FASLG (Fas ligand)

Gene

• Entrez ID: 356
• Gene name: Fas ligand
• Gene symbol: FASLG
• Synonyms (NCBI Gene): ALPS1B, APT1LG1, APTL, CD178, CD95-L, CD95L, FASL, TNFSF6, TNLG1A
• Chromosome: 1
• Chromosome location: 1q24.3
• Summary: This gene is a member of the tumor necrosis factor superfamily. The primary function of the encoded transmembrane protein is the induction of apoptosis triggered by binding to FAS. The FAS/FASLG signaling pathway is essential for immune system regulation,

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs763110	C>T	Risk-factor	Upstream transcript variant
rs56302117	T>G	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, missense variant
rs80358236	TGCCTCTGGAATGGGAAGACACCTATGGAATTGTCCTGCTTTCTGGAGTGAAGTATAAGAAGGGTGGCCTTGTGATCAATGAAA>-	Pathogenic	3 prime UTR variant, inframe deletion, coding sequence variant
rs140406512	C>A,T	Conflicting-interpretations-of-pathogenicity	Intron variant, coding sequence variant, missense variant
rs201525996	A>G	Benign, conflicting-interpretations-of-pathogenicity	Intron variant
rs587776450	T>-	Pathogenic	Coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006989	hsa-miR-21-5p	Luciferase reporter assay, Western blot	21820586
MIRT006989	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	23177026
MIRT006989	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	23177026
MIRT029780	hsa-miR-26b-5p	Microarray	19088304
MIRT006989	hsa-miR-21-5p	Reporter assay;Western blot;Other	20371612
MIRT006989	hsa-miR-21-5p	Luciferase reporter assay, Western blot	23504349
MIRT006989	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	24821435
MIRT006989	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	24821435
MIRT006989	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	24821435
MIRT006989	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blot	24821435
MIRT006989	hsa-miR-21-5p	Luciferase reporter assay	25118289
MIRT006989	hsa-miR-21-5p	Luciferase reporter assay	25118289
MIRT006989	hsa-miR-21-5p	Luciferase reporter assay	25118289
MIRT006989	hsa-miR-21-5p	Luciferase reporter assay	25118289
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT658286	hsa-miR-485-3p	HITS-CLIP	23824327
MIRT658285	hsa-miR-539-3p	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT629088	hsa-miR-92a-3p	HITS-CLIP	23824327
MIRT629087	hsa-miR-367-3p	HITS-CLIP	23824327
MIRT629086	hsa-miR-92b-3p	HITS-CLIP	23824327
MIRT629085	hsa-miR-25-3p	HITS-CLIP	23824327
MIRT629084	hsa-miR-363-3p	HITS-CLIP	23824327
MIRT629083	hsa-miR-32-5p	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT629082	hsa-miR-7703	HITS-CLIP	23824327
MIRT629081	hsa-miR-4325	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT658286	hsa-miR-485-3p	HITS-CLIP	23824327
MIRT658285	hsa-miR-539-3p	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT658286	hsa-miR-485-3p	HITS-CLIP	23824327
MIRT658285	hsa-miR-539-3p	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT629088	hsa-miR-92a-3p	HITS-CLIP	23824327
MIRT629087	hsa-miR-367-3p	HITS-CLIP	23824327
MIRT629086	hsa-miR-92b-3p	HITS-CLIP	23824327
MIRT629085	hsa-miR-25-3p	HITS-CLIP	23824327
MIRT629084	hsa-miR-363-3p	HITS-CLIP	23824327
MIRT629083	hsa-miR-32-5p	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT629082	hsa-miR-7703	HITS-CLIP	23824327
MIRT629081	hsa-miR-4325	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT737672	hsa-let-7e-5p	Luciferase reporter assay	26826505
MIRT731263	hsa-let-7e-5p	Luciferase reporter assay	26826505
MIRT731263	hsa-let-7e-5p	Luciferase reporter assay	26826505
MIRT731263	hsa-let-7e-5p	Luciferase reporter assay	26826505
MIRT731263	hsa-let-7e-5p	Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	33168041
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT658286	hsa-miR-485-3p	HITS-CLIP	23824327
MIRT658285	hsa-miR-539-3p	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT629088	hsa-miR-92a-3p	HITS-CLIP	23824327
MIRT629087	hsa-miR-367-3p	HITS-CLIP	23824327
MIRT629086	hsa-miR-92b-3p	HITS-CLIP	23824327
MIRT629085	hsa-miR-25-3p	HITS-CLIP	23824327
MIRT629084	hsa-miR-363-3p	HITS-CLIP	23824327
MIRT629083	hsa-miR-32-5p	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT629082	hsa-miR-7703	HITS-CLIP	23824327
MIRT629081	hsa-miR-4325	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT658286	hsa-miR-485-3p	HITS-CLIP	23824327
MIRT658285	hsa-miR-539-3p	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT658286	hsa-miR-485-3p	HITS-CLIP	23824327
MIRT658285	hsa-miR-539-3p	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT629088	hsa-miR-92a-3p	HITS-CLIP	23824327
MIRT629087	hsa-miR-367-3p	HITS-CLIP	23824327
MIRT629086	hsa-miR-92b-3p	HITS-CLIP	23824327
MIRT629085	hsa-miR-25-3p	HITS-CLIP	23824327
MIRT629084	hsa-miR-363-3p	HITS-CLIP	23824327
MIRT629083	hsa-miR-32-5p	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT629082	hsa-miR-7703	HITS-CLIP	23824327
MIRT629081	hsa-miR-4325	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT611045	hsa-miR-7849-3p	HITS-CLIP	23824327
MIRT611044	hsa-miR-8485	HITS-CLIP	23824327
MIRT611043	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611042	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611041	hsa-miR-603	HITS-CLIP	23824327
MIRT611040	hsa-miR-5195-5p	HITS-CLIP	23824327
MIRT611039	hsa-miR-3941	HITS-CLIP	23824327
MIRT737677	hsa-let-7a	CLIP-seq
MIRT737678	hsa-let-7b	CLIP-seq
MIRT737679	hsa-let-7c	CLIP-seq
MIRT737680	hsa-let-7d	CLIP-seq
MIRT737672	hsa-let-7e	CLIP-seq
MIRT737681	hsa-let-7f	CLIP-seq
MIRT737675	hsa-let-7g	CLIP-seq
MIRT737674	hsa-let-7i	CLIP-seq
MIRT737683	hsa-miR-1224-3p	CLIP-seq
MIRT989499	hsa-miR-329	CLIP-seq
MIRT737684	hsa-miR-3922-5p	CLIP-seq
MIRT737676	hsa-miR-4458	CLIP-seq
MIRT737673	hsa-miR-4500	CLIP-seq
MIRT737686	hsa-miR-451b	CLIP-seq
MIRT737685	hsa-miR-4708-3p	CLIP-seq
MIRT737682	hsa-miR-98	CLIP-seq
MIRT989499	hsa-miR-329	CLIP-seq
MIRT1993283	hsa-miR-105	CLIP-seq
MIRT989499	hsa-miR-329	CLIP-seq
MIRT2227116	hsa-miR-25	CLIP-seq
MIRT2227117	hsa-miR-32	CLIP-seq
MIRT989499	hsa-miR-329	CLIP-seq
MIRT2227118	hsa-miR-363	CLIP-seq
MIRT2227119	hsa-miR-367	CLIP-seq
MIRT2227120	hsa-miR-92a	CLIP-seq
MIRT2227121	hsa-miR-92b	CLIP-seq
MIRT2227116	hsa-miR-25	CLIP-seq
MIRT2227117	hsa-miR-32	CLIP-seq
MIRT2227118	hsa-miR-363	CLIP-seq
MIRT2227119	hsa-miR-367	CLIP-seq
MIRT2428744	hsa-miR-875-3p	CLIP-seq
MIRT2227120	hsa-miR-92a	CLIP-seq
MIRT2227121	hsa-miR-92b	CLIP-seq
MIRT989499	hsa-miR-329	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF2	Unknown	19670268;9710625
CEBPB	Unknown	12496392
CIITA	Unknown	14563113
CREM	Repression	11754361
EGR1	Unknown	14563113
EGR2	Repression	19651900
FOXO3	Activation	11756562
IRF1	Unknown	14563113
JUN	Unknown	14563113;19670268;9710625
MAX	Unknown	10734130
MYC	Activation	12655294
MYC	Unknown	10734130;14563113
NFKB1	Activation	12655294;16770006
NFKB1	Unknown	10671224;14563113;15160330
NR4A1	Unknown	14563113
PDCD11	Unknown	14563113
PPARG	Activation	18293083
RELA	Activation	12655294;16770006
RELA	Unknown	10671224;14563113;15160330
SP1	Activation	12655294
SP1	Unknown	14563113;15004200

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	17557115
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	TAS	7826947
GO:0005123	Function	Death receptor binding	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	9333124
GO:0005125	Function	Cytokine activity	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	12198154, 12887920, 16318909, 16498403, 16595635, 17761170, 19807924, 21803845, 24025841, 25241761, 25416956, 26871637, 28514442, 32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9228058
GO:0005615	Component	Extracellular space	IDA	18835034
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IDA	17557115
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005886	Component	Plasma membrane	IDA	12201652
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7826947
GO:0005901	Component	Caveola	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	8787672
GO:0006925	Process	Inflammatory cell apoptotic process	IEA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	7826947
GO:0007267	Process	Cell-cell signaling	TAS	7826947
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IBA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	9184224, 9333124, 26582200
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	18835034
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IDA	18835034
GO:0030644	Process	Intracellular chloride ion homeostasis	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	14749367
GO:0043065	Process	Positive regulation of apoptotic process	IDA	21625644
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043202	Component	Lysosomal lumen	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IEA
GO:0046666	Process	Retinal cell programmed cell death	IEA
GO:0048388	Process	Endosomal lumen acidification	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0060205	Component	Cytoplasmic vesicle lumen	IEA
GO:0070062	Component	Extracellular exosome	IDA	17076679
GO:0070231	Process	T cell apoptotic process	IDA	17076679
GO:0070266	Process	Necroptotic process	IDA	11101870
GO:0070848	Process	Response to growth factor	IEA
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0097190	Process	Apoptotic signaling pathway	IDA	11101870
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0097190	Process	Apoptotic signaling pathway	IMP	18293083
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	22891283
GO:0097527	Process	Necroptotic signaling pathway	IDA	11101870
GO:1903514	Process	Release of sequestered calcium ion into cytosol by endoplasmic reticulum	IDA	26582200
GO:1905782	Process	Positive regulation of phosphatidylserine exposure on apoptotic cell surface	IDA	24904167
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IDA	18835034
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IBA

Other IDs

• MIM: 134638
• HGNC: 11936
• e!Ensembl: ENSG00000117560

Protein

• UniProt ID: P48023
• Protein name: Tumor necrosis factor ligand superfamily member 6 (Apoptosis antigen ligand) (APTL) (CD95 ligand) (CD95-L) (Fas antigen ligand) (Fas ligand) (FasL) (CD antigen CD178) [Cleaved into: Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor n
• Protein function: Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells (PubMed:26334989, PubMed:9228058). Involved in cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development (
• PDB: 4MSV, 5L19, 5L36
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00229	TNF	160 → 281	TNF(Tumour Necrosis Factor) family	Domain

• Sequence:

  MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPP
  PPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQ
  MHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGG
  LVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWA
  RSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

• Sequence length: 281

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autoimmune lymphoproliferative syndrome type 1	Likely pathogenic; Pathogenic	rs1413244355, rs773045347, rs2527587918, rs80358236	RCV001789806 RCV001948225 RCV003517699 RCV001789750	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
AUTOIMMUNE LYMPHOPROLIFERATIVE SYNDROME, TYPE IB	Pathogenic	rs80358236	RCV000017959	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lung cancer	Likely pathogenic	rs1413244355	RCV004820889	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE LYMPHOPROLIFERATIVE SYNDROME	—	CTD, Disgenet, HPO, Orphanet CTD, Disgenet, HPO, Orphanet CTD, Disgenet, HPO, Orphanet CTD, Disgenet, HPO, Orphanet CTD, Disgenet, HPO, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE LYMPHOPROLIFERATIVE SYNDROME TYPE 1, AUTOSOMAL DOMINANT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE LYMPHOPROLIFERATIVE SYNDROME TYPE 2B	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC PERSISTENT HEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC ANGIOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC PERIPHERAL ANGIOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FASLG-related disorder	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA, FAMILIAL COMBINED	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunodeficiency 98 with autoinflammation, X-linked	Benign; Likely benign	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
LIVER FAILURE, ACUTE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER, SUSCEPTIBILITY TO	risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acral Lentiginous Malignant Melanoma	Acral Lentiginous Malignant Melanoma	BEFREE	11603392		★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	11442750		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	17853317		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	17853317		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	15659839, 22585600		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	20074157, 21390183		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	21390183		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10547600		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	9683272		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	20706274		★☆☆☆☆ Found in Text Mining only
Aicardi Goutieres syndrome	Aicardi goutieres syndrome	Pubtator	30597845	Associate	★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	20394629		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	20394629		★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	22252758	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	20643858	Stimulate	★☆☆☆☆ Found in Text Mining only
Anaphylaxis	Anaphylaxis	Pubtator	30189430	Inhibit	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	10547600		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	10203105, 11222356, 11830480, 32628088	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	11830480		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	11564081, 12404285	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	10203105	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	11849855	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30428004		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	LHGDN	16212902		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	29611722		★☆☆☆☆ Found in Text Mining only
Aplastic anemia, idiopathic	Anemia	BEFREE	29611722		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	26374830	Associate	★☆☆☆☆ Found in Text Mining only
Arterial Diseases, Common Carotid	Moyamoya disease	CTD_human_DG	15063428		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	22687048	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	20462799	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12746897, 14691302, 15457448, 17459170, 19196465, 23918525, 9333124, 9764613, 9767455	Associate	★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	Pubtator	22252758	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11207646		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	12393263		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	24603338	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	11407740, 11786516, 17053166	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	15063428		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	15178561		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrophy	Atrophy	Pubtator	18383830	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	20394629		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10494037, 12353035, 12559631, 28424702, 29611722, 31618754, 31850658, 9278296, 9609991, 9922038		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	10632670, 12149230, 12496392, 16108814, 16180659, 23850805, 28250925	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	15457562, 16902496		★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	BEFREE	11380411, 16627752, 17605793, 17999750, 20162683, 21109225, 26334989, 27060458, 9136951		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	11380411, 15870181, 17062728, 17605793, 19176318, 22857792, 26113417, 27060458, 32599613, 33995372, 34438083, 35628184, 37838774, 9845544	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	ORPHANET_DG	16627752, 17605793		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune lymphoproliferative syndrome	Autoimmune Lymphoproliferative Disorder	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	UNIPROT_DG	26334989, 8787672		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	GENOMICS_ENGLAND_DG	27848183		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	9136951	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Lymphoproliferative Syndrome Type 1, Autosomal Dominant	Lymphoproliferative Disorder	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Lymphoproliferative Syndrome Type 2B	Autoimmune Lymphoproliferative Disorder	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Lymphoproliferative Syndrome, Type IA	Autoimmune Lymphoproliferative Disorder	BEFREE	15870181		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome, Type IB	Autoimmune Lymphoproliferative Disorder	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Azoospermia	Azoospermia	BEFREE	11749796, 19146781, 24665877		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	11697638		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	11049999		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	21390183		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	12403936		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	16237110	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15514684, 16538171, 23948181, 24815844, 29453645		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	16538171		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	34741638	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	10440912, 9333124	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	9792306	Associate	★☆☆☆☆ Found in Text Mining only
Bowen's Disease		Pubtator	12089736	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	11584892		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	20501759, 26858129, 8878461, 9217971	Associate	★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	24094130		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10547600, 10640988, 10651943, 17183065, 22732091, 23326385, 24248546, 24408012		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10391843, 10651943, 11070347, 11571297, 12223126, 14982861, 17352235, 19341712, 21069948, 22842170, 22909995, 23326385, 24289581, 24916571, 25472583, 27524883, 29185091, 32143617, 35864548, 36766731, 37334575, 38041032	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	15196254	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	37569852	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11477113, 15937082, 16004605, 16091761, 16224150, 20222173, 22022540, 23280017, 26617948	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10817504, 26232338		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	11005209	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	12089736	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	12787140, 16638418, 9389732	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	22842170	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	19015953	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10735508, 14669310, 15849812, 15849828, 16080799, 16273601, 16419152, 24761872, 25596532, 27431384, 28246474, 30085405, 35283421, 9353266	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	18469794	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15514684, 16538171, 23948181, 24815844, 29453645		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12466971, 15937082, 17014925, 18757527		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	10817504, 17465232, 22161157	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10782148, 10944605, 12460460, 12941126, 17132225, 31097685, 35165523, 39465721	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11442750, 12089736, 15698511, 16456813, 21808135, 25976983	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	12651606	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	15660112, 9421463		★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23234803, 31537619		★☆☆☆☆ Found in Text Mining only
Cardiofaciocutaneous syndrome	Cardiofaciocutaneous syndrome	Pubtator	12404285	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	17966039	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	17966039	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	16324756, 17943461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	LHGDN	17943461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	16324756, 17943461		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	CTD_human_DG	17943461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	CTD_human_DG	17943461		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	15063428		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	Pubtator	15063428	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Atherosclerosis	Carotid Atherosclerosis	CTD_human_DG	15063428		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	LHGDN	14739407		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	26859134	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	BEFREE	10224298		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	18068525, 24375196, 24619598, 27790710		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18068525, 24375196, 24619598, 27790710		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22211869		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	9683272		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	11854917, 29089545	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	20101459		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	29089545	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11049999		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	15339846		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	28261298		★☆☆☆☆ Found in Text Mining only
Coffin-Siris syndrome	Coffin-Siris Syndrome	BEFREE	10487849		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26374830	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	31330513, 8686766	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15004200, 16957513, 28300842		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	10567875, 10744679, 11477113, 11592778, 12865931, 14614330, 16273638, 18648368, 20039457, 9177233, 9223329	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12137598, 15962391, 15991293, 16273638		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11927015, 15138115		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10079247, 10098769, 11592778, 11927015, 12610520, 14520470, 15004200, 15274324, 15962391, 15991293, 16273638, 18648368, 19067240, 21071349, 22022540, 23615374, 26211005, 26759270, 28300842, 28929494, 29684585, 30016783, 30214631, 31796117, 9895372	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	11067949		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16000573, 16474169, 17559541		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	19067240	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital contractural arachnodactyly	Pubtator	29089545	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	30569262		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	21935395		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20572163, 31097685		★☆☆☆☆ Found in Text Mining only
Coombs positive hemolytic anemia	Coombs Positive Hemolytic Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21297489		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	34777632	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30569262		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	22860894		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26374830	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28785150	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	16538172		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	10567629	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	31416448		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	18078642		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	26186532		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	16858424, 21430507	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	30254289		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	11091268	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	12542799, 30286163	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	33318199	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	16388717, 22778762	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	30286163		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	9421463		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23335850	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24172699	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	16180659	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22519592, 9334358	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24178789, 30024959	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11845233, 16180659		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16691186		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Angiopathies	Diabetic cardiomyopathy	CTD_human_DG	25381014		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DiGeorge Syndrome	Digeorge syndrome	Pubtator	9697985	Associate	★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	24690069, 30066360, 30606056		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	16858424, 17977827	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	30286163		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	17822550	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	23639073	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10817504, 25472583		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	12372468		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15806311, 16687653		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	31566051	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	30443253		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	27006531	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23234803		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24473454, 26819081, 9605741		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	16186185, 16425431, 24473454, 26819081	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24473454, 9605741		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	19728877, 24473454	Associate	★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	16412052	Associate	★☆☆☆☆ Found in Text Mining only
External Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	15063428		★☆☆☆☆ Found in Text Mining only
Fibroadenoma of breast	Fibroadenoma Of Breast	HPO_DG			★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	29137483		★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	25169582		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	25169582	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	24587306		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	15968727	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	20074157		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	10691918, 9788963	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	18383830		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	25333257	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	18941456	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	12466128, 19375652	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	20074157, 21148629		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	8889553	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	LHGDN	18057579		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11092528, 11883844, 24130787, 24561085, 9217971	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18328427, 25394756, 25850884, 29453321, 30939793, 31564969		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18328427, 25394756, 25850884, 29453321, 30939793, 31564969		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10203695, 10435616, 10980594, 11307620, 11313826, 9811463		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10780669, 11522296, 11770895, 11883844, 22060015, 24130787, 25556484, 29164574, 8878461, 9111585, 9217971, 9409814, 9472635	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12629150, 15358139		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	29137483	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	10999463	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	10192442, 14993881, 21430507	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	10192442		★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	9645360	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	10443697, 11101869, 12559631		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	LHGDN	18162459, 18324486		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	18324486, 19008632, 33912135	Associate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	29432441		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	11005209, 12480911, 18324486	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	11101869, 27572459		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	LHGDN	12559631, 18324486		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	16219172	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	16543918, 17426710, 21504271, 29419701		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	38200037	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Disorders	Headache	Pubtator	32628088	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	22790687	Associate	★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	LHGDN	14988839		★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	30066360		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	11549589	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	11697638		★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	10540162, 22449797, 27243827	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	15457575	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	LHGDN	14602201		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10355962		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	15096587, 9533769	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis	Hydrops Fetalis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperlipidemia Familial Combined	Hyperlipidemia	Pubtator	15063428	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	CTD_human_DG	15063428		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	Pubtator	17605793	Associate	★☆☆☆☆ Found in Text Mining only
Hypersplenism	Hypersplenism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17853317		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35875936	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	10946867		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	11334117, 27218286	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	22252758	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	9870917		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	18650480, 29137483		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	HPO_DG			★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26374830	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	24178789, 30024959	Associate	★☆☆☆☆ Found in Text Mining only
Internal Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	15063428		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	23205884		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	23801893	Inhibit	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	24228099, 32143617	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	23141929	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	18383830	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	18473402	Associate	★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	25169582		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	25169582	Associate	★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	16304056		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	33415169	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	23618817		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	16978419	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10075697, 10517493, 10556200, 28537657	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10607716, 15694838, 28537657, 9136951		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	16595663, 17123604		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	10556200	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10517493, 10556200, 10812243, 22183068, 28013316, 9012700	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	11698395, 11918536	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	10807792, 9845544		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20438363, 30828789		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	22306364		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	20359312		★☆☆☆☆ Found in Text Mining only
Lhermitte-Duclos disease	Lhermitte-Duclos disease	BEFREE	21806408		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	20359312, 23153021		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	14669310, 15849828		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19567199, 26891954, 8946836		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	24759184	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	27243827	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	7595193	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	10540162, 28410274	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	29374146		★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	CTD_human_DG	19505222		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure, Acute	Liver failure	BEFREE	29374146		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lumbar disc disease	Lumbar Disc Disease	BEFREE	21806408		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	12414525, 15833141, 26617708, 36119078	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	27682872		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	22252758	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15302589, 15937082, 17704746		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	15937082, 16186185, 17708363, 18757527, 24128051, 31978067	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	15674374, 18650480		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	16638418, 26261624	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10632670, 10643709, 11905854, 12421989, 12496392, 20529085, 24348139, 8787672, 9344329	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19644848, 26261624, 33198645	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	15674374, 18650480		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10643709, 15674374, 16163374, 18069935, 18650480, 20394629, 27050822, 27438772, 28078588, 29021794, 8787672		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	12421989, 16808908		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	11905854	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	LHGDN	15480896		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	15674374, 18650480		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15962391, 23534738, 26400345	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23280017, 25596086, 27524883	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10595932, 11046041, 16494623, 17210689, 33168041, 33513976	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	17545588, 20162683, 26334989, 9278296		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17545588		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	10782148, 33168041	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	12780524		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	12780524		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	LHGDN	15816832		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	12149230, 17966039, 8787672	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	LHGDN	15492869		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	8643610, 9609991		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	23639073	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10435616, 11146447, 11289159, 11770895, 9670853		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	16543918, 17426710, 21504271, 29419701		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10547600, 10651943, 17183065, 22732091, 23326385, 24248546, 24408012		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	15937082, 24473454, 9605741		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	24587306		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12466971, 15937082, 17014925, 18757527		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	20359312, 23153021, 25944167		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31537619		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11345135		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11708878, 12601398, 21557277		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17875776		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19565204, 21864388, 22631677, 23681795		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	25944167		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15514684, 16538171, 23948181, 24815844, 29453645		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10547600, 10933980, 11067949, 11307620, 11321235, 11927015, 16538171, 17000697, 17183065, 17545588, 17961631, 19337311, 19403301, 19565204, 21390183, 22211869, 22732091, 23205884, 24014103, 24086353, 24598538, 24690893, 25656654, 25661359, 28078578, 28078596, 28273453, 29063830, 31564969, 9284765, 9391118, 9922038		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	18068525, 24375196, 24619598, 27790710		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15004200, 16957513, 28300842		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10547600		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14977837, 17183065, 17962219		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	9683272		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10383736, 10802053, 11121134, 11369232, 11511316, 12021310, 12177809, 12610520, 15654977, 15930731, 16306044, 16487513, 17545621, 19725869, 24862567, 38307835, 9892185	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	11603392, 14668794, 15654977, 19725869, 26355347, 30932943		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	14668794, 15093732, 16538172		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	16487513		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	17342088	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	37401304	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	26186532		★☆☆☆☆ Found in Text Mining only
Microangiopathy, Diabetic	Diabetic cardiomyopathy	CTD_human_DG	25381014		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	34852799	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	12021310, 21808135, 24337492, 25634589	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11222356, 11830480, 12823344, 37138866, 9207432, 9822274, 9916933	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	11830480		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	9922038		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11438180		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	12694389, 21437244, 25950471, 26407760, 8879222	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	12742662		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	28008595	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	12576232		★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	22723941	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	20476668	Stimulate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30939793		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	12404285	Stimulate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	9792306	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	12513781		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	26563376		★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	16324756, 17943461		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	11849855, 11970950, 14711179	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	27323110		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	19740320	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	21414848	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	15330177, 24194922	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20842669		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10353760, 10547600, 10556200, 10933980, 11001528, 11121134, 11603392, 11640888, 11772948, 11927015, 12780524, 15272306, 15733832, 15897249, 16304056, 16538171, 17183065, 17786316, 17961631, 18328427, 19287191, 19567199, 21390183, 22732091, 23497165, 23894399, 24780723, 26858129, 29021794, 31537619, 9018234, 9284765, 9421463, 9683272		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	23832418		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	LHGDN	14739003		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10453076, 19944115, 23951214, 9278296, 9288794		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	21298033, 23951214	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	10807792, 12480700, 18819843, 31467122, 9136951	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18757527, 19240174, 21807637, 29079711		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	21807637		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24178789	Associate	★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	11749796, 19146781		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	20359312		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	25976983	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	12932288, 25807424	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	12932288	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	23392773		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29845202		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	19066961	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	20819644, 30065912		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12637505		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31537619		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10780525, 12637505, 12725530, 15662527, 17465232, 17667919, 19959214, 22161157, 23076876, 31537619, 39608974, 9616229	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11345135		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12490654, 18483392		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10714630, 11115536, 11310825, 12173320, 19664137, 32606315	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	32606315	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	11310825, 11889077	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	11310825		★☆☆☆☆ Found in Text Mining only
Panniculitis	Panniculitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	17598974, 25824544		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	26458812	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	12787425	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35393909	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	29068570		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	HPO_DG			★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	11394648		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11708878, 12601398, 21557277		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	12124829	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11020350, 17295927, 19055752, 29211704, 33326414, 38087324	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17875776		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	9421463		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17118637, 33260035	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	12414525, 26617708	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30109946		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	24903614	Associate	★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	25501066	Stimulate	★☆☆☆☆ Found in Text Mining only
RAS-ASSOCIATED AUTOIMMUNE LEUKOPROLIFERATIVE DISORDER	Autoimmune Leukoproliferative Disorder	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20572163		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	LHGDN	12414525		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	15161631		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	15378505, 27625332	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	23191987	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18078642		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	20008919		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21879377, 23749041, 25645050		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	Pubtator	26376720	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	22252758	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	26376720	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	11549589, 18506556	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	17695539, 22382690, 9846984	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	BEFREE	18074150		★☆☆☆☆ Found in Text Mining only
SCAPULOPERONEAL MYOPATHY, X-LINKED DOMINANT	Scapuloperoneal Myopathy, X-Linked	BEFREE	20501759, 26858129		★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	18577653		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	LHGDN	12583439		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	11039936		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	24938700		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	18314443, 21270445	Associate	★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	17966039		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	11204278, 12100038, 12528117, 17966039, 37353767, 9764611, 9844061	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	17966039	Inhibit	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	12787140	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	21430507	Inhibit	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	8652825	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12466971		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	29960293	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11442750, 15996722		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15907374		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24473454		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	15039212, 18547033, 20501759, 23534738, 23894399, 26400345, 27628319, 32628088, 37798436	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	23894399		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	25976983		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16543918, 17000697, 20501759		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	23618817		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	21297489		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	LHGDN	12707034		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	BEFREE	18577653		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15948252, 19565204, 21864388, 22631677, 23681795		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	10858249, 14595120, 18383830	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11206267, 12854132, 15991280, 18383830, 20193111, 20222173, 21526501, 26393583, 26617948, 28627601, 34957697, 36124496, 9895372	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	11895550, 12854132, 18561948		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	17966039		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	17966039		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	11407740	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	20889682		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Testicular Diseases	CTD_human_DG	19429229		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Testicular Diseases	Testicular Diseases	BEFREE	31476926		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Testicular Neoplasms	Testicular neoplasm	Pubtator	21509038	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	29068570		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	LHGDN	18505906		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17598974		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	11005209	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	11675676, 19008632	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	16219172	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	18577653		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27367565		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	16101181, 22517918, 23948181	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Tract Infections	Urinary tract infection	Pubtator	16918537	Stimulate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	16456813	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	17433060	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	16186185, 16456813, 21119362, 23076876, 23280017, 26345794, 26458812, 32212814	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	31618754		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	20165911		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	18548110		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	Pubtator	18548110, 34107850	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	18548110		★☆☆☆☆ Found in Text Mining only