FAS (Fas cell surface death receptor)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 355
• Gene name: Fas cell surface death receptor
• Gene symbol: FAS
• Synonyms (NCBI Gene): ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6
• Chromosome: 10
• Chromosome location: 10q23.31
• Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogen

SNPs Show/Hide all (41)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28929498	A>T	Pathogenic	Missense variant, coding sequence variant, 3 prime UTR variant, non coding transcript variant
rs56006128	G>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance, not-provided	Intron variant, coding sequence variant, missense variant, non coding transcript variant
rs121913076	A>C	Pathogenic	Non coding transcript variant, missense variant, 3 prime UTR variant, coding sequence variant
rs121913077	C>T	Pathogenic	Non coding transcript variant, stop gained, 3 prime UTR variant, coding sequence variant
rs121913078	C>T	Pathogenic	Intron variant, missense variant, non coding transcript variant, coding sequence variant
rs121913079	A>G	Pathogenic, uncertain-significance	Non coding transcript variant, missense variant, 3 prime UTR variant, coding sequence variant
rs121913080	G>C	Pathogenic, likely-pathogenic	Non coding transcript variant, missense variant, 3 prime UTR variant, coding sequence variant
rs121913081	C>T	Pathogenic	Non coding transcript variant, missense variant, 3 prime UTR variant, coding sequence variant
rs121913082	A>G	Pathogenic	Non coding transcript variant, missense variant, 3 prime UTR variant, coding sequence variant
rs121913083	A>G	Pathogenic	Intron variant, missense variant, non coding transcript variant, coding sequence variant
rs121913084	T>C	Pathogenic	Intron variant, missense variant, non coding transcript variant, coding sequence variant
rs121913085	G>C	Pathogenic	Non coding transcript variant, missense variant, 3 prime UTR variant, coding sequence variant
rs121913086	G>T	Pathogenic	Non coding transcript variant, missense variant, 3 prime UTR variant, coding sequence variant
rs267607122	T>A,C	Pathogenic	Splice donor variant, intron variant
rs483352683	T>A,C	Likely-pathogenic, uncertain-significance	Coding sequence variant, 3 prime UTR variant, non coding transcript variant, missense variant
rs606231361	G>-	Pathogenic	Coding sequence variant, intron variant, frameshift variant, non coding transcript variant
rs606231362	->T	Pathogenic	Intron variant, splice donor variant
rs606231363	A>C	Pathogenic	Intron variant, splice acceptor variant
rs606231364	G>A	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs606231365	->AAAATTCAAACTTCAGAAAT	Pathogenic	Coding sequence variant, frameshift variant, non coding transcript variant, 3 prime UTR variant
rs606231366	->T	Pathogenic	Coding sequence variant, frameshift variant, non coding transcript variant, 3 prime UTR variant
rs778993919	C>A,T	Pathogenic	Stop gained, coding sequence variant, non coding transcript variant, 3 prime UTR variant, synonymous variant
rs886039359	G>A	Pathogenic	Intron variant, splice donor variant
rs886039524	AT>-	Pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant, 3 prime UTR variant
rs1085307626	G>-	Likely-pathogenic	Frameshift variant, non coding transcript variant, intron variant, coding sequence variant
rs1554851356	C>-	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1554851718	T>G	Likely-pathogenic	Non coding transcript variant, intron variant, missense variant, coding sequence variant
rs1554852090	A>-	Likely-pathogenic	Intron variant, frameshift variant, non coding transcript variant, stop gained, coding sequence variant
rs1554852244	->CATG	Pathogenic	Non coding transcript variant, frameshift variant, 3 prime UTR variant, coding sequence variant
rs1564686301	T>A	Pathogenic	Non coding transcript variant, stop gained, coding sequence variant
rs1564691414	A>G	Likely-pathogenic	Intron variant, splice acceptor variant
rs1564692984	T>-,TT	Likely-pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1564696849	G>A,T	Pathogenic, pathogenic-likely-pathogenic	Intron variant, splice donor variant
rs1564699214	A>-	Pathogenic	Non coding transcript variant, frameshift variant, 3 prime UTR variant, coding sequence variant
rs1589465172	C>-	Pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs1589465256	C>-	Likely-pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs1589478691	G>-	Pathogenic	Frameshift variant, coding sequence variant, intron variant, non coding transcript variant
rs1589485636	->TGAAAT	Pathogenic	Intron variant, splice donor variant
rs1589488463	G>A	Pathogenic	Splice acceptor variant, intron variant
rs1589488494	AG>-	Pathogenic	Frameshift variant, coding sequence variant, intron variant, non coding transcript variant
rs1589488640	G>A	Pathogenic	Intron variant, splice donor variant

miRNA Show/Hide all (358)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005581	hsa-miR-146a-5p	Luciferase reporter assay, Western blot	20656888
MIRT006331	hsa-miR-106a-5p	Luciferase reporter assay	22431000
MIRT006331	hsa-miR-106a-5p	Luciferase reporter assay	22431000
MIRT006331	hsa-miR-106a-5p	Luciferase reporter assay	22431000
MIRT006331	hsa-miR-106a-5p	Luciferase reporter assay	22431000
MIRT006331	hsa-miR-106a-5p	Luciferase reporter assay	22431000
MIRT006331	hsa-miR-106a-5p	Luciferase reporter assay	22431000
MIRT016252	hsa-miR-504-5p	qRT-PCR	20542001
MIRT027598	hsa-miR-98-5p	Microarray	19088304
MIRT002421	hsa-miR-21-5p	Microarray	20048743
MIRT053338	hsa-miR-196b-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22353710
MIRT053338	hsa-miR-196b-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22353710
MIRT053381	hsa-miR-23a-3p	Flow, Luciferase reporter assay, Microarray, Western blot	23804233
MIRT005581	hsa-miR-146a-5p	Luciferase reporter assay	23645835
MIRT005581	hsa-miR-146a-5p	Luciferase reporter assay	23645835
MIRT438788	hsa-miR-17-5p	qRT-PCR	24955218
MIRT438788	hsa-miR-17-5p	qRT-PCR	24955218
MIRT438787	hsa-miR-106b-5p	qRT-PCR	24955218
MIRT438787	hsa-miR-106b-5p	qRT-PCR	24955218
MIRT438786	hsa-miR-18a-5p	qRT-PCR	24955218
MIRT438786	hsa-miR-18a-5p	qRT-PCR	24955218
MIRT438785	hsa-miR-92a-1-5p	qRT-PCR	24955218
MIRT438785	hsa-miR-92a-1-5p	qRT-PCR	24955218
MIRT438784	hsa-miR-92a-2-5p	qRT-PCR	24955218
MIRT438784	hsa-miR-92a-2-5p	qRT-PCR	24955218
MIRT005581	hsa-miR-146a-5p	Luciferase reporter assay	23645835
MIRT005581	hsa-miR-146a-5p	Luciferase reporter assay	23645835
MIRT438788	hsa-miR-17-5p	qRT-PCR	24955218
MIRT438788	hsa-miR-17-5p	qRT-PCR	24955218
MIRT438787	hsa-miR-106b-5p	qRT-PCR	24955218
MIRT438787	hsa-miR-106b-5p	qRT-PCR	24955218
MIRT438786	hsa-miR-18a-5p	qRT-PCR	24955218
MIRT438786	hsa-miR-18a-5p	qRT-PCR	24955218
MIRT438785	hsa-miR-92a-1-5p	qRT-PCR	24955218
MIRT438785	hsa-miR-92a-1-5p	qRT-PCR	24955218
MIRT438784	hsa-miR-92a-2-5p	qRT-PCR	24955218
MIRT438784	hsa-miR-92a-2-5p	qRT-PCR	24955218
MIRT127441	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT127442	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT731620	hsa-miR-133b	Luciferase reporter assay	26919791
MIRT731620	hsa-miR-133b	Luciferase reporter assay	26919791
MIRT006331	hsa-miR-106a-5p	Flow, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	27142596
MIRT006331	hsa-miR-106a-5p	Flow, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	27142596
MIRT053338	hsa-miR-196b-5p	Luciferase reporter assay, qRT-PCR, Western blot	25605245
MIRT053338	hsa-miR-196b-5p	Luciferase reporter assay, qRT-PCR, Western blot	25605245
MIRT005581	hsa-miR-146a-5p	Immunofluorescence, qRT-PCR	32210951
MIRT053338	hsa-miR-196b-5p	Western blotting, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry, ELISA	32963220
MIRT735853	hsa-miR-141-3p	qRT-PCR, ELISA	32691634
MIRT989477	hsa-miR-1303	CLIP-seq
MIRT989478	hsa-miR-23a	CLIP-seq
MIRT989479	hsa-miR-23b	CLIP-seq
MIRT989480	hsa-miR-23c	CLIP-seq
MIRT989481	hsa-miR-3170	CLIP-seq
MIRT989482	hsa-miR-340	CLIP-seq
MIRT989483	hsa-miR-361-5p	CLIP-seq
MIRT989484	hsa-miR-3691-5p	CLIP-seq
MIRT989485	hsa-miR-374c	CLIP-seq
MIRT989486	hsa-miR-4257	CLIP-seq
MIRT989487	hsa-miR-4282	CLIP-seq
MIRT989488	hsa-miR-4293	CLIP-seq
MIRT989489	hsa-miR-4330	CLIP-seq
MIRT989490	hsa-miR-4481	CLIP-seq
MIRT989491	hsa-miR-4719	CLIP-seq
MIRT989492	hsa-miR-4745-5p	CLIP-seq
MIRT989493	hsa-miR-4752	CLIP-seq
MIRT989494	hsa-miR-561	CLIP-seq
MIRT989495	hsa-miR-596	CLIP-seq
MIRT989496	hsa-miR-655	CLIP-seq
MIRT989497	hsa-miR-759	CLIP-seq
MIRT989498	hsa-miR-877	CLIP-seq
MIRT1993275	hsa-miR-1912	CLIP-seq
MIRT1993276	hsa-miR-3130-5p	CLIP-seq
MIRT1993277	hsa-miR-4482	CLIP-seq
MIRT1993278	hsa-miR-4699-3p	CLIP-seq
MIRT1993279	hsa-miR-548aa	CLIP-seq
MIRT1993280	hsa-miR-548ac	CLIP-seq
MIRT1993281	hsa-miR-548d-3p	CLIP-seq
MIRT1993282	hsa-miR-548z	CLIP-seq
MIRT1993275	hsa-miR-1912	CLIP-seq
MIRT1993276	hsa-miR-3130-5p	CLIP-seq
MIRT2449478	hsa-miR-3163	CLIP-seq
MIRT2449479	hsa-miR-3646	CLIP-seq
MIRT2449480	hsa-miR-3662	CLIP-seq
MIRT1993277	hsa-miR-4482	CLIP-seq
MIRT2530912	hsa-miR-103b	CLIP-seq
MIRT2530913	hsa-miR-1206	CLIP-seq
MIRT2530914	hsa-miR-1225-5p	CLIP-seq
MIRT2530915	hsa-miR-1251	CLIP-seq
MIRT2530916	hsa-miR-1275	CLIP-seq
MIRT2530917	hsa-miR-1283	CLIP-seq
MIRT2530918	hsa-miR-1295	CLIP-seq
MIRT2530919	hsa-miR-129-5p	CLIP-seq
MIRT2530920	hsa-miR-1302	CLIP-seq
MIRT989477	hsa-miR-1303	CLIP-seq
MIRT2530921	hsa-miR-1305	CLIP-seq
MIRT2530922	hsa-miR-153	CLIP-seq
MIRT2530923	hsa-miR-181a	CLIP-seq
MIRT2530924	hsa-miR-181b	CLIP-seq
MIRT2530925	hsa-miR-181c	CLIP-seq
MIRT2530926	hsa-miR-181d	CLIP-seq
MIRT2530927	hsa-miR-185	CLIP-seq
MIRT1993275	hsa-miR-1912	CLIP-seq
MIRT2530928	hsa-miR-1976	CLIP-seq
MIRT2530929	hsa-miR-200b	CLIP-seq
MIRT2530930	hsa-miR-200c	CLIP-seq
MIRT2530931	hsa-miR-216b	CLIP-seq
MIRT2530932	hsa-miR-217	CLIP-seq
MIRT2530933	hsa-miR-2278	CLIP-seq
MIRT2530934	hsa-miR-28-3p	CLIP-seq
MIRT2530935	hsa-miR-29a	CLIP-seq
MIRT2530936	hsa-miR-29b	CLIP-seq
MIRT2530937	hsa-miR-29c	CLIP-seq
MIRT2530938	hsa-miR-302f	CLIP-seq
MIRT1993276	hsa-miR-3130-5p	CLIP-seq
MIRT2530939	hsa-miR-3140-3p	CLIP-seq
MIRT2530940	hsa-miR-3145-3p	CLIP-seq
MIRT2530941	hsa-miR-3148	CLIP-seq
MIRT2449478	hsa-miR-3163	CLIP-seq
MIRT2530942	hsa-miR-325	CLIP-seq
MIRT989482	hsa-miR-340	CLIP-seq
MIRT2530943	hsa-miR-342-5p	CLIP-seq
MIRT989483	hsa-miR-361-5p	CLIP-seq
MIRT2449479	hsa-miR-3646	CLIP-seq
MIRT2530944	hsa-miR-3653	CLIP-seq
MIRT2530945	hsa-miR-3658	CLIP-seq
MIRT2449480	hsa-miR-3662	CLIP-seq
MIRT2530946	hsa-miR-3663-3p	CLIP-seq
MIRT2530947	hsa-miR-3675-3p	CLIP-seq
MIRT2530948	hsa-miR-3677-5p	CLIP-seq
MIRT2530949	hsa-miR-3688-5p	CLIP-seq
MIRT2530950	hsa-miR-3689a-5p	CLIP-seq
MIRT2530951	hsa-miR-3689b	CLIP-seq
MIRT2530952	hsa-miR-3689e	CLIP-seq
MIRT2530953	hsa-miR-3689f	CLIP-seq
MIRT2530954	hsa-miR-370	CLIP-seq
MIRT2530955	hsa-miR-371b-5p	CLIP-seq
MIRT2530956	hsa-miR-376a	CLIP-seq
MIRT2530957	hsa-miR-376b	CLIP-seq
MIRT2530958	hsa-miR-3920	CLIP-seq
MIRT2530959	hsa-miR-3921	CLIP-seq
MIRT2530960	hsa-miR-3974	CLIP-seq
MIRT2530961	hsa-miR-4251	CLIP-seq
MIRT2530962	hsa-miR-4252	CLIP-seq
MIRT989486	hsa-miR-4257	CLIP-seq
MIRT2530963	hsa-miR-4260	CLIP-seq
MIRT2530964	hsa-miR-4262	CLIP-seq
MIRT2530965	hsa-miR-429	CLIP-seq
MIRT2530966	hsa-miR-4291	CLIP-seq
MIRT2530967	hsa-miR-4298	CLIP-seq
MIRT2530968	hsa-miR-4306	CLIP-seq
MIRT2530969	hsa-miR-4324	CLIP-seq
MIRT2530970	hsa-miR-4329	CLIP-seq
MIRT2530971	hsa-miR-433	CLIP-seq
MIRT989489	hsa-miR-4330	CLIP-seq
MIRT2530972	hsa-miR-4426	CLIP-seq
MIRT2530973	hsa-miR-4446-5p	CLIP-seq
MIRT2530974	hsa-miR-4447	CLIP-seq
MIRT2530975	hsa-miR-4470	CLIP-seq
MIRT2530976	hsa-miR-4472	CLIP-seq
MIRT2530977	hsa-miR-4477a	CLIP-seq
MIRT2530978	hsa-miR-448	CLIP-seq
MIRT1993277	hsa-miR-4482	CLIP-seq
MIRT2530979	hsa-miR-4517	CLIP-seq
MIRT2530980	hsa-miR-4525	CLIP-seq
MIRT2530981	hsa-miR-4644	CLIP-seq
MIRT2530982	hsa-miR-4647	CLIP-seq
MIRT2530983	hsa-miR-4651	CLIP-seq
MIRT2530984	hsa-miR-4653-5p	CLIP-seq
MIRT2530985	hsa-miR-4659a-3p	CLIP-seq
MIRT2530986	hsa-miR-4659b-3p	CLIP-seq
MIRT2530987	hsa-miR-4662b	CLIP-seq
MIRT2530988	hsa-miR-4664-5p	CLIP-seq
MIRT2530989	hsa-miR-4665-5p	CLIP-seq
MIRT2530990	hsa-miR-4668-3p	CLIP-seq
MIRT2530991	hsa-miR-4668-5p	CLIP-seq
MIRT2530992	hsa-miR-4670-3p	CLIP-seq
MIRT2530993	hsa-miR-4680-3p	CLIP-seq
MIRT2530994	hsa-miR-4694-3p	CLIP-seq
MIRT2530995	hsa-miR-4698	CLIP-seq
MIRT1993278	hsa-miR-4699-3p	CLIP-seq
MIRT2530996	hsa-miR-4716-5p	CLIP-seq
MIRT2530997	hsa-miR-4717-5p	CLIP-seq
MIRT989491	hsa-miR-4719	CLIP-seq
MIRT2530998	hsa-miR-4723-5p	CLIP-seq
MIRT2530999	hsa-miR-4763-5p	CLIP-seq
MIRT2531000	hsa-miR-4768-5p	CLIP-seq
MIRT2531001	hsa-miR-4778-3p	CLIP-seq
MIRT2531002	hsa-miR-4781-3p	CLIP-seq
MIRT2531003	hsa-miR-4787-5p	CLIP-seq
MIRT2531004	hsa-miR-4793-5p	CLIP-seq
MIRT2531005	hsa-miR-4796-3p	CLIP-seq
MIRT2531006	hsa-miR-483-3p	CLIP-seq
MIRT2531007	hsa-miR-485-3p	CLIP-seq
MIRT2531008	hsa-miR-510	CLIP-seq
MIRT2531009	hsa-miR-512-5p	CLIP-seq
MIRT2531010	hsa-miR-518a-5p	CLIP-seq
MIRT2531011	hsa-miR-520g	CLIP-seq
MIRT2531012	hsa-miR-520h	CLIP-seq
MIRT2531013	hsa-miR-527	CLIP-seq
MIRT2531014	hsa-miR-539	CLIP-seq
MIRT2531015	hsa-miR-545	CLIP-seq
MIRT1993279	hsa-miR-548aa	CLIP-seq
MIRT1993280	hsa-miR-548ac	CLIP-seq
MIRT2531016	hsa-miR-548c-3p	CLIP-seq
MIRT1993281	hsa-miR-548d-3p	CLIP-seq
MIRT2531017	hsa-miR-548p	CLIP-seq
MIRT1993282	hsa-miR-548z	CLIP-seq
MIRT989494	hsa-miR-561	CLIP-seq
MIRT2531018	hsa-miR-587	CLIP-seq
MIRT2531019	hsa-miR-607	CLIP-seq
MIRT2531020	hsa-miR-608	CLIP-seq
MIRT2531021	hsa-miR-625	CLIP-seq
MIRT2531022	hsa-miR-628-3p	CLIP-seq
MIRT989497	hsa-miR-759	CLIP-seq
MIRT2531023	hsa-miR-760	CLIP-seq
MIRT2531024	hsa-miR-767-3p	CLIP-seq
MIRT989498	hsa-miR-877	CLIP-seq
MIRT2531025	hsa-miR-942	CLIP-seq
MIRT2530912	hsa-miR-103b	CLIP-seq
MIRT2530913	hsa-miR-1206	CLIP-seq
MIRT2530914	hsa-miR-1225-5p	CLIP-seq
MIRT2530915	hsa-miR-1251	CLIP-seq
MIRT2530916	hsa-miR-1275	CLIP-seq
MIRT2530917	hsa-miR-1283	CLIP-seq
MIRT2530918	hsa-miR-1295	CLIP-seq
MIRT2530919	hsa-miR-129-5p	CLIP-seq
MIRT2530920	hsa-miR-1302	CLIP-seq
MIRT989477	hsa-miR-1303	CLIP-seq
MIRT2530921	hsa-miR-1305	CLIP-seq
MIRT2530922	hsa-miR-153	CLIP-seq
MIRT2530923	hsa-miR-181a	CLIP-seq
MIRT2530924	hsa-miR-181b	CLIP-seq
MIRT2530925	hsa-miR-181c	CLIP-seq
MIRT2530926	hsa-miR-181d	CLIP-seq
MIRT2680780	hsa-miR-1827	CLIP-seq
MIRT2530927	hsa-miR-185	CLIP-seq
MIRT1993275	hsa-miR-1912	CLIP-seq
MIRT2530928	hsa-miR-1976	CLIP-seq
MIRT2530929	hsa-miR-200b	CLIP-seq
MIRT2530930	hsa-miR-200c	CLIP-seq
MIRT2530931	hsa-miR-216b	CLIP-seq
MIRT2530932	hsa-miR-217	CLIP-seq
MIRT2530933	hsa-miR-2278	CLIP-seq
MIRT2530934	hsa-miR-28-3p	CLIP-seq
MIRT2530935	hsa-miR-29a	CLIP-seq
MIRT2530936	hsa-miR-29b	CLIP-seq
MIRT2530937	hsa-miR-29c	CLIP-seq
MIRT2530938	hsa-miR-302f	CLIP-seq
MIRT1993276	hsa-miR-3130-5p	CLIP-seq
MIRT2530939	hsa-miR-3140-3p	CLIP-seq
MIRT2530940	hsa-miR-3145-3p	CLIP-seq
MIRT2530941	hsa-miR-3148	CLIP-seq
MIRT2449478	hsa-miR-3163	CLIP-seq
MIRT2680781	hsa-miR-3189-3p	CLIP-seq
MIRT2530942	hsa-miR-325	CLIP-seq
MIRT989482	hsa-miR-340	CLIP-seq
MIRT2530943	hsa-miR-342-5p	CLIP-seq
MIRT2680782	hsa-miR-3612	CLIP-seq
MIRT989483	hsa-miR-361-5p	CLIP-seq
MIRT2680783	hsa-miR-362-5p	CLIP-seq
MIRT2449479	hsa-miR-3646	CLIP-seq
MIRT2530944	hsa-miR-3653	CLIP-seq
MIRT2530945	hsa-miR-3658	CLIP-seq
MIRT2449480	hsa-miR-3662	CLIP-seq
MIRT2530946	hsa-miR-3663-3p	CLIP-seq
MIRT2530947	hsa-miR-3675-3p	CLIP-seq
MIRT2530948	hsa-miR-3677-5p	CLIP-seq
MIRT2530949	hsa-miR-3688-5p	CLIP-seq
MIRT2530950	hsa-miR-3689a-5p	CLIP-seq
MIRT2530951	hsa-miR-3689b	CLIP-seq
MIRT2530952	hsa-miR-3689e	CLIP-seq
MIRT2530953	hsa-miR-3689f	CLIP-seq
MIRT2530954	hsa-miR-370	CLIP-seq
MIRT2530955	hsa-miR-371b-5p	CLIP-seq
MIRT2530958	hsa-miR-3920	CLIP-seq
MIRT2530959	hsa-miR-3921	CLIP-seq
MIRT2530960	hsa-miR-3974	CLIP-seq
MIRT2530961	hsa-miR-4251	CLIP-seq
MIRT2530962	hsa-miR-4252	CLIP-seq
MIRT989486	hsa-miR-4257	CLIP-seq
MIRT2530963	hsa-miR-4260	CLIP-seq
MIRT2530964	hsa-miR-4262	CLIP-seq
MIRT2530965	hsa-miR-429	CLIP-seq
MIRT2530966	hsa-miR-4291	CLIP-seq
MIRT2530967	hsa-miR-4298	CLIP-seq
MIRT2530968	hsa-miR-4306	CLIP-seq
MIRT2680784	hsa-miR-432	CLIP-seq
MIRT2530969	hsa-miR-4324	CLIP-seq
MIRT2530970	hsa-miR-4329	CLIP-seq
MIRT2530971	hsa-miR-433	CLIP-seq
MIRT989489	hsa-miR-4330	CLIP-seq
MIRT2530972	hsa-miR-4426	CLIP-seq
MIRT2680785	hsa-miR-4443	CLIP-seq
MIRT2530973	hsa-miR-4446-5p	CLIP-seq
MIRT2530974	hsa-miR-4447	CLIP-seq
MIRT2530975	hsa-miR-4470	CLIP-seq
MIRT2530976	hsa-miR-4472	CLIP-seq
MIRT2530977	hsa-miR-4477a	CLIP-seq
MIRT2530978	hsa-miR-448	CLIP-seq
MIRT1993277	hsa-miR-4482	CLIP-seq
MIRT2530979	hsa-miR-4517	CLIP-seq
MIRT2530980	hsa-miR-4525	CLIP-seq
MIRT2530981	hsa-miR-4644	CLIP-seq
MIRT2530982	hsa-miR-4647	CLIP-seq
MIRT2530983	hsa-miR-4651	CLIP-seq
MIRT2530984	hsa-miR-4653-5p	CLIP-seq
MIRT2530985	hsa-miR-4659a-3p	CLIP-seq
MIRT2530986	hsa-miR-4659b-3p	CLIP-seq
MIRT2530987	hsa-miR-4662b	CLIP-seq
MIRT2530988	hsa-miR-4664-5p	CLIP-seq
MIRT2530989	hsa-miR-4665-5p	CLIP-seq
MIRT2530990	hsa-miR-4668-3p	CLIP-seq
MIRT2530991	hsa-miR-4668-5p	CLIP-seq
MIRT2530992	hsa-miR-4670-3p	CLIP-seq
MIRT2530993	hsa-miR-4680-3p	CLIP-seq
MIRT2530994	hsa-miR-4694-3p	CLIP-seq
MIRT2530995	hsa-miR-4698	CLIP-seq
MIRT1993278	hsa-miR-4699-3p	CLIP-seq
MIRT2530996	hsa-miR-4716-5p	CLIP-seq
MIRT2530997	hsa-miR-4717-5p	CLIP-seq
MIRT989491	hsa-miR-4719	CLIP-seq
MIRT2530998	hsa-miR-4723-5p	CLIP-seq
MIRT2530999	hsa-miR-4763-5p	CLIP-seq
MIRT2531000	hsa-miR-4768-5p	CLIP-seq
MIRT2531001	hsa-miR-4778-3p	CLIP-seq
MIRT2531002	hsa-miR-4781-3p	CLIP-seq
MIRT2531003	hsa-miR-4787-5p	CLIP-seq
MIRT2531004	hsa-miR-4793-5p	CLIP-seq
MIRT2531005	hsa-miR-4796-3p	CLIP-seq
MIRT2531006	hsa-miR-483-3p	CLIP-seq
MIRT2531007	hsa-miR-485-3p	CLIP-seq
MIRT2680786	hsa-miR-500b	CLIP-seq
MIRT2531008	hsa-miR-510	CLIP-seq
MIRT2531009	hsa-miR-512-5p	CLIP-seq
MIRT2531010	hsa-miR-518a-5p	CLIP-seq
MIRT2531011	hsa-miR-520g	CLIP-seq
MIRT2531012	hsa-miR-520h	CLIP-seq
MIRT2531013	hsa-miR-527	CLIP-seq
MIRT2531014	hsa-miR-539	CLIP-seq
MIRT2531015	hsa-miR-545	CLIP-seq
MIRT1993279	hsa-miR-548aa	CLIP-seq
MIRT1993280	hsa-miR-548ac	CLIP-seq
MIRT2531016	hsa-miR-548c-3p	CLIP-seq
MIRT1993281	hsa-miR-548d-3p	CLIP-seq
MIRT2531017	hsa-miR-548p	CLIP-seq
MIRT1993282	hsa-miR-548z	CLIP-seq
MIRT989494	hsa-miR-561	CLIP-seq
MIRT2531018	hsa-miR-587	CLIP-seq
MIRT2531019	hsa-miR-607	CLIP-seq
MIRT2531020	hsa-miR-608	CLIP-seq
MIRT2531021	hsa-miR-625	CLIP-seq
MIRT2531022	hsa-miR-628-3p	CLIP-seq
MIRT2680787	hsa-miR-650	CLIP-seq
MIRT989497	hsa-miR-759	CLIP-seq
MIRT2531023	hsa-miR-760	CLIP-seq
MIRT2531024	hsa-miR-767-3p	CLIP-seq
MIRT989498	hsa-miR-877	CLIP-seq
MIRT2531025	hsa-miR-942	CLIP-seq

Transcription factors Show/Hide all (33)

Transcription factor	Regulation	Reference
ATF2	Unknown	19670268
ATM	Activation	19502594
EGR1	Repression	9300687
FOS	Activation	10903433
GLI1	Repression	21135115
GLI2	Repression	21135115
HDGF	Activation	19710540
JUN	Activation	10903433
JUN	Unknown	19670268
NFKB1	Activation	19628709;9733827
NFKB1	Repression	16784892
NFKB1	Unknown	10022897;10871852;16317104;7528667
NFKBIA	Repression	9733827
NFYA	Unknown	9261184
NFYB	Unknown	9261184
NFYC	Unknown	9261184
PURA	Repression	10903433
RELA	Activation	19628709;9733827
RELA	Repression	16784892
RELA	Unknown	10871852;16317104
SP1	Activation	22084312
SP1	Unknown	10022897;10871852;9261184;9300785
SREBF1	Activation	18420801
SREBF1	Unknown	12531699;20173757;9300785
SREBF2	Unknown	9300785
STAT1	Unknown	16317104
STAT3	Activation	15223310
STAT3	Repression	16651438;22313388
TFAP2A	Unknown	7528667
TP53	Activation	10101800;11313989
TP53	Unknown	16317104
YBX1	Repression	10903433
YY1	Repression	16784892;17530016

Gene ontology (GO) Show/Hide all (61)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005031	Function	Tumor necrosis factor receptor activity	IBA
GO:0005031	Function	Tumor necrosis factor receptor activity	IDA	12221075
GO:0005515	Function	Protein binding	IPI	7536190, 7538907, 10918185, 11003656, 11495919, 11606059, 12724420, 12887920, 15465831, 15917238, 16498403, 17047155, 17159907, 18328427, 18846110, 19118384, 20935634, 20956295, 21109225, 21382479, 21625644, 21713032, 21803845, 25241761, 26942442, 33961781
GO:0005516	Function	Calmodulin binding	IDA	24914971
GO:0005516	Function	Calmodulin binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	NAS	7533181
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	21625644
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IDA	9681877
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	1375228, 10871852
GO:0006924	Process	Activation-induced cell death of T cells	IBA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	9360929
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	9184224
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	9333124, 12221075
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	22891283
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0019900	Function	Kinase binding	IPI	7538908
GO:0031264	Component	Death-inducing signaling complex	IDA	11101870, 21803845
GO:0031265	Component	CD95 death-inducing signaling complex	IBA
GO:0031265	Component	CD95 death-inducing signaling complex	IDA	20935634
GO:0031265	Component	CD95 death-inducing signaling complex	IEA
GO:0032872	Process	Regulation of stress-activated MAPK cascade	IBA
GO:0032872	Process	Regulation of stress-activated MAPK cascade	IMP	11096076
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0034198	Process	Cellular response to amino acid starvation	IMP	11096076
GO:0036337	Process	Fas signaling pathway	IDA	12221075
GO:0036337	Process	Fas signaling pathway	IMP	11096076
GO:0038023	Function	Signaling receptor activity	NAS	7533181
GO:0038023	Function	Signaling receptor activity	TAS	1375228
GO:0042802	Function	Identical protein binding	IPI	7536190, 7538908, 21382479
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	NAS	7533181
GO:0043065	Process	Positive regulation of apoptotic process	IDA	21625644
GO:0043065	Process	Positive regulation of apoptotic process	IMP	20935634
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	7510905
GO:0045121	Component	Membrane raft	IBA
GO:0045121	Component	Membrane raft	IDA	21382479
GO:0045121	Component	Membrane raft	IEA
GO:0065003	Process	Protein-containing complex assembly	TAS	10875918
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071455	Process	Cellular response to hyperoxia	IMP	21382479
GO:0097049	Process	Motor neuron apoptotic process	IBA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IMP	22891283
GO:0097527	Process	Necroptotic signaling pathway	IBA
GO:0097527	Process	Necroptotic signaling pathway	IMP	16507998
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	IDA	12221075
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IMP	11096076

Other IDs

• MIM: 134637
• HGNC: 11920
• e!Ensembl: ENSG00000026103

Protein

• UniProt ID: P25445
• Protein name: Tumor necrosis factor receptor superfamily member 6 (Apo-1 antigen) (Apoptosis-mediating surface antigen FAS) (FASLG receptor) (CD antigen CD95)
• Protein function: Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase CASP8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs CASP8 proteolytic activation which initiates the subsequent cascade of caspases
• PDB: 1DDF , 2NA7 , 3EWT , 3EZQ , 3THM , 3TJE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00020	TNFR_c6	85 → 127	TNFR/NGFR cysteine-rich region	Domain
  PF00020	TNFR_c6	129 → 165	TNFR/NGFR cysteine-rich region	Domain
  PF00531	Death	230 → 314	Death domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 and isoform 6 are expressed at equal levels in resting peripheral blood mononuclear cells. After activation there is an increase in isoform 1 and decrease in the levels of isoform 6. {ECO:0000269|PubMed:7575433}.
• Sequence:

  MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCH
  KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCT
  RTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLL
  LLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVM
  TLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKK
  ANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV

• Sequence length: 335

Pathways

KEGG Pathway	Reactome Pathway
Platinum drug resistance	Caspase activation via Death Receptors in the presence of ligand
MAPK signaling pathway	Regulation by c-FLIP
Cytokine-cytokine receptor interaction	RIPK1-mediated regulated necrosis
p53 signaling pathway	CASP8 activity is inhibited
Apoptosis	TP53 Regulates Transcription of Death Receptors and Ligands
Necroptosis	Dimerization of procaspase-8
Natural killer cell mediated cytotoxicity	FasL/ CD95L signaling
TNF signaling pathway
Non-alcoholic fatty liver disease
Alcoholic liver disease
Type I diabetes mellitus
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Pathogenic Escherichia coli infection
Chagas disease
African trypanosomiasis
Hepatitis C
Hepatitis B
Measles
Human cytomegalovirus infection
Influenza A
Human papillomavirus infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Pathways in cancer
Proteoglycans in cancer
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Lipid and atherosclerosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal Show/Hide Causal Diseases (8)
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autoimmune lymphoproliferative syndrome type 1	Pathogenic; Likely pathogenic	rs121913086, rs2133515017, rs2133539468, rs2133547404, rs1589488640, rs121913080, rs2133384423, rs2119446366, rs2133472134, rs2119445224, rs2133503921, rs2133502090, rs866771343, rs2133504109, rs2133503091, rs2133529359, rs1564692984, rs2133527951, rs2119446096, rs2119445087, rs2495223270, rs2495225911, rs2495102207, rs2495121485, rs1404280764, rs2495160136, rs2495187032, rs28929498, rs2495226256, rs2495228618, rs2495155336, rs2495122596, rs2495184504, rs2119446879, rs886039524, rs2495021186, rs1435894576, rs1848491059, rs201072885, rs2495153923, rs2495225078, rs606231362, rs121913077, rs267607122, rs2495222321, rs1554851718, rs1564699214, rs1564686301, rs1564696849, rs1564691414, rs1589482683, rs1589488463, rs1589488494, rs1589465172, rs1589478691, rs1589485636, rs778993919, rs1842954041, rs1848315820, rs1207744817, rs1848558128, rs1848671126, rs1848675068, rs1848019699	RCV001379330 RCV001383293 RCV001383519 RCV001388141 RCV001382234 RCV001382235 RCV002573298 RCV001878381 RCV001928326 RCV001900407 RCV001987558 RCV001977467 RCV001949292 RCV001884965 RCV001993142 RCV002006613 RCV001939671 RCV002051252 RCV002262183 RCV003517361 RCV002305674 RCV002283777 RCV002464990 RCV003062287 RCV003062288 RCV003058262 RCV003062289 RCV003037351 RCV003037352 RCV003037353 RCV002825303 RCV002810783 RCV002863795 RCV003009179 RCV003011781 RCV003047954 RCV001382236 RCV003517918 RCV003518769 RCV003518770 RCV003518771 RCV003634587 RCV003819549 RCV003517125 RCV001071386 RCV002513090 RCV000638906 RCV001382233 RCV003885402 RCV001051234 RCV000701568 RCV000704333 RCV000695507 RCV000735216 RCV000797871 RCV000805931 RCV000822092 RCV000799837 RCV000853326 RCV000988430 RCV000988431 RCV000988432 RCV000988433 RCV001055690 RCV001071835 RCV001067936 RCV001050531 RCV001070775 RCV001067019 RCV001856272	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
AUTOIMMUNE LYMPHOPROLIFERATIVE SYNDROME, TYPE IA	Pathogenic	rs606231361, rs606231362, rs121913076, rs606231363, rs121913077, rs28929498, rs121913080, rs267607122, rs606231364, rs606231365, rs121913085, rs606231366, rs121913086	RCV000017961 RCV000017962 RCV000017963 RCV000017964 RCV000017965 RCV000017968 RCV000017969 RCV000017971 RCV000017972 RCV000017973 RCV000017977 RCV000017978 RCV000017979 RCV000017980	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
FAS-related disorder	Pathogenic	rs866771343	RCV003401971	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Inherited Immunodeficiency Diseases	Likely pathogenic; Pathogenic	rs778993919	RCV001027571	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Malignant lymphoma, large B-cell, diffuse	Pathogenic	rs1589488640	RCV005930303	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Splenomegaly	Likely pathogenic	rs1554851718	RCV000626571	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SQUAMOUS CELL CARCINOMA, BURN SCAR-RELATED, SOMATIC	Pathogenic	rs121913082, rs121913083, rs121913084	RCV000017974 RCV000017975 RCV000017976	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thyroid cancer, nonmedullary, 1	Likely pathogenic; Pathogenic	rs886039359	RCV005895436	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (70)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	26974007, 30946743	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES	—	CTD	22536412, 2545777, 26590112	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE LYMPHOPROLIFERATIVE SYNDROME	—	CTD, Disgenet, HPO, Orphanet CTD, Disgenet, HPO, Orphanet CTD, Disgenet, HPO, Orphanet CTD, Disgenet, HPO, Orphanet CTD, Disgenet, HPO, Orphanet	15877736, 17674358, 20301287, 21885602, 22983577, 7540117, 8929361, 10709732, 20360470, 39060684	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE LYMPHOPROLIFERATIVE SYNDROME TYPE 1, AUTOSOMAL DOMINANT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE LYMPHOPROLIFERATIVE SYNDROME TYPE 2B	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet disease	—	Orphanet	26136352	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	10716473, 10920071, 17943461	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	CTD, Disgenet CTD, Disgenet	17943461	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	23770605, 24292274, 26956414, 28165464, 39024449, 40883272	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	26974007	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	16123366	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Conflicting classifications of pathogenicity; Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL THORACIC AORTIC ANEURYSM AND AORTIC DISSECTION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAS-related autoimmune lymphoproliferative immune disorder	—	ClinGen	ClinGen report	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	CTD, Disgenet CTD, Disgenet	21880982, 36999444	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMATOLOGIC DISEASES	—	CTD	15877736	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMATOLOGICAL DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatoblastoma	Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	33106285	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	38555047	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	7579353	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKOCYTE DISORDERS	—	CTD, Disgenet CTD, Disgenet	38555047	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER FAILURE, ACUTE	—	CTD, Disgenet CTD, Disgenet	12828076	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	19654303	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	19654303	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	19654303	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	26192916	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	36999444	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	CTD, Disgenet CTD, Disgenet	33632240, 38555047	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOID LEUKEMIA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, LARGE B-CELL, DIFFUSE	—	CTD	26192916	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOPROLIFERATIVE SYNDROME 1	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOYAMOYA DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS, RELAPSING-REMITTING	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYASTHENIA GRAVIS	—	CTD, Disgenet CTD, Disgenet	15169653	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	15664267	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	23127599	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGOARTICULAR JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	23603761	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYARTICULAR JUVENILE IDIOPATHIC ARTHRITIS, RHEUMATOID FACTOR NEGATIVE	—	GWAS catalog	23603761	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROTEINURIA	—	CTD	26590112, 33632240, 36999444	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	26974007	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	26974007	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SELECTIVE IGA DEFICIENCY DISEASE	—	GWAS catalog	27723758	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPLENIC DISEASES	—	CTD, Disgenet CTD, Disgenet	38555047	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	19654303	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck	-	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	23603761	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	26974007	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	9070496	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEOMENINGOENCEPHALITIC SYNDROME	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION, LEFT	—	CTD	11809923	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VOGT-KOYANAGI-HARADA DISEASE	—	Orphanet	26136352	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

FASLG 6 shared diseasesDilated cardiomyopathy, Autoimmune disease, Autoimmune lymphoproliferative disorder, Cardiomyopathy, Liver failure, Lung neoplasms 30 shared pathwaysPlatinum drug resistance, MAPK signaling pathway, Cytokine-cytokine receptor interaction, Apoptosis, Necroptosis, Natural killer cell mediated cytotoxicity, Non-alcoholic fatty liver disease, Alcoholic liver disease, Type I diabetes mellitus, Pathogenic Escherichia coli infection, Chagas disease, African trypanosomiasis +18 more 15 shared evidence sourcesDisgenet (Autoimmune lymphoproliferative disorder), Orphanet (Autoimmune lymphoproliferative disorder), CTD (Autoimmune lymphoproliferative disorder), HPO (Autoimmune lymphoproliferative disorder), ClinVar (Autoimmune lymphoproliferative disorder), Disgenet (Cardiomyopathy), CTD (Cardiomyopathy), CTD (Dilated cardiomyopathy), Disgenet (Dilated cardiomyopathy), Disgenet (Diabetes mellitus type 2), CTD (Liver failure), Disgenet (Liver failure) +3 more Related via 30 shared pathways including Platinum drug resistance, MAPK signaling pathway — evidence mostly Disgenet. TNFRSF1A 4 shared diseasesAutoimmune disease, Behcet disease, Cystic fibrosis, Sclerosing cholangitis 16 shared pathwaysMAPK signaling pathway, Cytokine-cytokine receptor interaction, Apoptosis, Necroptosis, TNF signaling pathway, Non-alcoholic fatty liver disease, Alcoholic liver disease, Pathogenic Escherichia coli infection, Chagas disease, Hepatitis C, Human cytomegalovirus infection, Influenza A +4 more 10 shared evidence sourcesDisgenet (Ankylosing spondylitis), GWAS catalog (Ankylosing spondylitis), CTD (Autoimmune disease), Disgenet (Behcet disease), Disgenet (Cystic fibrosis), Disgenet (Diabetes mellitus type 2), CTD (Diabetes mellitus type 2), Disgenet (Multiple sclerosis), Disgenet (Rheumatoid arthritis), GWAS catalog (Sclerosing cholangitis) Related via 16 shared pathways including MAPK signaling pathway, Cytokine-cytokine receptor interaction — evidence mostly Disgenet. STAT3 10 shared diseasesMyeloid leukemia, Autoimmune disease, Behcet disease, Cardiomyopathy, Juvenile idiopathic arthritis, Oligoarticular juvenile idiopathic arthritis, Lung neoplasms, Lymphoproliferative syndrome, Sclerosing cholangitis, Urinary bladder neoplasms 9 shared pathwaysNecroptosis, Hepatitis C, Hepatitis B, Measles, Human cytomegalovirus infection, Kaposi sarcoma-associated herpesvirus infection, Epstein-Barr virus infection, Proteoglycans in cancer, Lipid and atherosclerosis 14 shared evidence sourcesDisgenet (Alzheimer disease), Disgenet (Ankylosing spondylitis), GWAS catalog (Ankylosing spondylitis), CTD (Autoimmune disease), Disgenet (Behcet disease), Disgenet (Cardiomyopathy), CTD (Cardiomyopathy), Disgenet (Diabetes mellitus type 2), CTD (Myeloid leukemia), CTD (Lung neoplasms), Disgenet (Lymphoproliferative syndrome), Disgenet (Rheumatoid arthritis) +2 more Related via 10 shared diseases including Myeloid leukemia, Autoimmune disease — evidence mostly Disgenet. CASP8 3 shared diseasesAutoimmune lymphoproliferative disorder, Lymphocytic leukemia, Lung neoplasms 25 shared pathwaysPlatinum drug resistance, p53 signaling pathway, Apoptosis, Necroptosis, TNF signaling pathway, Non-alcoholic fatty liver disease, Alcoholic liver disease, Pathogenic Escherichia coli infection, Chagas disease, Hepatitis C, Hepatitis B, Measles +13 more 8 shared evidence sourcesDisgenet (Autoimmune lymphoproliferative disorder), Orphanet (Autoimmune lymphoproliferative disorder), CTD (Autoimmune lymphoproliferative disorder), ClinVar (Autoimmune lymphoproliferative disorder), GWAS catalog (Lymphocytic leukemia), Disgenet (Diabetes mellitus type 2), CTD (Diabetes mellitus type 2), CTD (Lung neoplasms) Related via 25 shared pathways including Platinum drug resistance, p53 signaling pathway — evidence mostly CTD. IL2 9 shared diseasesBehcet disease, Glomerulonephritis, Juvenile idiopathic arthritis, Oligoarticular juvenile idiopathic arthritis, Lung neoplasms, Polyarticular juvenile idiopathic arthritis, Sclerosing cholangitis, Selective iga deficiency disease, Urinary bladder neoplasms 7 shared pathwaysCytokine-cytokine receptor interaction, Type I diabetes mellitus, Chagas disease, Measles, Autoimmune thyroid disease, Allograft rejection, Graft-versus-host disease 14 shared evidence sourcesDisgenet (Alzheimer disease), GWAS catalog (Ankylosing spondylitis), Disgenet (Systemic lupus erythematosus), Disgenet (Behcet disease), Disgenet (Glomerulonephritis), CTD (Glomerulonephritis), GWAS catalog (Juvenile idiopathic arthritis), CTD (Lung neoplasms), GWAS catalog (Oligoarticular juvenile idiopathic arthritis), GWAS catalog (Polyarticular juvenile idiopathic arthritis), Disgenet (Rheumatoid arthritis), GWAS catalog (Sclerosing cholangitis) +2 more Related via 9 shared diseases including Behcet disease, Glomerulonephritis — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
FASLG	6	["Dilated cardiomyopathy","Autoimmune disease","Autoimmune lymphoproliferative disorder","Cardiomyopathy","Liver failure","Lung neoplasms"]	30	["Platinum drug resistance","MAPK signaling pathway","Cytokine-cytokine receptor interaction","Apoptosis","Necroptosis","Natural killer cell mediated cytotoxicity","Non-alcoholic fatty liver disease","Alcoholic liver disease","Type I diabetes mellitus","Pathogenic Escherichia coli infection","Chagas disease","African trypanosomiasis"]	15	["Disgenet (Autoimmune lymphoproliferative disorder)","Orphanet (Autoimmune lymphoproliferative disorder)","CTD (Autoimmune lymphoproliferative disorder)","HPO (Autoimmune lymphoproliferative disorder)","ClinVar (Autoimmune lymphoproliferative disorder)","Disgenet (Cardiomyopathy)","CTD (Cardiomyopathy)","CTD (Dilated cardiomyopathy)","Disgenet (Dilated cardiomyopathy)","Disgenet (Diabetes mellitus type 2)","CTD (Liver failure)","Disgenet (Liver failure)"]
TNFRSF1A	4	["Autoimmune disease","Behcet disease","Cystic fibrosis","Sclerosing cholangitis"]	16	["MAPK signaling pathway","Cytokine-cytokine receptor interaction","Apoptosis","Necroptosis","TNF signaling pathway","Non-alcoholic fatty liver disease","Alcoholic liver disease","Pathogenic Escherichia coli infection","Chagas disease","Hepatitis C","Human cytomegalovirus infection","Influenza A"]	10	["Disgenet (Ankylosing spondylitis)","GWAS catalog (Ankylosing spondylitis)","CTD (Autoimmune disease)","Disgenet (Behcet disease)","Disgenet (Cystic fibrosis)","Disgenet (Diabetes mellitus type 2)","CTD (Diabetes mellitus type 2)","Disgenet (Multiple sclerosis)","Disgenet (Rheumatoid arthritis)","GWAS catalog (Sclerosing cholangitis)"]
STAT3	10	["Myeloid leukemia","Autoimmune disease","Behcet disease","Cardiomyopathy","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis","Lung neoplasms","Lymphoproliferative syndrome","Sclerosing cholangitis","Urinary bladder neoplasms"]	9	["Necroptosis","Hepatitis C","Hepatitis B","Measles","Human cytomegalovirus infection","Kaposi sarcoma-associated herpesvirus infection","Epstein-Barr virus infection","Proteoglycans in cancer","Lipid and atherosclerosis"]	14	["Disgenet (Alzheimer disease)","Disgenet (Ankylosing spondylitis)","GWAS catalog (Ankylosing spondylitis)","CTD (Autoimmune disease)","Disgenet (Behcet disease)","Disgenet (Cardiomyopathy)","CTD (Cardiomyopathy)","Disgenet (Diabetes mellitus type 2)","CTD (Myeloid leukemia)","CTD (Lung neoplasms)","Disgenet (Lymphoproliferative syndrome)","Disgenet (Rheumatoid arthritis)"]
CASP8	3	["Autoimmune lymphoproliferative disorder","Lymphocytic leukemia","Lung neoplasms"]	25	["Platinum drug resistance","p53 signaling pathway","Apoptosis","Necroptosis","TNF signaling pathway","Non-alcoholic fatty liver disease","Alcoholic liver disease","Pathogenic Escherichia coli infection","Chagas disease","Hepatitis C","Hepatitis B","Measles"]	8	["Disgenet (Autoimmune lymphoproliferative disorder)","Orphanet (Autoimmune lymphoproliferative disorder)","CTD (Autoimmune lymphoproliferative disorder)","ClinVar (Autoimmune lymphoproliferative disorder)","GWAS catalog (Lymphocytic leukemia)","Disgenet (Diabetes mellitus type 2)","CTD (Diabetes mellitus type 2)","CTD (Lung neoplasms)"]
IL2	9	["Behcet disease","Glomerulonephritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis","Lung neoplasms","Polyarticular juvenile idiopathic arthritis","Sclerosing cholangitis","Selective iga deficiency disease","Urinary bladder neoplasms"]	7	["Cytokine-cytokine receptor interaction","Type I diabetes mellitus","Chagas disease","Measles","Autoimmune thyroid disease","Allograft rejection","Graft-versus-host disease"]	14	["Disgenet (Alzheimer disease)","GWAS catalog (Ankylosing spondylitis)","Disgenet (Systemic lupus erythematosus)","Disgenet (Behcet disease)","Disgenet (Glomerulonephritis)","CTD (Glomerulonephritis)","GWAS catalog (Juvenile idiopathic arthritis)","CTD (Lung neoplasms)","GWAS catalog (Oligoarticular juvenile idiopathic arthritis)","GWAS catalog (Polyarticular juvenile idiopathic arthritis)","Disgenet (Rheumatoid arthritis)","GWAS catalog (Sclerosing cholangitis)"]

Diseases Linked via Similar Genes

Asthma Linked via 3 of 5 related genesFASLG, STAT3, IL2 Non-small-cell lung carcinoma Linked via 3 of 5 related genesFASLG, STAT3, CASP8 Melanoma Linked via 3 of 5 related genesFASLG, CASP8, IL2 Prostatic neoplasms Linked via 3 of 5 related genesFASLG, STAT3, IL2 Diabetes mellitus type 1 Linked via 3 of 5 related genesFASLG, STAT3, IL2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Asthma	3	["FASLG","STAT3","IL2"]
Non-small-cell lung carcinoma	3	["FASLG","STAT3","CASP8"]
Melanoma	3	["FASLG","CASP8","IL2"]
Prostatic neoplasms	3	["FASLG","STAT3","IL2"]
Diabetes mellitus type 1	3	["FASLG","STAT3","IL2"]