Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	841
Gene name	Caspase 8
Gene symbol	CASP8
Synonyms (NCBI Gene)	ALPS2BCAP4Casp-8FLICEMACHMCH5
Chromosome	2
Chromosome location	2q33.1
Summary	This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain, a large pro

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs17860424	C>T	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs587776665	GT>-	Pathogenic	Downstream transcript variant, genic downstream transcript variant, frameshift variant, non coding transcript variant, coding sequence variant

374

Show/Hide all (374)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005293	hsa-let-7a-5p	Western blot	18758960
MIRT006278	hsa-miR-19b-1-5p	Luciferase reporter assay	22197821
MIRT006278	hsa-miR-19b-1-5p	Luciferase reporter assay	22197821
MIRT006278	hsa-miR-19b-1-5p	Luciferase reporter assay	22197821
MIRT029158	hsa-miR-26b-5p	Microarray	19088304
MIRT204830	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT204830	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT204830	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT204830	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT204830	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT204830	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT204830	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT204830	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT682669	hsa-miR-6808-5p	HITS-CLIP	23706177
MIRT682668	hsa-miR-6893-5p	HITS-CLIP	23706177
MIRT682667	hsa-miR-940	HITS-CLIP	23706177
MIRT682666	hsa-miR-3929	HITS-CLIP	23706177
MIRT682665	hsa-miR-4419b	HITS-CLIP	23706177
MIRT682664	hsa-miR-4478	HITS-CLIP	23706177
MIRT682663	hsa-miR-4768-3p	HITS-CLIP	23706177
MIRT682662	hsa-miR-6746-5p	HITS-CLIP	23706177
MIRT682661	hsa-miR-4649-3p	HITS-CLIP	23706177
MIRT682660	hsa-miR-1827	HITS-CLIP	23706177
MIRT682659	hsa-miR-485-5p	HITS-CLIP	23706177
MIRT682658	hsa-miR-6884-5p	HITS-CLIP	23706177
MIRT682657	hsa-miR-4722-5p	HITS-CLIP	23706177
MIRT682656	hsa-miR-7160-5p	HITS-CLIP	23706177
MIRT682655	hsa-miR-6735-3p	HITS-CLIP	23706177
MIRT682654	hsa-miR-6771-5p	HITS-CLIP	23706177
MIRT682653	hsa-miR-665	HITS-CLIP	23706177
MIRT527678	hsa-miR-495-3p	PAR-CLIP	22012620
MIRT527677	hsa-miR-5688	PAR-CLIP	22012620
MIRT527676	hsa-miR-29a-3p	PAR-CLIP	22012620
MIRT527675	hsa-miR-29b-3p	PAR-CLIP	22012620
MIRT527674	hsa-miR-29c-3p	PAR-CLIP	22012620
MIRT527673	hsa-miR-6871-3p	PAR-CLIP	22012620
MIRT527672	hsa-miR-767-5p	PAR-CLIP	22012620
MIRT527671	hsa-miR-5682	PAR-CLIP	22012620
MIRT731940	hsa-miR-376a-3p	Luciferase reporter assayqRT-PCRWestern blot	27979415
MIRT731940	hsa-miR-376a-3p	Luciferase reporter assayqRT-PCRWestern blot	27979415
MIRT731940	hsa-miR-376a-3p	PAR-CLIP	27292025
MIRT733649	hsa-miR-149-5p	qRT-PCR	34051087
MIRT733649	hsa-miR-149-5p	qRT-PCR	34051087
MIRT735255	hsa-miR-21-3p	MicroarrayqRT-PCR	32407273
MIRT736406	hsa-miR-491-3p	qRT-PCRFlow cytometry	33679688
MIRT682669	hsa-miR-6808-5p	HITS-CLIP	23706177
MIRT682668	hsa-miR-6893-5p	HITS-CLIP	23706177
MIRT682667	hsa-miR-940	HITS-CLIP	23706177
MIRT682666	hsa-miR-3929	HITS-CLIP	23706177
MIRT682665	hsa-miR-4419b	HITS-CLIP	23706177
MIRT682664	hsa-miR-4478	HITS-CLIP	23706177
MIRT682663	hsa-miR-4768-3p	HITS-CLIP	23706177
MIRT682662	hsa-miR-6746-5p	HITS-CLIP	23706177
MIRT682661	hsa-miR-4649-3p	HITS-CLIP	23706177
MIRT682660	hsa-miR-1827	HITS-CLIP	23706177
MIRT682659	hsa-miR-485-5p	HITS-CLIP	23706177
MIRT682658	hsa-miR-6884-5p	HITS-CLIP	23706177
MIRT682657	hsa-miR-4722-5p	HITS-CLIP	23706177
MIRT682656	hsa-miR-7160-5p	HITS-CLIP	23706177
MIRT682655	hsa-miR-6735-3p	HITS-CLIP	23706177
MIRT682654	hsa-miR-6771-5p	HITS-CLIP	23706177
MIRT682653	hsa-miR-665	HITS-CLIP	23706177
MIRT527678	hsa-miR-495-3p	PAR-CLIP	22012620
MIRT527677	hsa-miR-5688	PAR-CLIP	22012620
MIRT527676	hsa-miR-29a-3p	PAR-CLIP	22012620
MIRT527675	hsa-miR-29b-3p	PAR-CLIP	22012620
MIRT527674	hsa-miR-29c-3p	PAR-CLIP	22012620
MIRT527673	hsa-miR-6871-3p	PAR-CLIP	22012620
MIRT527672	hsa-miR-767-5p	PAR-CLIP	22012620
MIRT527671	hsa-miR-5682	PAR-CLIP	22012620
MIRT755543	hsa-miR-181c-5p	Western blottingqRT-PCR	36676955
MIRT864185	hsa-miR-1184	CLIP-seq
MIRT864186	hsa-miR-1226	CLIP-seq
MIRT864187	hsa-miR-1231	CLIP-seq
MIRT864188	hsa-miR-1273	CLIP-seq
MIRT864189	hsa-miR-1293	CLIP-seq
MIRT864190	hsa-miR-137	CLIP-seq
MIRT864191	hsa-miR-192	CLIP-seq
MIRT864192	hsa-miR-215	CLIP-seq
MIRT864193	hsa-miR-24	CLIP-seq
MIRT864194	hsa-miR-3064-3p	CLIP-seq
MIRT864195	hsa-miR-3122	CLIP-seq
MIRT864196	hsa-miR-3689a-3p	CLIP-seq
MIRT864197	hsa-miR-3689c	CLIP-seq
MIRT864198	hsa-miR-3913-5p	CLIP-seq
MIRT864199	hsa-miR-3940-5p	CLIP-seq
MIRT864200	hsa-miR-4252	CLIP-seq
MIRT864201	hsa-miR-4284	CLIP-seq
MIRT864202	hsa-miR-4418	CLIP-seq
MIRT864203	hsa-miR-4483	CLIP-seq
MIRT864204	hsa-miR-4486	CLIP-seq
MIRT864205	hsa-miR-4490	CLIP-seq
MIRT864206	hsa-miR-4507	CLIP-seq
MIRT864207	hsa-miR-4537	CLIP-seq
MIRT864208	hsa-miR-4649-5p	CLIP-seq
MIRT864209	hsa-miR-4715-3p	CLIP-seq
MIRT864210	hsa-miR-4728-5p	CLIP-seq
MIRT864211	hsa-miR-4746-3p	CLIP-seq
MIRT864212	hsa-miR-4755-3p	CLIP-seq
MIRT864213	hsa-miR-4774-5p	CLIP-seq
MIRT864214	hsa-miR-4792	CLIP-seq
MIRT864215	hsa-miR-4793-3p	CLIP-seq
MIRT864216	hsa-miR-508-5p	CLIP-seq
MIRT864217	hsa-miR-509-3-5p	CLIP-seq
MIRT864218	hsa-miR-509-5p	CLIP-seq
MIRT864219	hsa-miR-548ac	CLIP-seq
MIRT864220	hsa-miR-548ae	CLIP-seq
MIRT864221	hsa-miR-548aj	CLIP-seq
MIRT864222	hsa-miR-548am	CLIP-seq
MIRT864223	hsa-miR-548d-3p	CLIP-seq
MIRT864224	hsa-miR-548x	CLIP-seq
MIRT864225	hsa-miR-548z	CLIP-seq
MIRT864226	hsa-miR-635	CLIP-seq
MIRT864227	hsa-miR-661	CLIP-seq
MIRT864228	hsa-miR-766	CLIP-seq
MIRT864186	hsa-miR-1226	CLIP-seq
MIRT864188	hsa-miR-1273	CLIP-seq
MIRT864189	hsa-miR-1293	CLIP-seq
MIRT864190	hsa-miR-137	CLIP-seq
MIRT864194	hsa-miR-3064-3p	CLIP-seq
MIRT864229	hsa-miR-3120-5p	CLIP-seq
MIRT864195	hsa-miR-3122	CLIP-seq
MIRT864230	hsa-miR-3165	CLIP-seq
MIRT864231	hsa-miR-3613-3p	CLIP-seq
MIRT864196	hsa-miR-3689a-3p	CLIP-seq
MIRT864197	hsa-miR-3689c	CLIP-seq
MIRT864232	hsa-miR-371-5p	CLIP-seq
MIRT864233	hsa-miR-371b-5p	CLIP-seq
MIRT864198	hsa-miR-3913-5p	CLIP-seq
MIRT864200	hsa-miR-4252	CLIP-seq
MIRT864234	hsa-miR-4433	CLIP-seq
MIRT864235	hsa-miR-4459	CLIP-seq
MIRT864203	hsa-miR-4483	CLIP-seq
MIRT864207	hsa-miR-4537	CLIP-seq
MIRT864236	hsa-miR-4683	CLIP-seq
MIRT864209	hsa-miR-4715-3p	CLIP-seq
MIRT864210	hsa-miR-4728-5p	CLIP-seq
MIRT864211	hsa-miR-4746-3p	CLIP-seq
MIRT864237	hsa-miR-4778-5p	CLIP-seq
MIRT864214	hsa-miR-4792	CLIP-seq
MIRT864215	hsa-miR-4793-3p	CLIP-seq
MIRT864238	hsa-miR-495	CLIP-seq
MIRT864216	hsa-miR-508-5p	CLIP-seq
MIRT864239	hsa-miR-543	CLIP-seq
MIRT864219	hsa-miR-548ac	CLIP-seq
MIRT864220	hsa-miR-548ae	CLIP-seq
MIRT864221	hsa-miR-548aj	CLIP-seq
MIRT864222	hsa-miR-548am	CLIP-seq
MIRT864223	hsa-miR-548d-3p	CLIP-seq
MIRT864224	hsa-miR-548x	CLIP-seq
MIRT864225	hsa-miR-548z	CLIP-seq
MIRT864228	hsa-miR-766	CLIP-seq
MIRT864185	hsa-miR-1184	CLIP-seq
MIRT864191	hsa-miR-192	CLIP-seq
MIRT864192	hsa-miR-215	CLIP-seq
MIRT864193	hsa-miR-24	CLIP-seq
MIRT864229	hsa-miR-3120-5p	CLIP-seq
MIRT864231	hsa-miR-3613-3p	CLIP-seq
MIRT864232	hsa-miR-371-5p	CLIP-seq
MIRT864233	hsa-miR-371b-5p	CLIP-seq
MIRT1956164	hsa-miR-3944-5p	CLIP-seq
MIRT864201	hsa-miR-4284	CLIP-seq
MIRT864202	hsa-miR-4418	CLIP-seq
MIRT864207	hsa-miR-4537	CLIP-seq
MIRT1956165	hsa-miR-4658	CLIP-seq
MIRT864211	hsa-miR-4746-3p	CLIP-seq
MIRT1956166	hsa-miR-4758-5p	CLIP-seq
MIRT864237	hsa-miR-4778-5p	CLIP-seq
MIRT864214	hsa-miR-4792	CLIP-seq
MIRT864217	hsa-miR-509-3-5p	CLIP-seq
MIRT864218	hsa-miR-509-5p	CLIP-seq
MIRT864188	hsa-miR-1273	CLIP-seq
MIRT864189	hsa-miR-1293	CLIP-seq
MIRT864193	hsa-miR-24	CLIP-seq
MIRT2193822	hsa-miR-3074-3p	CLIP-seq
MIRT864195	hsa-miR-3122	CLIP-seq
MIRT864230	hsa-miR-3165	CLIP-seq
MIRT2193823	hsa-miR-3653	CLIP-seq
MIRT864196	hsa-miR-3689a-3p	CLIP-seq
MIRT864197	hsa-miR-3689c	CLIP-seq
MIRT864198	hsa-miR-3913-5p	CLIP-seq
MIRT2193824	hsa-miR-3942-5p	CLIP-seq
MIRT864200	hsa-miR-4252	CLIP-seq
MIRT864201	hsa-miR-4284	CLIP-seq
MIRT864234	hsa-miR-4433	CLIP-seq
MIRT864235	hsa-miR-4459	CLIP-seq
MIRT864203	hsa-miR-4483	CLIP-seq
MIRT864204	hsa-miR-4486	CLIP-seq
MIRT864207	hsa-miR-4537	CLIP-seq
MIRT864208	hsa-miR-4649-5p	CLIP-seq
MIRT864236	hsa-miR-4683	CLIP-seq
MIRT2193825	hsa-miR-4703-5p	CLIP-seq
MIRT864210	hsa-miR-4728-5p	CLIP-seq
MIRT864211	hsa-miR-4746-3p	CLIP-seq
MIRT864214	hsa-miR-4792	CLIP-seq
MIRT864215	hsa-miR-4793-3p	CLIP-seq
MIRT2193826	hsa-miR-487a	CLIP-seq
MIRT864216	hsa-miR-508-5p	CLIP-seq
MIRT864226	hsa-miR-635	CLIP-seq
MIRT864227	hsa-miR-661	CLIP-seq
MIRT864228	hsa-miR-766	CLIP-seq
MIRT864229	hsa-miR-3120-5p	CLIP-seq
MIRT864231	hsa-miR-3613-3p	CLIP-seq
MIRT864232	hsa-miR-371-5p	CLIP-seq
MIRT864233	hsa-miR-371b-5p	CLIP-seq
MIRT864237	hsa-miR-4778-5p	CLIP-seq
MIRT2497039	hsa-miR-106a	CLIP-seq
MIRT2497040	hsa-miR-106b	CLIP-seq
MIRT2497041	hsa-miR-10a	CLIP-seq
MIRT2497042	hsa-miR-10b	CLIP-seq
MIRT864185	hsa-miR-1184	CLIP-seq
MIRT2497043	hsa-miR-1224-3p	CLIP-seq
MIRT2497044	hsa-miR-1260	CLIP-seq
MIRT2497045	hsa-miR-1260b	CLIP-seq
MIRT864188	hsa-miR-1273	CLIP-seq
MIRT2497046	hsa-miR-128	CLIP-seq
MIRT2497047	hsa-miR-1280	CLIP-seq
MIRT864189	hsa-miR-1293	CLIP-seq
MIRT2497048	hsa-miR-150	CLIP-seq
MIRT2497049	hsa-miR-17	CLIP-seq
MIRT2497050	hsa-miR-1908	CLIP-seq
MIRT864191	hsa-miR-192	CLIP-seq
MIRT2497051	hsa-miR-20a	CLIP-seq
MIRT2497052	hsa-miR-20b	CLIP-seq
MIRT2497053	hsa-miR-2114	CLIP-seq
MIRT864192	hsa-miR-215	CLIP-seq
MIRT864193	hsa-miR-24	CLIP-seq
MIRT2497054	hsa-miR-302a	CLIP-seq
MIRT2497055	hsa-miR-302b	CLIP-seq
MIRT2497056	hsa-miR-302c	CLIP-seq
MIRT2497057	hsa-miR-302d	CLIP-seq
MIRT2497058	hsa-miR-302e	CLIP-seq
MIRT864229	hsa-miR-3120-5p	CLIP-seq
MIRT864195	hsa-miR-3122	CLIP-seq
MIRT864230	hsa-miR-3165	CLIP-seq
MIRT2497059	hsa-miR-339-5p	CLIP-seq
MIRT864231	hsa-miR-3613-3p	CLIP-seq
MIRT864196	hsa-miR-3689a-3p	CLIP-seq
MIRT864197	hsa-miR-3689c	CLIP-seq
MIRT864232	hsa-miR-371-5p	CLIP-seq
MIRT864233	hsa-miR-371b-5p	CLIP-seq
MIRT2497060	hsa-miR-372	CLIP-seq
MIRT2497061	hsa-miR-373	CLIP-seq
MIRT864198	hsa-miR-3913-5p	CLIP-seq
MIRT2497062	hsa-miR-3934	CLIP-seq
MIRT864199	hsa-miR-3940-5p	CLIP-seq
MIRT1956164	hsa-miR-3944-5p	CLIP-seq
MIRT864200	hsa-miR-4252	CLIP-seq
MIRT864201	hsa-miR-4284	CLIP-seq
MIRT864202	hsa-miR-4418	CLIP-seq
MIRT2497063	hsa-miR-4421	CLIP-seq
MIRT864234	hsa-miR-4433	CLIP-seq
MIRT864235	hsa-miR-4459	CLIP-seq
MIRT864203	hsa-miR-4483	CLIP-seq
MIRT864204	hsa-miR-4486	CLIP-seq
MIRT864206	hsa-miR-4507	CLIP-seq
MIRT864208	hsa-miR-4649-5p	CLIP-seq
MIRT1956165	hsa-miR-4658	CLIP-seq
MIRT2497064	hsa-miR-4662a-5p	CLIP-seq
MIRT2497065	hsa-miR-4676-5p	CLIP-seq
MIRT864236	hsa-miR-4683	CLIP-seq
MIRT2497066	hsa-miR-4684-5p	CLIP-seq
MIRT2497067	hsa-miR-4714-3p	CLIP-seq
MIRT864210	hsa-miR-4728-5p	CLIP-seq
MIRT2497068	hsa-miR-4731-5p	CLIP-seq
MIRT1956166	hsa-miR-4758-5p	CLIP-seq
MIRT864237	hsa-miR-4778-5p	CLIP-seq
MIRT864215	hsa-miR-4793-3p	CLIP-seq
MIRT2497069	hsa-miR-498	CLIP-seq
MIRT864216	hsa-miR-508-5p	CLIP-seq
MIRT864217	hsa-miR-509-3-5p	CLIP-seq
MIRT864218	hsa-miR-509-5p	CLIP-seq
MIRT2497070	hsa-miR-512-3p	CLIP-seq
MIRT2497071	hsa-miR-519d	CLIP-seq
MIRT2497072	hsa-miR-520a-3p	CLIP-seq
MIRT2497073	hsa-miR-520b	CLIP-seq
MIRT2497074	hsa-miR-520c-3p	CLIP-seq
MIRT2497075	hsa-miR-520d-3p	CLIP-seq
MIRT2497076	hsa-miR-520e	CLIP-seq
MIRT2497077	hsa-miR-520g	CLIP-seq
MIRT2497078	hsa-miR-520h	CLIP-seq
MIRT2497079	hsa-miR-532-3p	CLIP-seq
MIRT2497080	hsa-miR-548c-3p	CLIP-seq
MIRT2497081	hsa-miR-575	CLIP-seq
MIRT2497082	hsa-miR-593	CLIP-seq
MIRT864226	hsa-miR-635	CLIP-seq
MIRT864227	hsa-miR-661	CLIP-seq
MIRT2497083	hsa-miR-663	CLIP-seq
MIRT864228	hsa-miR-766	CLIP-seq
MIRT2497084	hsa-miR-93	CLIP-seq
MIRT2497039	hsa-miR-106a	CLIP-seq
MIRT2497040	hsa-miR-106b	CLIP-seq
MIRT2497041	hsa-miR-10a	CLIP-seq
MIRT2497042	hsa-miR-10b	CLIP-seq
MIRT864185	hsa-miR-1184	CLIP-seq
MIRT2497043	hsa-miR-1224-3p	CLIP-seq
MIRT2497044	hsa-miR-1260	CLIP-seq
MIRT2497045	hsa-miR-1260b	CLIP-seq
MIRT864188	hsa-miR-1273	CLIP-seq
MIRT2497046	hsa-miR-128	CLIP-seq
MIRT2497047	hsa-miR-1280	CLIP-seq
MIRT864189	hsa-miR-1293	CLIP-seq
MIRT2497048	hsa-miR-150	CLIP-seq
MIRT2497049	hsa-miR-17	CLIP-seq
MIRT2497050	hsa-miR-1908	CLIP-seq
MIRT864191	hsa-miR-192	CLIP-seq
MIRT2497051	hsa-miR-20a	CLIP-seq
MIRT2497052	hsa-miR-20b	CLIP-seq
MIRT2497053	hsa-miR-2114	CLIP-seq
MIRT864192	hsa-miR-215	CLIP-seq
MIRT864193	hsa-miR-24	CLIP-seq
MIRT2497054	hsa-miR-302a	CLIP-seq
MIRT2497055	hsa-miR-302b	CLIP-seq
MIRT2497056	hsa-miR-302c	CLIP-seq
MIRT2497057	hsa-miR-302d	CLIP-seq
MIRT2497058	hsa-miR-302e	CLIP-seq
MIRT864229	hsa-miR-3120-5p	CLIP-seq
MIRT864195	hsa-miR-3122	CLIP-seq
MIRT864230	hsa-miR-3165	CLIP-seq
MIRT2497059	hsa-miR-339-5p	CLIP-seq
MIRT864231	hsa-miR-3613-3p	CLIP-seq
MIRT864196	hsa-miR-3689a-3p	CLIP-seq
MIRT864197	hsa-miR-3689c	CLIP-seq
MIRT864232	hsa-miR-371-5p	CLIP-seq
MIRT864233	hsa-miR-371b-5p	CLIP-seq
MIRT2497060	hsa-miR-372	CLIP-seq
MIRT2497061	hsa-miR-373	CLIP-seq
MIRT864198	hsa-miR-3913-5p	CLIP-seq
MIRT2497062	hsa-miR-3934	CLIP-seq
MIRT864199	hsa-miR-3940-5p	CLIP-seq
MIRT1956164	hsa-miR-3944-5p	CLIP-seq
MIRT864200	hsa-miR-4252	CLIP-seq
MIRT864201	hsa-miR-4284	CLIP-seq
MIRT864202	hsa-miR-4418	CLIP-seq
MIRT2497063	hsa-miR-4421	CLIP-seq
MIRT864234	hsa-miR-4433	CLIP-seq
MIRT864235	hsa-miR-4459	CLIP-seq
MIRT864203	hsa-miR-4483	CLIP-seq
MIRT864204	hsa-miR-4486	CLIP-seq
MIRT864206	hsa-miR-4507	CLIP-seq
MIRT864208	hsa-miR-4649-5p	CLIP-seq
MIRT1956165	hsa-miR-4658	CLIP-seq
MIRT2497064	hsa-miR-4662a-5p	CLIP-seq
MIRT2497065	hsa-miR-4676-5p	CLIP-seq
MIRT864236	hsa-miR-4683	CLIP-seq
MIRT2497066	hsa-miR-4684-5p	CLIP-seq
MIRT2497067	hsa-miR-4714-3p	CLIP-seq
MIRT864210	hsa-miR-4728-5p	CLIP-seq
MIRT2497068	hsa-miR-4731-5p	CLIP-seq
MIRT1956166	hsa-miR-4758-5p	CLIP-seq
MIRT864237	hsa-miR-4778-5p	CLIP-seq
MIRT864215	hsa-miR-4793-3p	CLIP-seq
MIRT2497069	hsa-miR-498	CLIP-seq
MIRT864216	hsa-miR-508-5p	CLIP-seq
MIRT864217	hsa-miR-509-3-5p	CLIP-seq
MIRT864218	hsa-miR-509-5p	CLIP-seq
MIRT2497070	hsa-miR-512-3p	CLIP-seq
MIRT2497071	hsa-miR-519d	CLIP-seq
MIRT2497072	hsa-miR-520a-3p	CLIP-seq
MIRT2497073	hsa-miR-520b	CLIP-seq
MIRT2497074	hsa-miR-520c-3p	CLIP-seq
MIRT2497075	hsa-miR-520d-3p	CLIP-seq
MIRT2497076	hsa-miR-520e	CLIP-seq
MIRT2497077	hsa-miR-520g	CLIP-seq
MIRT2497078	hsa-miR-520h	CLIP-seq
MIRT2497079	hsa-miR-532-3p	CLIP-seq
MIRT2497080	hsa-miR-548c-3p	CLIP-seq
MIRT2497081	hsa-miR-575	CLIP-seq
MIRT2497082	hsa-miR-593	CLIP-seq
MIRT864226	hsa-miR-635	CLIP-seq
MIRT864227	hsa-miR-661	CLIP-seq
MIRT2497083	hsa-miR-663	CLIP-seq
MIRT864228	hsa-miR-766	CLIP-seq
MIRT2497084	hsa-miR-93	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
CEBPD	Unknown	24810056
CREB1	Activation	18342014
DNMT1	Repression	20398055
MEN1	Activation	17766243
RUNX3	Activation	15930301

109

Show/Hide all (109)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	ISS
GO:0001525	Process	Angiogenesis	ISS
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0001817	Process	Regulation of cytokine production	ISS
GO:0002682	Process	Regulation of immune system process	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IBA
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	16916640, 16920334, 19240112, 31827280, 32929201, 33852854, 34012073, 35594856
GO:0004197	Function	Cysteine-type endopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IMP	11717445, 21737330, 21980415
GO:0004197	Function	Cysteine-type endopeptidase activity	TAS	8681376
GO:0005123	Function	Death receptor binding	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	8681376, 9208847, 9334338, 9343261, 9560245, 10442631, 10508784, 10508785, 12198154, 12884866, 12887920, 12888622, 14612908, 15069192, 15509781, 16498403, 16936772, 17047155, 17159907, 17170703, 17245429, 17479112, 18086677, 18245485, 18328427, 18485876, 18846110, 19060883, 19416807
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17167422
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	TAS	10891503
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005829	Component	Cytosol	IDA	17167422
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	TAS	10891503
GO:0005886	Component	Plasma membrane	IEA
GO:0006508	Process	Proteolysis	IDA	12888622
GO:0006508	Process	Proteolysis	IEA
GO:0006915	Process	Apoptotic process	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IMP	22891283
GO:0007507	Process	Heart development	ISS
GO:0008233	Function	Peptidase activity	IDA	19740745
GO:0008233	Function	Peptidase activity	IEA
GO:0008233	Function	Peptidase activity	IMP	17047155
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	TAS	8681376
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IBA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	9184224
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:0009967	Process	Positive regulation of signal transduction	IEA
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	TAS
GO:0016485	Process	Protein processing	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030027	Component	Lamellipodium	IDA	18216014
GO:0030027	Component	Lamellipodium	IEA
GO:0030101	Process	Natural killer cell activation	TAS	18309324
GO:0030154	Process	Cell differentiation	IEA
GO:0030225	Process	Macrophage differentiation	IBA
GO:0030225	Process	Macrophage differentiation	TAS	18309324
GO:0030335	Process	Positive regulation of cell migration	IDA	18216014
GO:0031264	Component	Death-inducing signaling complex	IDA	11101870, 21803845
GO:0031264	Component	Death-inducing signaling complex	IEA
GO:0031265	Component	CD95 death-inducing signaling complex	IBA
GO:0031265	Component	CD95 death-inducing signaling complex	IDA	11717445
GO:0031265	Component	CD95 death-inducing signaling complex	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	15069192
GO:0032025	Process	Response to cobalt ion	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IMP	22267217
GO:0032991	Component	Protein-containing complex	IDA	22267217
GO:0032991	Component	Protein-containing complex	IEA
GO:0034612	Process	Response to tumor necrosis factor	IMP	10521396
GO:0035877	Function	Death effector domain binding	IPI	11717445
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IDA	21785459
GO:0042110	Process	T cell activation	TAS	18309324
GO:0042113	Process	B cell activation	TAS	18309324
GO:0042802	Function	Identical protein binding	IPI	16169070, 17170703
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043009	Process	Chordate embryonic development	IEA
GO:0043065	Process	Positive regulation of apoptotic process	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	12884866
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IMP	17047155
GO:0043525	Process	Positive regulation of neuron apoptotic process	IBA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0044297	Component	Cell body	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045088	Process	Regulation of innate immune response	ISS
GO:0045471	Process	Response to ethanol	IEA
GO:0045651	Process	Positive regulation of macrophage differentiation	IMP	17047155
GO:0045862	Process	Positive regulation of proteolysis	IDA	18387192
GO:0048513	Process	Animal organ development	IEA
GO:0051603	Process	Proteolysis involved in protein catabolic process	IEA
GO:0051603	Process	Proteolysis involved in protein catabolic process	IMP	10521396
GO:0051603	Process	Proteolysis involved in protein catabolic process	ISS
GO:0051604	Process	Protein maturation	IDA	33852854, 35594856
GO:0051604	Process	Protein maturation	IDA	16916640, 33852854, 35594856
GO:0051604	Process	Protein maturation	IEA
GO:0060546	Process	Negative regulation of necroptotic process	IDA	31827280
GO:0060546	Process	Negative regulation of necroptotic process	IEA
GO:0060546	Process	Negative regulation of necroptotic process	ISS
GO:0060715	Process	Syncytiotrophoblast cell differentiation involved in labyrinthine layer development	TAS	18309324
GO:0070269	Process	Pyroptotic inflammatory response	IDA	33852854, 35594856
GO:0070269	Process	Pyroptotic inflammatory response	ISS
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0072347	Process	Response to anesthetic	IEA
GO:0097110	Function	Scaffold protein binding	IPI	21785459
GO:0097190	Process	Apoptotic signaling pathway	IMP	11101870
GO:0097190	Process	Apoptotic signaling pathway	TAS
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	21785459, 35446120
GO:0097194	Process	Execution phase of apoptosis	IDA	16916640
GO:0097194	Process	Execution phase of apoptosis	IEA
GO:0097194	Process	Execution phase of apoptosis	IMP	21737330
GO:0097194	Process	Execution phase of apoptosis	ISS
GO:0097264	Process	Self proteolysis	ISS
GO:0097342	Component	Ripoptosome	IDA	21737330
GO:0140639	Process	Positive regulation of pyroptotic inflammatory response	IDA	33852854
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IDA	16916640

MIM	HGNC	e!Ensembl
601763	1509	ENSG00000064012

Q14790

Protein name

Caspase-8 (CASP-8) (EC 3.4.22.61) (Apoptotic cysteine protease) (Apoptotic protease Mch-5) (CAP4) (FADD-homologous ICE/ced-3-like protease) (FADD-like ICE) (FLICE) (ICE-like apoptotic protease 5) (MORT1-associated ced-3 homolog) (MACH) [Cleaved into: Casp

Protein function

Thiol protease that plays a key role in programmed cell death by acting as a molecular switch for apoptosis, necroptosis and pyroptosis, and is required to prevent tissue damage during embryonic development and adulthood (PubMed:23516580, PubMed

PDB

1F9E , 1I4E , 1QDU , 1QTN , 2C2Z , 2FUN , 2K7Z , 2Y1L , 3H11 , 3KJN , 3KJQ , 4JJ7 , 4PRZ , 4PS1 , 4ZBW , 5H31 , 5H33 , 5JQE , 5L08 , 6AGW , 6PX9 , 7DEE , 7LVJ , 7LVM , 8YBX , 8YD7 , 8YD8 , 8YM4 , 8YM5 , 8YM6 , 8YNI , 8YNK , 8YNL , 8YNM , 8YNN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01335	DED	3 → 84	Death effector domain	Domain
PF01335	DED	101 → 180	Death effector domain	Domain
PF00656	Peptidase_C14	234 → 476		Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1, isoform 5 and isoform 7 are expressed in a wide variety of tissues. Highest expression in peripheral blood leukocytes, spleen, thymus and liver. Barely detectable in brain, testis and skeletal muscle.

Sequence

MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLS
FLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSF
KFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEE
FSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIIN
NHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQ
LMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQAC
QGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTW
YIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD

Sequence length

479

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autoimmune lymphoproliferative syndrome type 2B	Likely pathogenic; Pathogenic	rs373232880, rs1457092267, rs1948252170, rs1559374786, rs2470005907, rs143410219, rs762135470, rs2470081765, rs17860424, rs2470084250, rs2470003978, rs758051022, rs760132764, rs747862347, rs777784105, rs765672355, rs1368296717 View all (2 more)	RCV001379656 RCV001898605 RCV002040866 RCV002632653 RCV002638923 View all (12 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hepatocellular carcinoma	Pathogenic	rs587776665	RCV000008202	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lung cancer	Likely pathogenic	rs1559356254	RCV003990653	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (75)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTOIMMUNE LYMPHOPROLIFERATIVE SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE LYMPHOPROLIFERATIVE SYNDROME-RECURRENT VIRAL INFECTIONS DUE TO CASP8 DEFICIENCY	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN NEOPLASM OF SKIN	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER, PROTECTION AGAINST	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CASP8-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CASPASE 8 DEFICIENCY	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL HEMORRHAGE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATINOCYTE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer, protection against	protective	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOCYTIC NEVUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, FAMILIAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBORRHEIC KERATOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE CERVICAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (479)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acoustic Neuroma	Acoustic Neuroma	BEFREE	17684142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	16579975, 22010212, 27834956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	30551620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15645141, 23470529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	21472143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	21472143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23470529, 27195913, 28278082, 29843634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	21472143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	21472143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	21472143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	12949717, 18716417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	18716417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	15788647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	29072704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22010212, 27834956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	ORPHANET_DG	15531912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult hepatocellular carcinoma	Liver carcinoma	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	14688019, 15029256, 15289853, 16607283, 18342014, 19597472, 19887560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	12138895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	25349431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	30311940		★★★★★ ★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	21714972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26939933, 28558704, 28985224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	16110259		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 2, JUVENILE (disorder)	Amyotrophic lateral sclerosis	BEFREE	11161814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anal carcinoma	Anal Cancer	BEFREE	27462786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anencephaly	Anencephaly	BEFREE	28786179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	27592797	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anterior Cruciate Ligament Injuries	Anterior cruciate ligament injury	Pubtator	31692049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	19492233, 29416696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anthracosis	Anterior uveitis	Pubtator	34982434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anus Neoplasms	Anus neoplasm	Pubtator	27325299, 27462786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30428004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28978351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	34963488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	34576119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10817565, 24452947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	18823309, 27007676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	18823309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	15112054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	11096418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	26004742, 31632285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	33834070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	25569260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	25569260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	BEFREE	15160902, 18818883, 31309545		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	25814141, 31309545, 33995372	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Lymphoproliferative Syndrome Type 1, Autosomal Dominant	Lymphoproliferative Disorder	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome Type 2B	Autoimmune Lymphoproliferative Disorder	BEFREE	12353035, 18818883, 28978351, 30741924		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Autoimmune Lymphoproliferative Syndrome Type 2B	Autoimmune Lymphoproliferative Disorder	UNIPROT_DG	12353035		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Autoimmune Lymphoproliferative Syndrome Type 2B	Autoimmune Lymphoproliferative Disorder	ORPHANET_DG	16446975, 21447005		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Autoimmune Lymphoproliferative Syndrome Type 2B	Autoimmune Lymphoproliferative Disorder	CLINVAR_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Autoimmune Lymphoproliferative Syndrome Type 2B	Autoimmune Lymphoproliferative Disorder	CTD_human_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	16498450, 17585225, 21364665, 25310109, 26783238, 28454103, 28765925, 29434943, 29436651, 29552161, 30061179, 30127928, 30197679, 30467847, 30689998 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barth Syndrome	Barth syndrome	Pubtator	23523468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal Cell Cancer	Basal Cell Neoplasm	GWASCAT_DG	28177523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	GWASCAT_DG	28177523		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Basal Cell Neoplasm	Basal Cell Neoplasm	GWASCAT_DG	28177523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	15986355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	15986355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	11723175		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	11723175		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	19160091, 19276244, 19412632, 31519577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	19160091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	18398042, 26163602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	18407431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	18398042, 26359420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	16251207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15601643, 16251207, 17293864, 17666167, 17891485, 17932347, 17940865, 18058803, 18362937, 18823701, 19088016, 19094228, 19214744, 19318553, 19367188 View all (31 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	15601643, 17293864, 17450141, 29915430		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CGI_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	14701762, 14993214, 18362937, 19318553, 19843670, 20033885, 20154269, 20978178, 21127496, 21194473, 21596841, 21901386, 22532573, 23544014, 23593120 View all (31 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	19094228	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	20132554, 20978178, 39351539, 39391306	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	18823309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	10477698, 10946276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16443735, 17726263, 27798717, 33749640, 35325509, 36580018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	12170765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	26008974	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12810637, 12949717, 15705878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	23659359, 24149212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	24927175, 25855136, 26740556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11572758, 12748179, 16627981, 16750275, 18161048, 20398055, 23443079, 24209510, 25543761, 25755779, 28246474, 28350813, 28534955, 29476051, 30021196 View all (4 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	12820373, 19160091, 19276244, 19412632, 31519577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12466971, 16938569, 17450141, 19203830, 23315881, 24128051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	17569106, 24690311	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19940360, 20442297, 28154184, 36647955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25303977, 26107208, 27462786, 29617660, 35894839, 39694330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	24927175, 25855136, 26740556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	21472143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	21472143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18559494, 19214744, 20978178, 21714991, 22926736, 24412083, 30941888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	25888309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	31692049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal tunnel syndrome	Pubtator	31692049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	37455655	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	22695677		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	CTD_human_DG	17450141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
cervical cancer	Cervical Cancer	BEFREE	19258216, 20117760, 21328377, 26458812, 30004844		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	19258216, 20117760, 21328377, 26458812, 30004844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	17160263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	20232432, 22010212, 22211869, 27834956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	22010212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	14688019, 15029256, 15289853, 16607283, 18342014, 19597472, 19887560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	28662515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	30144553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	16371840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	28522217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	16443735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	16616114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11753607, 17071630, 19074885, 24719462, 28950661, 31637186		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASDB_DG	23770605		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASCAT_DG	23770605		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	BEFREE	29021368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21921917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	36576886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16217767, 20811726, 20837473, 24842234, 24885920, 24934366, 29242562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17182797, 17436592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	24317430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12692863, 12949717, 16948818, 17510406, 18245494, 18362937, 21538054, 22027693, 22513478, 23715747, 23844036, 24465592, 24498403, 24957706, 27507139, 29355114, 31177115 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	17450141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	12949717		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16036110, 16217767, 16619028, 17436592, 20567954, 20570920, 21722370, 23615374, 23844036, 24465592, 24498403, 24842234, 24934366, 26180579, 27507139 View all (11 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	17450141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32552466	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	18571097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital cerebral hernia	Congenital Cerebral Hernia	BEFREE	28786179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30633583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14555992, 14735202, 18354192, 18516683, 20572163, 21269758, 23313206, 28154184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28633917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	29847820	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11322779, 31276162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	18563783, 25407435		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic Fibrosis	BEFREE	29486923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	31299187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	14872492, 28765925, 31055086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29596938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	16033404		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	21135236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	21135236, 31775025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	29301000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23138840, 31299187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18483392, 23138840, 29409058, 31299187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23335850, 28127871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31587010	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37957232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31030170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	15531508		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	35932042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31341796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	19239430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	28238526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	19177145, 21135236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	24198425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalocele	Encephalocele	BEFREE	28786179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16014121, 17982483, 19531679, 23590818, 24651472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	16014121, 16928264, 19531679, 28421904, 32407273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	29520026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	16051033, 16616114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31212050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21714991, 24412083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	23659359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	19120899, 21426305		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	17450141, 21472143		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	19120899		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	GWASDB_DG	22323360		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26635288, 28542283, 36533709	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	17187659, 21926110, 24819879, 25431829, 33457096	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ewings sarcoma	Ewing sarcoma	BEFREE	17200356, 17525260, 25420617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	11110692		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	11110692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	24938610, 29072704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	37957232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	30248539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30248539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	22355661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30337250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	20564345, 21283657, 24329682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	21283657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Geographic Atrophy	BEFREE	25349431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	15523899, 18812519, 19432816, 22585859, 22672670, 24213561, 24561085, 25226230, 26017671, 27927008, 28594322, 30385739, 30670698, 36460775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16357155, 17272309, 18812519, 19432816, 20716639, 21877214, 22672670, 25358253, 28594322, 28618251, 29274253, 30385739, 30389373, 30501030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	17272309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16199861, 16357155, 17272309, 18812519, 19432816, 20716639, 21877214, 22672670, 25358253, 28594322, 28618251, 29274253, 30385739, 30389373, 30501030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	12496285, 14655759, 15523899, 16080161, 16319070, 18239851, 18398042, 21364665, 25755779, 26470725, 31806377, 35296768, 36325335, 36466844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	14991747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	16357155, 17684142, 18398042, 19724922, 26359420, 28204824, 28233371, 28677777, 30009775, 31810928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	36291136	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	18571097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	26283340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	23235765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	12930371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	12930371, 18324486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	LHGDN	18324486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	12930371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	12930371, 18324486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	LHGDN	18324486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	20086182, 21801448, 24816188, 9271594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	25314064, 28749946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	29847820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	22843554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	18563783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	40149873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	23256595	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	32050950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	10574243, 20978178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	17450141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	LHGDN	15956881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	11788820, 21519949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28396396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	17558734	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	29518608, 29780394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	29780394	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17600131, 36748372	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19706414, 20653473, 23492767, 26464645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	24621205		★★★★★ ★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	BEFREE	31411503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	31276162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	25814141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29212182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24322838, 31411503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	36647737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	17766243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30354994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	11222719, 15572586, 17899551, 19324905, 22590573, 30029010, 31754092, 9087414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	31762289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	16304056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33828176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
L2 Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	22010212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	15289875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	26367014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	26367014, 29593724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11238127, 11514566, 12506034, 17561974, 17993614, 19182209, 19298651, 20105315, 21190589, 26692089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15735742		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22411956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19298651	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24526787, 35873796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	12899712, 30551620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21307400, 24093560, 29191655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	12138895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	28278082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	25105148, 28181739, 29037125, 29764340, 31280204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10025875, 15105837, 15254777, 15531912, 16285959, 16750275, 17922191, 19728331, 20403046, 21979578, 22153863, 22575016, 28017612, 28486557, 28643196 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15531912, 17224200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	38146363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	12393901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	12810955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	12810955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12037669, 16242324, 16938569		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	12170765, 12384554		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	12170765, 27927008	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	17450141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	20661084, 21435100, 21525012, 28099148, 28542283, 29165042, 32069989	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	19950283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15703453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	19950283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10860845, 15703453, 19950283, 21078760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	19950283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23358467, 36533709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28700659	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	16579975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11222383, 12804643, 17277134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17532763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	14614322	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17071630, 19414860, 21633787, 23844036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	21633787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	LHGDN	15492869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	23108118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	11848481, 12067435, 28204824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	20086182, 24816188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	28950661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	22154545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15601643, 16251207, 17293864, 17666167, 17891485, 17932347, 17940865, 18362937, 18823701, 19088016, 19094228, 19214744, 19318553, 19367188, 19629679 View all (30 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	15601643, 17293864, 17450141, 29915430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	19531679, 23590818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	17450141, 21472143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	19120899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	20564345, 21283657, 24329682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	25553350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	30008897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25543761, 26783238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12170765, 12466971, 16938569, 17450141, 19203830, 23315881, 24128051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	17450141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	25105148, 28181739, 29037125, 29764340, 31280204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	31587185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	18559494, 19214744, 20978178, 22926736, 30941888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11704875, 18483392, 19843670, 22903547, 26084607, 30192158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of penis	Penile cancer	BEFREE	31034097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11559570, 11593415, 18413762, 21396839, 21396853, 21555367, 25292051, 26740556, 27705939, 28855498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	18563783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11973654, 12716387, 15705878, 21461653, 29717769, 29744288, 29901126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	17450141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	16452205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	19846952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19160091, 19276244, 19412632, 31519577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11585725, 11687970, 12037669, 12716387, 12804643, 15705878, 16938569, 17096027, 17450141, 17891485, 18093694, 18362937, 18398042, 18483392, 18563783 View all (45 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19258216, 20117760, 21328377, 26458812, 30004844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16217767, 20837473, 24842234, 24885920, 24934366, 29242562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	15601643, 17293864, 17450141, 29915430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14701762, 14993214, 15601643, 16951203, 17293864, 17666167, 18343995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	15601643, 17293864, 17450141, 29915430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21107885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	15601643, 17293864, 17450141, 29915430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	28950661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	17071630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	14688019, 15029256, 15289853, 16398460, 16607283, 18342014, 19597472, 19887560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	15029256, 18342014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	LHGDN	16607283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11067917, 16520380, 18222423, 20461078, 21983787, 23527236, 35357426	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	11511973, 11593392, 11896617, 12459641, 18563783, 19684859, 25407435		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	18563783		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	18563783, 21983787		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	GWASDB_DG	21983787		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	18563783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	15365725, 17684142, 18823701, 26359420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	18823701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Micronodular cirrhosis	Micronodular cirrhosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	17056595, 20404718	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	29048624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	19479204, 24337492, 25631445, 27827950, 29037125, 31280204, 32492030, 33108350, 34167951, 39327561	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	27981346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	17071630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	17766243, 20616437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	11877293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11877293, 12531793, 12969976, 15070698, 16487170, 17384201, 17910628, 22420897, 27738323, 28264449, 28270494, 29562955, 30115673, 36262053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12393500, 15574786, 19020753, 29296860, 30115673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12393500	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	14625033, 20363033, 25801023, 30372424		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	29780394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	22723941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	15677568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	15677568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	22202974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	35229543, 35757636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxoma	Myxoma	BEFREE	26803534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	22560505, 23406595, 29885366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12632081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	31566021, 31991751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	25906152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10802708, 11466626, 11511973, 11585725, 11585763, 11593392, 11896617, 12170765, 12203125, 12384554, 12466971, 14555992, 14583479, 14688019, 14697505 View all (72 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	14555992, 14735202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	23982205, 26419589, 28786179, 31064411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10802708, 11406564, 11466626, 11511973, 11709729, 11896617, 12170765, 12203125, 12615731, 12841868, 12880977, 14735202, 15033719, 15065018, 15094781 View all (26 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12170765, 12771917, 12841868, 14670183, 15029256, 15632181, 16886176, 16930472, 17064406, 17962944, 18342014, 18794122, 19924290, 20546602, 22493319 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	16607283, 17064406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	16979248	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	19176810, 28985224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	15473998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	22695677, 28985224, 30648790, 31083628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	16607283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	28278082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	28278082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	12632081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24938610, 31839747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	18571097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17510429, 19543235, 20471133, 20683665, 22370637, 22843554, 23254292, 23456625, 23470529, 24309938, 25228008, 27259273, 27474150, 30320341, 31046799		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	20471133		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	GWASCAT_DG	31326317		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29072704, 30248539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25914268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	39464190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	34982434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	26107208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	31587185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10088775, 31762289, 40165317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29505132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15540114, 17493842, 23830991, 28627658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	18158779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28002586, 28109080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Granulosa Cell Tumor	Ovarian Tumor	BEFREE	23235765		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18559494, 19214744, 20978178, 22926736, 24412083, 30941888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18431743, 19415457, 19959214, 20978178, 21487429, 22558117, 22843880, 23826964, 30197345, 30941888, 31424650, 31702036, 37120633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	29490557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11704875, 18483392, 19843670, 22903547, 26084607, 30192158		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18483392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17410536, 19843670, 27756327, 32504778, 36882663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	22120515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	20616437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11739563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	19176810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	30311940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	19309556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30814594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	29682185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	18571097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	15788647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	24367530		★★★★★ ★☆☆☆☆ Found in Text Mining only
PNEUMOTHORAX, PRIMARY SPONTANEOUS	Pneumothorax	BEFREE	20653473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	31275848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	16579975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	17378240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	22010212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	CTD_human_DG	29892016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, HEREDITARY, 1	Prostate Cancer, Hereditary	CTD_human_DG	29892016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11559570, 11593415, 18413762, 20033885, 21396839, 21396853, 21555367, 25292051, 26740556, 27705939, 28855498		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	GWASCAT_DG	29892016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	17203870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17203870, 20053773, 26740556, 27197191, 28855498, 34482382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18097748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	26740556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33828176	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	29490557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	26617708	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	27007676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	18339897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	18716417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	30008897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14555992, 14735202, 18354192, 18516683, 20572163, 21269758, 23313206, 28154184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	18516683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis	Retinitis	BEFREE	17056549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	LHGDN	17616526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	31454332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	12761581, 21385927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10817565, 12115181, 18513326, 19407827, 26905515, 28978351		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	34982434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	12919886	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	LHGDN	17525260		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	25420617		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	15703453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	36443881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28428949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	29282220, 29780394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	12115181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	18563783		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Deprivation	Sleep deprivation	Pubtator	30551620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	11807782, 12170765, 12466971, 16938569, 18093694, 18342014, 20473894, 26988918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	LHGDN	12700635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	12170765, 26988918	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	18342014	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	GWASCAT_DG	23770605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	28786179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	22723941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15289875, 26107208		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21308686, 21926110, 24464182, 25216531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20086182, 20808443, 21801448, 23358467, 23619168, 23659359, 24292195, 25275298, 26107208, 27323410, 27644244, 27693639, 28435450, 28700659, 29053175 View all (12 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of mouth	Oral cavity carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	31587185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19852930, 20086182, 20808443, 21801448, 23659359, 27323410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	23358896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	18571097		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	18571097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	24938610, 29072704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12716387, 21461653, 29717769, 29744288, 29901126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	30019295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12174360, 12439910, 23921907, 24509146, 28000850, 28429358, 28972304, 36748372	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	17450141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomatitis	Stomatitis	BEFREE	30620218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28327595		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	BEFREE	24649974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	29542026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	28278082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	32182833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	16452205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	16452205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	16452205, 35546566, 35968508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	18324486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	19414420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	15365725, 22588838, 27541197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	19276244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24325915, 27476169, 29374147, 29663486, 34036395, 35056723, 37175458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24579801, 27082853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29739919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	CTD_human_DG	17450141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15197583, 19258216, 26458812, 28112728, 33096476, 36399280, 38555994, 39707317, 40603406	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Wilms Tumor	Wilms tumor	Pubtator	14735202, 35436013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CASP8 (caspase 8)