT442449	hsa-miR-520c-3p	PAR-CLIP	23708386
MIRT442448	hsa-miR-520d-3p	PAR-CLIP	23708386
MIRT442447	hsa-miR-520e	PAR-CLIP	23708386
MIRT442446	hsa-miR-4769-3p	PAR-CLIP	23708386
MIRT442445	hsa-miR-6817-5p	PAR-CLIP	23708386
MIRT442444	hsa-miR-4727-5p	PAR-CLIP	23708386
MIRT442443	hsa-miR-192-3p	PAR-CLIP	23708386
MIRT442459	hsa-miR-3156-5p	PAR-CLIP	22100165
MIRT442458	hsa-miR-302a-3p	PAR-CLIP	22100165
MIRT442457	hsa-miR-302b-3p	PAR-CLIP	22100165
MIRT442456	hsa-miR-302c-3p	PAR-CLIP	22100165
MIRT442455	hsa-miR-302d-3p	PAR-CLIP	22100165
MIRT442454	hsa-miR-302e	PAR-CLIP	22100165
MIRT442453	hsa-miR-372-3p	PAR-CLIP	22100165
MIRT442452	hsa-miR-373-3p	PAR-CLIP	22100165
MIRT442451	hsa-miR-520a-3p	PAR-CLIP	22100165
MIRT442450	hsa-miR-520b	PAR-CLIP	22100165
MIRT442449	hsa-miR-520c-3p	PAR-CLIP	22100165
MIRT442448	hsa-miR-520d-3p	PAR-CLIP	22100165
MIRT442447	hsa-miR-520e	PAR-CLIP	22100165
MIRT442446	hsa-miR-4769-3p	PAR-CLIP	22100165
MIRT442445	hsa-miR-6817-5p	PAR-CLIP	22100165
MIRT442444	hsa-miR-4727-5p	PAR-CLIP	22100165
MIRT442459	hsa-miR-3156-5p	PAR-CLIP	22100165
MIRT442458	hsa-miR-302a-3p	PAR-CLIP	22100165
MIRT442457	hsa-miR-302b-3p	PAR-CLIP	22100165
MIRT442456	hsa-miR-302c-3p	PAR-CLIP	22100165
MIRT442455	hsa-miR-302d-3p	PAR-CLIP	22100165
MIRT442454	hsa-miR-302e	PAR-CLIP	22100165
MIRT442453	hsa-miR-372-3p	PAR-CLIP	22100165
MIRT442452	hsa-miR-373-3p	PAR-CLIP	22100165
MIRT442451	hsa-miR-520a-3p	PAR-CLIP	22100165
MIRT442450	hsa-miR-520b	PAR-CLIP	22100165
MIRT442449	hsa-miR-520c-3p	PAR-CLIP	22100165
MIRT442448	hsa-miR-520d-3p	PAR-CLIP	22100165
MIRT442447	hsa-miR-520e	PAR-CLIP	22100165
MIRT442446	hsa-miR-4769-3p	PAR-CLIP	22100165
MIRT442445	hsa-miR-6817-5p	PAR-CLIP	22100165
MIRT442444	hsa-miR-4727-5p	PAR-CLIP	22100165
MIRT442443	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT442459	hsa-miR-3156-5p	PAR-CLIP	22291592
MIRT442458	hsa-miR-302a-3p	PAR-CLIP	22291592
MIRT442457	hsa-miR-302b-3p	PAR-CLIP	22291592
MIRT442456	hsa-miR-302c-3p	PAR-CLIP	22291592
MIRT442455	hsa-miR-302d-3p	PAR-CLIP	22291592
MIRT442454	hsa-miR-302e	PAR-CLIP	22291592
MIRT442453	hsa-miR-372-3p	PAR-CLIP	22291592
MIRT442452	hsa-miR-373-3p	PAR-CLIP	22291592
MIRT442451	hsa-miR-520a-3p	PAR-CLIP	22291592
MIRT442450	hsa-miR-520b	PAR-CLIP	22291592
MIRT442449	hsa-miR-520c-3p	PAR-CLIP	22291592
MIRT442448	hsa-miR-520d-3p	PAR-CLIP	22291592
MIRT442447	hsa-miR-520e	PAR-CLIP	22291592
MIRT442446	hsa-miR-4769-3p	PAR-CLIP	22291592
MIRT442445	hsa-miR-6817-5p	PAR-CLIP	22291592
MIRT442444	hsa-miR-4727-5p	PAR-CLIP	22291592
MIRT442443	hsa-miR-192-3p	PAR-CLIP	22291592
MIRT442459	hsa-miR-3156-5p	PAR-CLIP	22291592
MIRT442458	hsa-miR-302a-3p	PAR-CLIP	22291592
MIRT442457	hsa-miR-302b-3p	PAR-CLIP	22291592
MIRT442456	hsa-miR-302c-3p	PAR-CLIP	22291592
MIRT442455	hsa-miR-302d-3p	PAR-CLIP	22291592
MIRT442454	hsa-miR-302e	PAR-CLIP	22291592
MIRT442453	hsa-miR-372-3p	PAR-CLIP	22291592
MIRT442452	hsa-miR-373-3p	PAR-CLIP	22291592
MIRT442451	hsa-miR-520a-3p	PAR-CLIP	22291592
MIRT442450	hsa-miR-520b	PAR-CLIP	22291592
MIRT442449	hsa-miR-520c-3p	PAR-CLIP	22291592
MIRT442448	hsa-miR-520d-3p	PAR-CLIP	22291592
MIRT442447	hsa-miR-520e	PAR-CLIP	22291592
MIRT442446	hsa-miR-4769-3p	PAR-CLIP	22291592
MIRT442445	hsa-miR-6817-5p	PAR-CLIP	22291592
MIRT442444	hsa-miR-4727-5p	PAR-CLIP	22291592
MIRT442443	hsa-miR-192-3p	PAR-CLIP	22291592
MIRT442459	hsa-miR-3156-5p	PAR-CLIP	23708386
MIRT442458	hsa-miR-302a-3p	PAR-CLIP	23708386
MIRT442457	hsa-miR-302b-3p	PAR-CLIP	23708386
MIRT442456	hsa-miR-302c-3p	PAR-CLIP	23708386
MIRT442455	hsa-miR-302d-3p	PAR-CLIP	23708386
MIRT442454	hsa-miR-302e	PAR-CLIP	23708386
MIRT442453	hsa-miR-372-3p	PAR-CLIP	23708386
MIRT442452	hsa-miR-373-3p	PAR-CLIP	23708386
MIRT442451	hsa-miR-520a-3p	PAR-CLIP	23708386
MIRT442450	hsa-miR-520b	PAR-CLIP	23708386
MIRT442449	hsa-miR-520c-3p	PAR-CLIP	23708386
MIRT442448	hsa-miR-520d-3p	PAR-CLIP	23708386
MIRT442447	hsa-miR-520e	PAR-CLIP	23708386
MIRT442446	hsa-miR-4769-3p	PAR-CLIP	23708386
MIRT442445	hsa-miR-6817-5p	PAR-CLIP	23708386
MIRT442444	hsa-miR-4727-5p	PAR-CLIP	23708386
MIRT442443	hsa-miR-192-3p	PAR-CLIP	23708386
MIRT442459	hsa-miR-3156-5p	PAR-CLIP	22100165
MIRT442458	hsa-miR-302a-3p	PAR-CLIP	22100165
MIRT442457	hsa-miR-302b-3p	PAR-CLIP	22100165
MIRT442456	hsa-miR-302c-3p	PAR-CLIP	22100165
MIRT442455	hsa-miR-302d-3p	PAR-CLIP	22100165
MIRT442454	hsa-miR-302e	PAR-CLIP	22100165
MIRT442453	hsa-miR-372-3p	PAR-CLIP	22100165
MIRT442452	hsa-miR-373-3p	PAR-CLIP	22100165
MIRT442451	hsa-miR-520a-3p	PAR-CLIP	22100165
MIRT442450	hsa-miR-520b	PAR-CLIP	22100165
MIRT442449	hsa-miR-520c-3p	PAR-CLIP	22100165
MIRT442448	hsa-miR-520d-3p	PAR-CLIP	22100165
MIRT442447	hsa-miR-520e	PAR-CLIP	22100165
MIRT442446	hsa-miR-4769-3p	PAR-CLIP	22100165
MIRT442445	hsa-miR-6817-5p	PAR-CLIP	22100165
MIRT442444	hsa-miR-4727-5p	PAR-CLIP	22100165
MIRT442459	hsa-miR-3156-5p	PAR-CLIP	22100165
MIRT442458	hsa-miR-302a-3p	PAR-CLIP	22100165
MIRT442457	hsa-miR-302b-3p	PAR-CLIP	22100165
MIRT442456	hsa-miR-302c-3p	PAR-CLIP	22100165
MIRT442455	hsa-miR-302d-3p	PAR-CLIP	22100165
MIRT442454	hsa-miR-302e	PAR-CLIP	22100165
MIRT442453	hsa-miR-372-3p	PAR-CLIP	22100165
MIRT442452	hsa-miR-373-3p	PAR-CLIP	22100165
MIRT442451	hsa-miR-520a-3p	PAR-CLIP	22100165
MIRT442450	hsa-miR-520b	PAR-CLIP	22100165
MIRT442449	hsa-miR-520c-3p	PAR-CLIP	22100165
MIRT442448	hsa-miR-520d-3p	PAR-CLIP	22100165
MIRT442447	hsa-miR-520e	PAR-CLIP	22100165
MIRT442446	hsa-miR-4769-3p	PAR-CLIP	22100165
MIRT442445	hsa-miR-6817-5p	PAR-CLIP	22100165
MIRT442444	hsa-miR-4727-5p	PAR-CLIP	22100165
MIRT442443	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT995788	hsa-miR-103a	CLIP-seq
MIRT995789	hsa-miR-107	CLIP-seq
MIRT739644	hsa-miR-1244	CLIP-seq
MIRT995790	hsa-miR-129-5p	CLIP-seq
MIRT995791	hsa-miR-15a	CLIP-seq
MIRT995792	hsa-miR-15b	CLIP-seq
MIRT995793	hsa-miR-16	CLIP-seq
MIRT995794	hsa-miR-195	CLIP-seq
MIRT739646	hsa-miR-199a-3p	CLIP-seq
MIRT739645	hsa-miR-199b-3p	CLIP-seq
MIRT995795	hsa-miR-21	CLIP-seq
MIRT995796	hsa-miR-217	CLIP-seq
MIRT739647	hsa-miR-3129-5p	CLIP-seq
MIRT995797	hsa-miR-3145-3p	CLIP-seq
MIRT995798	hsa-miR-3152-5p	CLIP-seq
MIRT739643	hsa-miR-3180-5p	CLIP-seq
MIRT995799	hsa-miR-3692	CLIP-seq
MIRT995800	hsa-miR-376c	CLIP-seq
MIRT995801	hsa-miR-3908	CLIP-seq
MIRT995802	hsa-miR-3942-5p	CLIP-seq
MIRT995803	hsa-miR-409-3p	CLIP-seq
MIRT995804	hsa-miR-424	CLIP-seq
MIRT995805	hsa-miR-4261	CLIP-seq
MIRT995806	hsa-miR-4310	CLIP-seq
MIRT995807	hsa-miR-4436b-5p	CLIP-seq
MIRT995808	hsa-miR-4468	CLIP-seq
MIRT995809	hsa-miR-4477a	CLIP-seq
MIRT995810	hsa-miR-4517	CLIP-seq
MIRT995811	hsa-miR-4703-5p	CLIP-seq
MIRT995812	hsa-miR-4711-3p	CLIP-seq
MIRT995813	hsa-miR-4766-3p	CLIP-seq
MIRT995814	hsa-miR-4774-3p	CLIP-seq
MIRT995815	hsa-miR-4781-3p	CLIP-seq
MIRT995816	hsa-miR-4803	CLIP-seq
MIRT995817	hsa-miR-494	CLIP-seq
MIRT995818	hsa-miR-495	CLIP-seq
MIRT995819	hsa-miR-497	CLIP-seq
MIRT995820	hsa-miR-501-5p	CLIP-seq
MIRT739649	hsa-miR-526b	CLIP-seq
MIRT995821	hsa-miR-577	CLIP-seq
MIRT739642	hsa-miR-578	CLIP-seq
MIRT995822	hsa-miR-580	CLIP-seq
MIRT995823	hsa-miR-590-5p	CLIP-seq
MIRT995824	hsa-miR-633	CLIP-seq
MIRT739648	hsa-miR-936	CLIP-seq
MIRT995788	hsa-miR-103a	CLIP-seq
MIRT995789	hsa-miR-107	CLIP-seq
MIRT1548696	hsa-miR-1253	CLIP-seq
MIRT1548697	hsa-miR-132	CLIP-seq
MIRT995791	hsa-miR-15a	CLIP-seq
MIRT995792	hsa-miR-15b	CLIP-seq
MIRT995793	hsa-miR-16	CLIP-seq
MIRT995794	hsa-miR-195	CLIP-seq
MIRT995795	hsa-miR-21	CLIP-seq
MIRT1548698	hsa-miR-2113	CLIP-seq
MIRT1548699	hsa-miR-2116	CLIP-seq
MIRT1548700	hsa-miR-212	CLIP-seq
MIRT1548701	hsa-miR-300	CLIP-seq
MIRT995798	hsa-miR-3152-5p	CLIP-seq
MIRT1548702	hsa-miR-331-5p	CLIP-seq
MIRT1548703	hsa-miR-3653	CLIP-seq
MIRT1548704	hsa-miR-3658	CLIP-seq
MIRT1548705	hsa-miR-3671	CLIP-seq
MIRT1548706	hsa-miR-375	CLIP-seq
MIRT1548707	hsa-miR-381	CLIP-seq
MIRT1548708	hsa-miR-3920	CLIP-seq
MIRT995803	hsa-miR-409-3p	CLIP-seq
MIRT995804	hsa-miR-424	CLIP-seq
MIRT1548709	hsa-miR-4273	CLIP-seq
MIRT1548710	hsa-miR-4291	CLIP-seq
MIRT995806	hsa-miR-4310	CLIP-seq
MIRT1548711	hsa-miR-4328	CLIP-seq
MIRT995807	hsa-miR-4436b-5p	CLIP-seq
MIRT995810	hsa-miR-4517	CLIP-seq
MIRT1548712	hsa-miR-452	CLIP-seq
MIRT1548713	hsa-miR-4524	CLIP-seq
MIRT1548714	hsa-miR-455-3p	CLIP-seq
MIRT1548715	hsa-miR-4662a-3p	CLIP-seq
MIRT1548716	hsa-miR-4666-3p	CLIP-seq
MIRT1548717	hsa-miR-4676-3p	CLIP-seq
MIRT1548718	hsa-miR-4677-5p	CLIP-seq
MIRT1548719	hsa-miR-4678	CLIP-seq
MIRT1548720	hsa-miR-4693-5p	CLIP-seq
MIRT1548721	hsa-miR-4715-3p	CLIP-seq
MIRT1548722	hsa-miR-4756-3p	CLIP-seq
MIRT1548723	hsa-miR-4760-3p	CLIP-seq
MIRT1548724	hsa-miR-4762-3p	CLIP-seq
MIRT1548725	hsa-miR-4762-5p	CLIP-seq
MIRT995814	hsa-miR-4774-3p	CLIP-seq
MIRT1548726	hsa-miR-4775	CLIP-seq
MIRT995815	hsa-miR-4781-3p	CLIP-seq
MIRT1548727	hsa-miR-4789-5p	CLIP-seq
MIRT1548728	hsa-miR-4795-3p	CLIP-seq
MIRT995816	hsa-miR-4803	CLIP-seq
MIRT995819	hsa-miR-497	CLIP-seq
MIRT1548729	hsa-miR-503	CLIP-seq
MIRT1548730	hsa-miR-520d-5p	CLIP-seq
MIRT1548731	hsa-miR-524-5p	CLIP-seq
MIRT1548732	hsa-miR-570	CLIP-seq
MIRT995822	hsa-miR-580	CLIP-seq
MIRT995823	hsa-miR-590-5p	CLIP-seq
MIRT1548733	hsa-miR-599	CLIP-seq
MIRT1548734	hsa-miR-607	CLIP-seq
MIRT1548735	hsa-miR-646	CLIP-seq
MIRT1548736	hsa-miR-922	CLIP-seq
MIRT1995321	hsa-miR-3591-5p	CLIP-seq
MIRT1995322	hsa-miR-587	CLIP-seq
MIRT995788	hsa-miR-103a	CLIP-seq
MIRT995789	hsa-miR-107	CLIP-seq
MIRT995791	hsa-miR-15a	CLIP-seq
MIRT995792	hsa-miR-15b	CLIP-seq
MIRT995793	hsa-miR-16	CLIP-seq
MIRT995794	hsa-miR-195	CLIP-seq
MIRT995804	hsa-miR-424	CLIP-seq
MIRT995806	hsa-miR-4310	CLIP-seq
MIRT995807	hsa-miR-4436b-5p	CLIP-seq
MIRT995808	hsa-miR-4468	CLIP-seq
MIRT995819	hsa-miR-497	CLIP-seq
MIRT1548732	hsa-miR-570	CLIP-seq
MIRT739644	hsa-miR-1244	CLIP-seq
MIRT739646	hsa-miR-199a-3p	CLIP-seq
MIRT739645	hsa-miR-199b-3p	CLIP-seq
MIRT739647	hsa-miR-3129-5p	CLIP-seq
MIRT2428934	hsa-miR-383	CLIP-seq
MIRT2428935	hsa-miR-4267	CLIP-seq
MIRT1548711	hsa-miR-4328	CLIP-seq
MIRT995812	hsa-miR-4711-3p	CLIP-seq
MIRT2428936	hsa-miR-4772-5p	CLIP-seq
MIRT995816	hsa-miR-4803	CLIP-seq
MIRT995818	hsa-miR-495	CLIP-seq
MIRT739648	hsa-miR-936	CLIP-seq
MIRT2437267	hsa-miR-101	CLIP-seq
MIRT2437268	hsa-miR-144	CLIP-seq
MIRT2437269	hsa-miR-4426	CLIP-seq
MIRT2437270	hsa-miR-4647	CLIP-seq
MIRT2437271	hsa-miR-4662b	CLIP-seq
MIRT2442168	hsa-miR-4722-3p	CLIP-seq
MIRT2437267	hsa-miR-101	CLIP-seq
MIRT995788	hsa-miR-103a	CLIP-seq
MIRT2532961	hsa-miR-106a	CLIP-seq
MIRT2532962	hsa-miR-106b	CLIP-seq
MIRT995789	hsa-miR-107	CLIP-seq
MIRT2532963	hsa-miR-1208	CLIP-seq
MIRT739644	hsa-miR-1244	CLIP-seq
MIRT2532964	hsa-miR-1246	CLIP-seq
MIRT2532965	hsa-miR-1256	CLIP-seq
MIRT2532966	hsa-miR-125a-3p	CLIP-seq
MIRT2532967	hsa-miR-1276	CLIP-seq
MIRT2532968	hsa-miR-128	CLIP-seq
MIRT2532969	hsa-miR-1283	CLIP-seq
MIRT2532970	hsa-miR-1290	CLIP-seq
MIRT2532971	hsa-miR-1323	CLIP-seq
MIRT2532972	hsa-miR-133a	CLIP-seq
MIRT2532973	hsa-miR-133b	CLIP-seq
MIRT2532974	hsa-miR-140-3p	CLIP-seq
MIRT2532975	hsa-miR-140-5p	CLIP-seq
MIRT2532976	hsa-miR-142-5p	CLIP-seq
MIRT2437268	hsa-miR-144	CLIP-seq
MIRT2532977	hsa-miR-148a	CLIP-seq
MIRT2532978	hsa-miR-148b	CLIP-seq
MIRT2532979	hsa-miR-150	CLIP-seq
MIRT2532980	hsa-miR-152	CLIP-seq
MIRT2532981	hsa-miR-155	CLIP-seq
MIRT995791	hsa-miR-15a	CLIP-seq
MIRT995792	hsa-miR-15b	CLIP-seq
MIRT995793	hsa-miR-16	CLIP-seq
MIRT2532982	hsa-miR-17	CLIP-seq
MIRT2532983	hsa-miR-181a	CLIP-seq
MIRT2532984	hsa-miR-181b	CLIP-seq
MIRT2532985	hsa-miR-181c	CLIP-seq
MIRT2532986	hsa-miR-181d	CLIP-seq
MIRT2532987	hsa-miR-1912	CLIP-seq
MIRT2532988	hsa-miR-192	CLIP-seq
MIRT995794	hsa-miR-195	CLIP-seq
MIRT739646	hsa-miR-199a-3p	CLIP-seq
MIRT739645	hsa-miR-199b-3p	CLIP-seq
MIRT2532989	hsa-miR-200b	CLIP-seq
MIRT2532990	hsa-miR-200c	CLIP-seq
MIRT2532991	hsa-miR-203	CLIP-seq
MIRT2532992	hsa-miR-2053	CLIP-seq
MIRT2532993	hsa-miR-2054	CLIP-seq
MIRT2532994	hsa-miR-20a	CLIP-seq
MIRT2532995	hsa-miR-20b	CLIP-seq
MIRT995795	hsa-miR-21	CLIP-seq
MIRT1548698	hsa-miR-2113	CLIP-seq
MIRT1548699	hsa-miR-2116	CLIP-seq
MIRT2532996	hsa-miR-215	CLIP-seq
MIRT2532997	hsa-miR-216a	CLIP-seq
MIRT995796	hsa-miR-217	CLIP-seq
MIRT2532998	hsa-miR-218	CLIP-seq
MIRT2532999	hsa-miR-219-5p	CLIP-seq
MIRT2533000	hsa-miR-2277-3p	CLIP-seq
MIRT2533001	hsa-miR-23a	CLIP-seq
MIRT2533002	hsa-miR-23b	CLIP-seq
MIRT2533003	hsa-miR-23c	CLIP-seq
MIRT2533004	hsa-miR-296-5p	CLIP-seq
MIRT1548701	hsa-miR-300	CLIP-seq
MIRT2533005	hsa-miR-302a	CLIP-seq
MIRT2533006	hsa-miR-302b	CLIP-seq
MIRT2533007	hsa-miR-302c	CLIP-seq
MIRT2533008	hsa-miR-302d	CLIP-seq
MIRT2533009	hsa-miR-3121-3p	CLIP-seq
MIRT2533010	hsa-miR-3127-5p	CLIP-seq
MIRT739647	hsa-miR-3129-5p	CLIP-seq
MIRT2533011	hsa-miR-3130-5p	CLIP-seq
MIRT2533012	hsa-miR-3134	CLIP-seq
MIRT2533013	hsa-miR-3144-3p	CLIP-seq
MIRT995797	hsa-miR-3145-3p	CLIP-seq
MIRT2533014	hsa-miR-3148	CLIP-seq
MIRT995798	hsa-miR-3152-5p	CLIP-seq
MIRT2533015	hsa-miR-3155	CLIP-seq
MIRT2533016	hsa-miR-3155b	CLIP-seq
MIRT2533017	hsa-miR-3167	CLIP-seq
MIRT2533018	hsa-miR-3177-5p	CLIP-seq
MIRT2533019	hsa-miR-3200-5p	CLIP-seq
MIRT2533020	hsa-miR-3202	CLIP-seq
MIRT1548702	hsa-miR-331-5p	CLIP-seq
MIRT2533021	hsa-miR-340	CLIP-seq
MIRT2533022	hsa-miR-34b	CLIP-seq
MIRT2533023	hsa-miR-3609	CLIP-seq
MIRT2533024	hsa-miR-3613-3p	CLIP-seq
MIRT2533025	hsa-miR-361-5p	CLIP-seq
MIRT2533026	hsa-miR-3616-5p	CLIP-seq
MIRT2533027	hsa-miR-3622a-5p	CLIP-seq
MIRT2533028	hsa-miR-362-5p	CLIP-seq
MIRT2533029	hsa-miR-3647-3p	CLIP-seq
MIRT2533030	hsa-miR-3647-5p	CLIP-seq
MIRT1548705	hsa-miR-3671	CLIP-seq
MIRT2533031	hsa-miR-3685	CLIP-seq
MIRT995799	hsa-miR-3692	CLIP-seq
MIRT2533032	hsa-miR-369-3p	CLIP-seq
MIRT2533033	hsa-miR-371b-5p	CLIP-seq
MIRT2533034	hsa-miR-372	CLIP-seq
MIRT2533035	hsa-miR-373	CLIP-seq
MIRT1548706	hsa-miR-375	CLIP-seq
MIRT995800	hsa-miR-376c	CLIP-seq
MIRT2533036	hsa-miR-380	CLIP-seq
MIRT1548707	hsa-miR-381	CLIP-seq
MIRT2428934	hsa-miR-383	CLIP-seq
MIRT2533037	hsa-miR-384	CLIP-seq
MIRT995801	hsa-miR-3908	CLIP-seq
MIRT2533038	hsa-miR-3915	CLIP-seq
MIRT2533039	hsa-miR-3918	CLIP-seq
MIRT1548708	hsa-miR-3920	CLIP-seq
MIRT2533040	hsa-miR-3924	CLIP-seq
MIRT2533041	hsa-miR-3928	CLIP-seq
MIRT2533042	hsa-miR-3934	CLIP-seq
MIRT995802	hsa-miR-3942-5p	CLIP-seq
MIRT2533043	hsa-miR-3945	CLIP-seq
MIRT2533044	hsa-miR-3977	CLIP-seq
MIRT2533045	hsa-miR-3978	CLIP-seq
MIRT995803	hsa-miR-409-3p	CLIP-seq
MIRT2533046	hsa-miR-410	CLIP-seq
MIRT2533047	hsa-miR-421	CLIP-seq
MIRT995804	hsa-miR-424	CLIP-seq
MIRT2533048	hsa-miR-4253	CLIP-seq
MIRT995805	hsa-miR-4261	CLIP-seq
MIRT2533049	hsa-miR-4262	CLIP-seq
MIRT2533050	hsa-miR-4265	CLIP-seq
MIRT2428935	hsa-miR-4267	CLIP-seq
MIRT1548709	hsa-miR-4273	CLIP-seq
MIRT2533051	hsa-miR-4276	CLIP-seq
MIRT2533052	hsa-miR-4277	CLIP-seq
MIRT2533053	hsa-miR-4289	CLIP-seq
MIRT2533054	hsa-miR-429	CLIP-seq
MIRT1548710	hsa-miR-4291	CLIP-seq
MIRT2533055	hsa-miR-4293	CLIP-seq
MIRT2533056	hsa-miR-4296	CLIP-seq
MIRT995806	hsa-miR-4310	CLIP-seq
MIRT2533057	hsa-miR-4322	CLIP-seq
MIRT1548711	hsa-miR-4328	CLIP-seq
MIRT2533058	hsa-miR-433	CLIP-seq
MIRT2533059	hsa-miR-4422	CLIP-seq
MIRT2533060	hsa-miR-4423-3p	CLIP-seq
MIRT2437269	hsa-miR-4426	CLIP-seq
MIRT2533061	hsa-miR-4436b-3p	CLIP-seq
MIRT995807	hsa-miR-4436b-5p	CLIP-seq
MIRT2533062	hsa-miR-4445	CLIP-seq
MIRT2533063	hsa-miR-4453	CLIP-seq
MIRT995808	hsa-miR-4468	CLIP-seq
MIRT2533064	hsa-miR-4476	CLIP-seq
MIRT995809	hsa-miR-4477a	CLIP-seq
MIRT2533065	hsa-miR-4482	CLIP-seq
MIRT2533066	hsa-miR-4484	CLIP-seq
MIRT2533067	hsa-miR-4495	CLIP-seq
MIRT2533068	hsa-miR-4496	CLIP-seq
MIRT995810	hsa-miR-4517	CLIP-seq
MIRT2533069	hsa-miR-4520a-5p	CLIP-seq
MIRT2533070	hsa-miR-4520b-5p	CLIP-seq
MIRT2533071	hsa-miR-4521	CLIP-seq
MIRT1548713	hsa-miR-4524	CLIP-seq
MIRT2533072	hsa-miR-4528	CLIP-seq
MIRT2533073	hsa-miR-4534	CLIP-seq
MIRT2533074	hsa-miR-4538	CLIP-seq
MIRT2437270	hsa-miR-4647	CLIP-seq
MIRT2533075	hsa-miR-4648	CLIP-seq
MIRT2533076	hsa-miR-4649-3p	CLIP-seq
MIRT2533077	hsa-miR-4654	CLIP-seq
MIRT2533078	hsa-miR-4659a-5p	CLIP-seq
MIRT2533079	hsa-miR-4659b-5p	CLIP-seq
MIRT2437271	hsa-miR-4662b	CLIP-seq
MIRT1548716	hsa-miR-4666-3p	CLIP-seq
MIRT1548718	hsa-miR-4677-5p	CLIP-seq
MIRT1548719	hsa-miR-4678	CLIP-seq
MIRT2533080	hsa-miR-4698	CLIP-seq
MIRT995811	hsa-miR-4703-5p	CLIP-seq
MIRT2533081	hsa-miR-4704-5p	CLIP-seq
MIRT2533082	hsa-miR-4705	CLIP-seq
MIRT2533083	hsa-miR-4709-5p	CLIP-seq
MIRT2533084	hsa-miR-4713-5p	CLIP-seq
MIRT1548721	hsa-miR-4715-3p	CLIP-seq
MIRT2533085	hsa-miR-4718	CLIP-seq
MIRT2442168	hsa-miR-4722-3p	CLIP-seq
MIRT2533086	hsa-miR-4742-3p	CLIP-seq
MIRT2533087	hsa-miR-4747-5p	CLIP-seq
MIRT1548722	hsa-miR-4756-3p	CLIP-seq
MIRT1548723	hsa-miR-4760-3p	CLIP-seq
MIRT1548725	hsa-miR-4762-5p	CLIP-seq
MIRT2533088	hsa-miR-4764-3p	CLIP-seq
MIRT995813	hsa-miR-4766-3p	CLIP-seq
MIRT2533089	hsa-miR-4769-5p	CLIP-seq
MIRT2428936	hsa-miR-4772-5p	CLIP-seq
MIRT995814	hsa-miR-4774-3p	CLIP-seq
MIRT1548726	hsa-miR-4775	CLIP-seq
MIRT2533090	hsa-miR-4776-3p	CLIP-seq
MIRT2533091	hsa-miR-4777-5p	CLIP-seq
MIRT995815	hsa-miR-4781-3p	CLIP-seq
MIRT2533092	hsa-miR-4782-3p	CLIP-seq
MIRT2533093	hsa-miR-4786-3p	CLIP-seq
MIRT2533094	hsa-miR-4789-3p	CLIP-seq
MIRT1548727	hsa-miR-4789-5p	CLIP-seq
MIRT2533095	hsa-miR-4793-5p	CLIP-seq
MIRT1548728	hsa-miR-4795-3p	CLIP-seq
MIRT2533096	hsa-miR-4795-5p	CLIP-seq
MIRT2533097	hsa-miR-4796-3p	CLIP-seq
MIRT995816	hsa-miR-4803	CLIP-seq
MIRT2533098	hsa-miR-484	CLIP-seq
MIRT2533099	hsa-miR-486-5p	CLIP-seq
MIRT995817	hsa-miR-494	CLIP-seq
MIRT995818	hsa-miR-495	CLIP-seq
MIRT995819	hsa-miR-497	CLIP-seq
MIRT2533100	hsa-miR-500a	CLIP-seq
MIRT2533101	hsa-miR-500b	CLIP-seq
MIRT995820	hsa-miR-501-5p	CLIP-seq
MIRT1548729	hsa-miR-503	CLIP-seq
MIRT2533102	hsa-miR-508-3p	CLIP-seq
MIRT2533103	hsa-miR-512-3p	CLIP-seq
MIRT2533104	hsa-miR-513a-3p	CLIP-seq
MIRT2533105	hsa-miR-518d-5p	CLIP-seq
MIRT2533106	hsa-miR-519b-5p	CLIP-seq
MIRT2533107	hsa-miR-519c-5p	CLIP-seq
MIRT2533108	hsa-miR-519d	CLIP-seq
MIRT2533109	hsa-miR-520c-5p	CLIP-seq
MIRT2533110	hsa-miR-526a	CLIP-seq
MIRT2533111	hsa-miR-532-3p	CLIP-seq
MIRT2533112	hsa-miR-548a-3p	CLIP-seq
MIRT2533113	hsa-miR-548aa	CLIP-seq
MIRT2533114	hsa-miR-548ah	CLIP-seq
MIRT2533115	hsa-miR-548an	CLIP-seq
MIRT2533116	hsa-miR-548e	CLIP-seq
MIRT2533117	hsa-miR-548f	CLIP-seq
MIRT2533118	hsa-miR-548o	CLIP-seq
MIRT2533119	hsa-miR-548p	CLIP-seq
MIRT2533120	hsa-miR-548u	CLIP-seq
MIRT2533121	hsa-miR-561	CLIP-seq
MIRT1548732	hsa-miR-570	CLIP-seq
MIRT2533122	hsa-miR-573	CLIP-seq
MIRT2533123	hsa-miR-576-5p	CLIP-seq
MIRT995821	hsa-miR-577	CLIP-seq
MIRT2533124	hsa-miR-586	CLIP-seq
MIRT995823	hsa-miR-590-5p	CLIP-seq
MIRT1548733	hsa-miR-599	CLIP-seq
MIRT1548734	hsa-miR-607	CLIP-seq
MIRT2533125	hsa-miR-621	CLIP-seq
MIRT2533126	hsa-miR-643	CLIP-seq
MIRT1548735	hsa-miR-646	CLIP-seq
MIRT2533127	hsa-miR-660	CLIP-seq
MIRT2533128	hsa-miR-764	CLIP-seq
MIRT2533129	hsa-miR-875-5p	CLIP-seq
MIRT2533130	hsa-miR-876-5p	CLIP-seq
MIRT1548736	hsa-miR-922	CLIP-seq
MIRT2533131	hsa-miR-93	CLIP-seq
MIRT739648	hsa-miR-936	CLIP-seq
MIRT2437267	hsa-miR-101	CLIP-seq
MIRT995788	hsa-miR-103a	CLIP-seq
MIRT2532961	hsa-miR-106a	CLIP-seq
MIRT2532962	hsa-miR-106b	CLIP-seq
MIRT995789	hsa-miR-107	CLIP-seq
MIRT2532963	hsa-miR-1208	CLIP-seq
MIRT2680963	hsa-miR-1231	CLIP-seq
MIRT2532964	hsa-miR-1246	CLIP-seq
MIRT2532965	hsa-miR-1256	CLIP-seq
MIRT2532966	hsa-miR-125a-3p	CLIP-seq
MIRT2532967	hsa-miR-1276	CLIP-seq
MIRT2532968	hsa-miR-128	CLIP-seq
MIRT2532969	hsa-miR-1283	CLIP-seq
MIRT2532970	hsa-miR-1290	CLIP-seq
MIRT2680964	hsa-miR-1305	CLIP-seq
MIRT2532971	hsa-miR-1323	CLIP-seq
MIRT2532972	hsa-miR-133a	CLIP-seq
MIRT2532973	hsa-miR-133b	CLIP-seq
MIRT2532974	hsa-miR-140-3p	CLIP-seq
MIRT2532975	hsa-miR-140-5p	CLIP-seq
MIRT2532976	hsa-miR-142-5p	CLIP-seq
MIRT2437268	hsa-miR-144	CLIP-seq
MIRT2532977	hsa-miR-148a	CLIP-seq
MIRT2532978	hsa-miR-148b	CLIP-seq
MIRT2532979	hsa-miR-150	CLIP-seq
MIRT2532980	hsa-miR-152	CLIP-seq
MIRT2532981	hsa-miR-155	CLIP-seq
MIRT995791	hsa-miR-15a	CLIP-seq
MIRT995792	hsa-miR-15b	CLIP-seq
MIRT995793	hsa-miR-16	CLIP-seq
MIRT2532982	hsa-miR-17	CLIP-seq
MIRT2532983	hsa-miR-181a	CLIP-seq
MIRT2532984	hsa-miR-181b	CLIP-seq
MIRT2532985	hsa-miR-181c	CLIP-seq
MIRT2532986	hsa-miR-181d	CLIP-seq
MIRT2532987	hsa-miR-1912	CLIP-seq
MIRT2532988	hsa-miR-192	CLIP-seq
MIRT995794	hsa-miR-195	CLIP-seq
MIRT739646	hsa-miR-199a-3p	CLIP-seq
MIRT739645	hsa-miR-199b-3p	CLIP-seq
MIRT2532991	hsa-miR-203	CLIP-seq
MIRT2532992	hsa-miR-2053	CLIP-seq
MIRT2532994	hsa-miR-20a	CLIP-seq
MIRT2532995	hsa-miR-20b	CLIP-seq
MIRT995795	hsa-miR-21	CLIP-seq
MIRT1548698	hsa-miR-2113	CLIP-seq
MIRT1548699	hsa-miR-2116	CLIP-seq
MIRT2532996	hsa-miR-215	CLIP-seq
MIRT2532997	hsa-miR-216a	CLIP-seq
MIRT995796	hsa-miR-217	CLIP-seq
MIRT2532998	hsa-miR-218	CLIP-seq
MIRT2532999	hsa-miR-219-5p	CLIP-seq
MIRT2533000	hsa-miR-2277-3p	CLIP-seq
MIRT2533001	hsa-miR-23a	CLIP-seq
MIRT2533002	hsa-miR-23b	CLIP-seq
MIRT2533003	hsa-miR-23c	CLIP-seq
MIRT2533004	hsa-miR-296-5p	CLIP-seq
MIRT1548701	hsa-miR-300	CLIP-seq
MIRT2533005	hsa-miR-302a	CLIP-seq
MIRT2533006	hsa-miR-302b	CLIP-seq
MIRT2533007	hsa-miR-302c	CLIP-seq
MIRT2533008	hsa-miR-302d	CLIP-seq
MIRT2533009	hsa-miR-3121-3p	CLIP-seq
MIRT2533010	hsa-miR-3127-5p	CLIP-seq
MIRT739647	hsa-miR-3129-5p	CLIP-seq
MIRT2533011	hsa-miR-3130-5p	CLIP-seq
MIRT2533012	hsa-miR-3134	CLIP-seq
MIRT2680965	hsa-miR-3136-3p	CLIP-seq
MIRT2533013	hsa-miR-3144-3p	CLIP-seq
MIRT995797	hsa-miR-3145-3p	CLIP-seq
MIRT995798	hsa-miR-3152-5p	CLIP-seq
MIRT2533015	hsa-miR-3155	CLIP-seq
MIRT2533016	hsa-miR-3155b	CLIP-seq
MIRT2533017	hsa-miR-3167	CLIP-seq
MIRT2533018	hsa-miR-3177-5p	CLIP-seq
MIRT2533019	hsa-miR-3200-5p	CLIP-seq
MIRT2533020	hsa-miR-3202	CLIP-seq
MIRT1548702	hsa-miR-331-5p	CLIP-seq
MIRT2533021	hsa-miR-340	CLIP-seq
MIRT2680966	hsa-miR-346	CLIP-seq
MIRT2533022	hsa-miR-34b	CLIP-seq
MIRT2680967	hsa-miR-3607-3p	CLIP-seq
MIRT2533023	hsa-miR-3609	CLIP-seq
MIRT2533024	hsa-miR-3613-3p	CLIP-seq
MIRT2533025	hsa-miR-361-5p	CLIP-seq
MIRT2533026	hsa-miR-3616-5p	CLIP-seq
MIRT2533027	hsa-miR-3622a-5p	CLIP-seq
MIRT2533029	hsa-miR-3647-3p	CLIP-seq
MIRT2533030	hsa-miR-3647-5p	CLIP-seq
MIRT1548705	hsa-miR-3671	CLIP-seq
MIRT2533031	hsa-miR-3685	CLIP-seq
MIRT995799	hsa-miR-3692	CLIP-seq
MIRT2533033	hsa-miR-371b-5p	CLIP-seq
MIRT2533034	hsa-miR-372	CLIP-seq
MIRT2533035	hsa-miR-373	CLIP-seq
MIRT1548706	hsa-miR-375	CLIP-seq
MIRT995800	hsa-miR-376c	CLIP-seq
MIRT2533036	hsa-miR-380	CLIP-seq
MIRT1548707	hsa-miR-381	CLIP-seq
MIRT2428934	hsa-miR-383	CLIP-seq
MIRT2533037	hsa-miR-384	CLIP-seq
MIRT995801	hsa-miR-3908	CLIP-seq
MIRT2533038	hsa-miR-3915	CLIP-seq
MIRT2533039	hsa-miR-3918	CLIP-seq
MIRT1548708	hsa-miR-3920	CLIP-seq
MIRT2533040	hsa-miR-3924	CLIP-seq
MIRT2533041	hsa-miR-3928	CLIP-seq
MIRT2533042	hsa-miR-3934	CLIP-seq
MIRT995802	hsa-miR-3942-5p	CLIP-seq
MIRT2533043	hsa-miR-3945	CLIP-seq
MIRT2533044	hsa-miR-3977	CLIP-seq
MIRT2533045	hsa-miR-3978	CLIP-seq
MIRT995803	hsa-miR-409-3p	CLIP-seq
MIRT2533046	hsa-miR-410	CLIP-seq
MIRT2533047	hsa-miR-421	CLIP-seq
MIRT995804	hsa-miR-424	CLIP-seq
MIRT2533048	hsa-miR-4253	CLIP-seq
MIRT995805	hsa-miR-4261	CLIP-seq
MIRT2533049	hsa-miR-4262	CLIP-seq
MIRT2428935	hsa-miR-4267	CLIP-seq
MIRT1548709	hsa-miR-4273	CLIP-seq
MIRT2533051	hsa-miR-4276	CLIP-seq
MIRT2533052	hsa-miR-4277	CLIP-seq
MIRT2680968	hsa-miR-4288	CLIP-seq
MIRT2533053	hsa-miR-4289	CLIP-seq
MIRT1548710	hsa-miR-4291	CLIP-seq
MIRT2533055	hsa-miR-4293	CLIP-seq
MIRT2680969	hsa-miR-4297	CLIP-seq
MIRT995806	hsa-miR-4310	CLIP-seq
MIRT1548711	hsa-miR-4328	CLIP-seq
MIRT2533058	hsa-miR-433	CLIP-seq
MIRT2533060	hsa-miR-4423-3p	CLIP-seq
MIRT2437269	hsa-miR-4426	CLIP-seq
MIRT2533061	hsa-miR-4436b-3p	CLIP-seq
MIRT995807	hsa-miR-4436b-5p	CLIP-seq
MIRT2533062	hsa-miR-4445	CLIP-seq
MIRT2533063	hsa-miR-4453	CLIP-seq
MIRT995808	hsa-miR-4468	CLIP-seq
MIRT2533064	hsa-miR-4476	CLIP-seq
MIRT995809	hsa-miR-4477a	CLIP-seq
MIRT2533065	hsa-miR-4482	CLIP-seq
MIRT2533066	hsa-miR-4484	CLIP-seq
MIRT2533067	hsa-miR-4495	CLIP-seq
MIRT2533068	hsa-miR-4496	CLIP-seq
MIRT995810	hsa-miR-4517	CLIP-seq
MIRT2533069	hsa-miR-4520a-5p	CLIP-seq
MIRT2533070	hsa-miR-4520b-5p	CLIP-seq
MIRT2533071	hsa-miR-4521	CLIP-seq
MIRT1548713	hsa-miR-4524	CLIP-seq
MIRT2533072	hsa-miR-4528	CLIP-seq
MIRT2533073	hsa-miR-4534	CLIP-seq
MIRT2533074	hsa-miR-4538	CLIP-seq
MIRT2437270	hsa-miR-4647	CLIP-seq
MIRT2533076	hsa-miR-4649-3p	CLIP-seq
MIRT2533078	hsa-miR-4659a-5p	CLIP-seq
MIRT2533079	hsa-miR-4659b-5p	CLIP-seq
MIRT2437271	hsa-miR-4662b	CLIP-seq
MIRT1548716	hsa-miR-4666-3p	CLIP-seq
MIRT2680970	hsa-miR-4668-3p	CLIP-seq
MIRT1548718	hsa-miR-4677-5p	CLIP-seq
MIRT1548719	hsa-miR-4678	CLIP-seq
MIRT2533080	hsa-miR-4698	CLIP-seq
MIRT995811	hsa-miR-4703-5p	CLIP-seq
MIRT2533081	hsa-miR-4704-5p	CLIP-seq
MIRT2533082	hsa-miR-4705	CLIP-seq
MIRT2533083	hsa-miR-4709-5p	CLIP-seq
MIRT995812	hsa-miR-4711-3p	CLIP-seq
MIRT2533084	hsa-miR-4713-5p	CLIP-seq
MIRT1548721	hsa-miR-4715-3p	CLIP-seq
MIRT2442168	hsa-miR-4722-3p	CLIP-seq
MIRT2533086	hsa-miR-4742-3p	CLIP-seq
MIRT1548722	hsa-miR-4756-3p	CLIP-seq
MIRT1548723	hsa-miR-4760-3p	CLIP-seq
MIRT1548725	hsa-miR-4762-5p	CLIP-seq
MIRT2533088	hsa-miR-4764-3p	CLIP-seq
MIRT995813	hsa-miR-4766-3p	CLIP-seq
MIRT2428936	hsa-miR-4772-5p	CLIP-seq
MIRT995814	hsa-miR-4774-3p	CLIP-seq
MIRT1548726	hsa-miR-4775	CLIP-seq
MIRT2533090	hsa-miR-4776-3p	CLIP-seq
MIRT2533091	hsa-miR-4777-5p	CLIP-seq
MIRT995815	hsa-miR-4781-3p	CLIP-seq
MIRT2533092	hsa-miR-4782-3p	CLIP-seq
MIRT2533093	hsa-miR-4786-3p	CLIP-seq
MIRT1548727	hsa-miR-4789-5p	CLIP-seq
MIRT2533095	hsa-miR-4793-5p	CLIP-seq
MIRT1548728	hsa-miR-4795-3p	CLIP-seq
MIRT2533096	hsa-miR-4795-5p	CLIP-seq
MIRT2533097	hsa-miR-4796-3p	CLIP-seq
MIRT995816	hsa-miR-4803	CLIP-seq
MIRT2533098	hsa-miR-484	CLIP-seq
MIRT2533099	hsa-miR-486-5p	CLIP-seq
MIRT995817	hsa-miR-494	CLIP-seq
MIRT995818	hsa-miR-495	CLIP-seq
MIRT995819	hsa-miR-497	CLIP-seq
MIRT2533100	hsa-miR-500a	CLIP-seq
MIRT995820	hsa-miR-501-5p	CLIP-seq
MIRT1548729	hsa-miR-503	CLIP-seq
MIRT2533102	hsa-miR-508-3p	CLIP-seq
MIRT2533103	hsa-miR-512-3p	CLIP-seq
MIRT2533104	hsa-miR-513a-3p	CLIP-seq
MIRT2533105	hsa-miR-518d-5p	CLIP-seq
MIRT2533106	hsa-miR-519b-5p	CLIP-seq
MIRT2533107	hsa-miR-519c-5p	CLIP-seq
MIRT2533108	hsa-miR-519d	CLIP-seq
MIRT2533109	hsa-miR-520c-5p	CLIP-seq
MIRT2533110	hsa-miR-526a	CLIP-seq
MIRT2533111	hsa-miR-532-3p	CLIP-seq
MIRT2533112	hsa-miR-548a-3p	CLIP-seq
MIRT2533113	hsa-miR-548aa	CLIP-seq
MIRT2533114	hsa-miR-548ah	CLIP-seq
MIRT2533115	hsa-miR-548an	CLIP-seq
MIRT2533116	hsa-miR-548e	CLIP-seq
MIRT2533117	hsa-miR-548f	CLIP-seq
MIRT2533118	hsa-miR-548o	CLIP-seq
MIRT2533119	hsa-miR-548p	CLIP-seq
MIRT2533120	hsa-miR-548u	CLIP-seq
MIRT1548732	hsa-miR-570	CLIP-seq
MIRT2533122	hsa-miR-573	CLIP-seq
MIRT2533123	hsa-miR-576-5p	CLIP-seq
MIRT995821	hsa-miR-577	CLIP-seq
MIRT2533124	hsa-miR-586	CLIP-seq
MIRT995823	hsa-miR-590-5p	CLIP-seq
MIRT1548733	hsa-miR-599	CLIP-seq
MIRT1548734	hsa-miR-607	CLIP-seq
MIRT2533125	hsa-miR-621	CLIP-seq
MIRT2680971	hsa-miR-632	CLIP-seq
MIRT2533126	hsa-miR-643	CLIP-seq
MIRT1548735	hsa-miR-646	CLIP-seq
MIRT2533127	hsa-miR-660	CLIP-seq
MIRT2680972	hsa-miR-665	CLIP-seq
MIRT2533128	hsa-miR-764	CLIP-seq
MIRT2533129	hsa-miR-875-5p	CLIP-seq
MIRT2533130	hsa-miR-876-5p	CLIP-seq
MIRT1548736	hsa-miR-922	CLIP-seq
MIRT2533131	hsa-miR-93	CLIP-seq
MIRT739648	hsa-miR-936	CLIP-seq

Transcription factor	Regulation	Reference
JUN	Unknown	15840658
NFKB1	Unknown	9869450
RELA	Unknown	9869450

49 Show/Hide all (49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001935	Process	Endothelial cell proliferation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0005111	Function	Type 2 fibroblast growth factor receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	1309608
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0007165	Process	Signal transduction	NAS	2475908
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	2475908
GO:0008201	Function	Heparin binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	8663044
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	2915979
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IGI	8663044
GO:0008544	Process	Epidermis development	TAS	7973639
GO:0009611	Process	Response to wounding	TAS	7973639
GO:0010463	Process	Mesenchymal cell proliferation	IDA	11023837
GO:0010838	Process	Positive regulation of keratinocyte proliferation	IDA	17449030
GO:0022008	Process	Neurogenesis	IBA
GO:0030036	Process	Actin cytoskeleton organization	IDA	17449030
GO:0030324	Process	Lung development	IBA
GO:0030334	Process	Regulation of cell migration	IBA
GO:0031069	Process	Hair follicle morphogenesis	IEA
GO:0034394	Process	Protein localization to cell surface	IDA	17449030
GO:0042056	Function	Chemoattractant activity	IDA	17449030
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IBA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IDA	11493558
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IDA	15690149
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	17449030
GO:0050918	Process	Positive chemotaxis	IDA	17449030
GO:0051450	Process	Myoblast proliferation	IEA
GO:0051549	Process	Positive regulation of keratinocyte migration	IDA	17449030
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0060445	Process	Branching involved in salivary gland morphogenesis	IEA
GO:0060501	Process	Positive regulation of epithelial cell proliferation involved in lung morphogenesis	IDA	9740653
GO:0060665	Process	Regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling	IEA
GO:0061033	Process	Secretion by lung epithelial cell involved in lung growth	IDA	10541313
GO:0090128	Process	Regulation of synapse maturation	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:2000288	Process	Positive regulation of myoblast proliferation	IEA

MIM	HGNC	e!Ensembl
148180	3685	ENSG00000140285

P21781

Protein name

Fibroblast growth factor 7 (FGF-7) (Heparin-binding growth factor 7) (HBGF-7) (Keratinocyte growth factor)

Protein function

Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epit

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00167	FGF	65 → 189	Fibroblast growth factor	Domain

Tissue specificity

TISSUE SPECIFICITY: Epithelial cell.

Sequence

MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTK
KEQKTAHFLPMAIT

Sequence length

194

Interactions

View interactions

KEGG Pathway	Reactome Pathway
MAPK signaling pathway	PI3K Cascade
Ras signaling pathway	PIP3 activates AKT signaling
Rap1 signaling pathway	FGFR2b ligand binding and activation
Calcium signaling pathway	Activated point mutants of FGFR2
PI3K-Akt signaling pathway	Constitutive Signaling by Aberrant PI3K in Cancer
Regulation of actin cytoskeleton	Phospholipase C-mediated cascade; FGFR2
Pathways in cancer	PI-3K cascade:FGFR2
Chemical carcinogenesis - receptor activation	SHC-mediated cascade:FGFR2
Melanoma	FRS-mediated FGFR2 signaling
Breast cancer	Negative regulation of FGFR2 signaling
Gastric cancer	Signaling by FGFR2 in disease
	RAF/MAP kinase cascade
	PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (13)
CLEFT LIP	—	CTD	17963255	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT PALATE	—	CTD, Disgenet CTD, Disgenet	17963255	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT UPPER LIP	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLETE UNILATERAL CLEFT LIP	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GINGIVAL HYPERPLASIA	—	CTD	11023675	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTHYROIDISM	—	GWAS catalog	34594039, 39067062	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	17692400	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	28604730, 37236969	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTINODULAR GOITER	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC HYPERPLASIA	—	CTD	14999240	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC HYPERTROPHY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	15677771	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC NODULAR GOITER	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (158)
Adenocarcinoma	Adenocarcinoma	BEFREE	8759054, 9070494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	GWASCAT_DG	28604730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Rickets	Rickets	BEFREE	25165185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	29693180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	15677771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	24002438		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	17525264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	39342401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	26587829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29707971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal cell nevus syndrome	Pubtator	19287498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	10902811, 11453236, 18386288, 8973690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	CTD_human_DG	14999240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14981945, 15311216, 15672868, 16827106, 19035303, 19661335, 28869838, 31308741, 9184170, 9538155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15311216, 15781986, 16827106, 18225535, 18383836, 19035303, 19661335, 27852068, 28869838, 35726195, 9184170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	LHGDN	12016100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	19700645, 29722558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	29722558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	30459472	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	18976705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22159401, 25623741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25623741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	29970688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	17525264, 22159401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26587829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17596295, 20213138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22427941, 38188687	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11000522, 15809711, 29970688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome 1	Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome	BEFREE	9869450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	12533693, 18246360, 22481617, 33627146	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	20679958, 25138153, 29556625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	22024578, 29556625	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma Middle Ear	Middle ear cholesteatoma	Pubtator	12533693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	10698046, 10739532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	19281086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21921092, 22796760, 30777021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	BEFREE	29556625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	27855391, 27981544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	10562583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	10562583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	8701991, 9358773	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26514676, 7962522, 9788974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10849325, 17706640, 19148469, 26514676, 31459966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17706640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	16984257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	17676984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of kidney	Renal hypoplasia	BEFREE	21222001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	30816491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	39501130	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	22028906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	8701991, 9358773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	8701991, 9358773	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	16141466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Adenomatoid Malformation of Lung, Congenital	Congenital Cystic Adenomatoid Malformation Of Lung	BEFREE	18558180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	11459923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	31555794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	16862176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	39342401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	8243806, 9070494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	12574212, 18292933, 9070494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	17482184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	29970688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	12569015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	8275490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	17786302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33323552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	8275490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	29722558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	17692400, 22713451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	17692400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	28481834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	10562583	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23577178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23577178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23577178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23577178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	15024187, 31205263		★★★★★ ★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	19158050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	18708365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	19177201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30858037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	15677771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	15677771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	29722558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10562583, 8566591, 8701991, 9358773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	10562583, 9358773	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	8701991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	16984257, 31555794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	17692400		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	BEFREE	27855391, 27981544		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	22796760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	22796760, 29722558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	31063156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14981945, 15311216, 15672868, 16827106, 18575591, 19035303, 19661335, 28869838, 31308741, 9184170, 9538155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	18292933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	8275490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11000522, 15809711, 29970688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17525264, 22159401, 7575607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10353739, 11069376, 19293288, 30761180, 8759054, 8973690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23545898, 28339036, 31289541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10849325, 14695201, 15327889, 17525264, 19148469, 20595807, 23545898, 24188496, 28093295, 30761180, 8973690, 9538155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26514676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15781986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	8499330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	28270036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	9794620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10849325, 12569015, 15562028, 20213138, 21367751, 22924850, 23335069, 28850798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular fasciitis	Nodular Fasciitis	BEFREE	12606136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	14981945, 15672868, 16619493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	15327889, 18708365, 19584147, 24188496, 29181845, 30999249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	20109188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomalacia	Osteomalacia	BEFREE	25165185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34102610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11000522, 15809711, 29970688		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15809711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24146310, 29970688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17525264, 22159401, 7575607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	17525264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	17525264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17525264, 22159401, 9665482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	9665487	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	LHGDN	12645668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	11842940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	8668336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	16141466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10353739, 11069376, 19293288, 30761180, 8759054, 8973690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Adenoma	Prostatic Adenoma	CTD_human_DG	14999240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	10880394	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	11453236		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Hyperplasia	Prostatic Hyperplasia	CTD_human_DG	14999240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Hyperplasia	Prostatic Hyperplasia	LHGDN	18386288		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Hypertrophy	Prostatic Hypertrophy	CTD_human_DG	14999240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15368475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27787597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	16120148, 16862176, 31555794, 9403712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30858037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21921092, 22796760, 29722558, 30777021	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	15579628, 28543309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	15677771, 28543309		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	15677771		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	18065658, 28526233, 29466596, 31728357, 31741137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	24288432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	32329827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	34850536	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	1445445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	30423328, 9767281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17596295, 20213138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20213138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20213138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23545898, 28339036, 31289541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17049492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23545898, 28339036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	15327889, 18708365, 19584147, 24188496, 29181845, 30999249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35459137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	25623741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21677832, 30807805, 8701991, 9358773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	25623741		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
FGF3	3	["Cleft lip","Cleft palate","Complete unilateral cleft lip"]	22	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Chemical carcinogenesis - receptor activation","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer"]	5	["CTD (Cleft lip)","Disgenet (Cleft palate)","CTD (Cleft palate)","Disgenet (Cleft lip)","Disgenet (Complete unilateral cleft lip)"]
FGF10	3	["Cleft lip","Cleft palate","Complete unilateral cleft lip"]	22	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Chemical carcinogenesis - receptor activation","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer"]	5	["CTD (Cleft lip)","Disgenet (Cleft palate)","CTD (Cleft palate)","Disgenet (Cleft lip)","Disgenet (Complete unilateral cleft lip)"]
FGF9	3	["Cleft lip","Cleft palate","Complete unilateral cleft lip"]	21	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Chemical carcinogenesis - receptor activation","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer"]	5	["CTD (Cleft lip)","Disgenet (Cleft palate)","CTD (Cleft palate)","Disgenet (Cleft lip)","Disgenet (Complete unilateral cleft lip)"]
FGF1	3	["Cleft lip","Complete unilateral cleft lip","Pulmonary fibrosis"]	21	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Calcium signaling pathway","Regulation of actin cytoskeleton","Melanoma","Breast cancer","Gastric cancer","PIP3 activates AKT signaling","RAF\/MAP kinase cascade","Constitutive Signaling by Aberrant PI3K in Cancer","PI5P, PP2A and IER3 Regulate PI3K\/AKT Signaling"]	4	["Disgenet (Cleft lip)","Disgenet (Complete unilateral cleft lip)","CTD (Pulmonary fibrosis)","Disgenet (Pulmonary fibrosis)"]
MTHFS	3	["Cleft lip","Cleft palate","Complete unilateral cleft lip"]	0	[]	5	["CTD (Cleft lip)","Disgenet (Cleft palate)","CTD (Cleft palate)","Disgenet (Cleft lip)","Disgenet (Complete unilateral cleft lip)"]

FGF7 (fibroblast growth factor 7)

Bookmark This Gene