EHBP1L1 (EH domain binding protein 1 like 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 254102
• Gene name: EH domain binding protein 1 like 1
• Gene symbol: EHBP1L1
• Synonyms (NCBI Gene): -
• Chromosome: 11
• Chromosome location: 11q13.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017416	hsa-miR-335-5p	Microarray	18185580
MIRT026343	hsa-miR-192-5p	Microarray	19074876
MIRT2217844	hsa-miR-4751	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005768	Component	Endosome	IEA
GO:0016020	Component	Membrane	HDA	19946888

Other IDs

• MIM: 619583
• HGNC: 30682
• e!Ensembl: ENSG00000173442

Protein

• UniProt ID: Q8N3D4
• Protein name: EH domain-binding protein 1-like protein 1
• Protein function: May act as Rab effector protein and play a role in vesicle trafficking.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00307	CH	1037 → 1142	Calponin homology (CH) domain	Domain
  PF10358	NT-C2	12 → 164	N-terminal C2 in EEIG1 and EHBP1 proteins	Domain
  PF12130	DUF3585	1363 → 1499	Bivalent Mical/EHBP Rab binding domain	Domain

• Sequence:

  MTSVWKRLQRVGKRAAKFQFVACYHELVLECTKKWQPDKLVVVWTRRNRRICSKAHSWQP
  GIQNPYRGTVVWMVPENVDISVTLYRDPHVDQYEAKEWTFIIENESKGQRKVLATAEVDL
  ARHAGPVPVQVPVRLRLKPKSVKVVQAELSLTLSGVLLREGRATDDDMQSLASLMSVKPS
  DVGNLDDFAESDEDEAHGPGAPEARARVPQPDPSRELKTLCEEEEEGQGRPQQAVASPSN
  AEDTSPAPVSAPAPPARTSRGQGSERANEAGGQVGPEAPRPPETSPEMRSSRQPAQDTAP
  TPAPRLRKGSDALRPPVPQGEDEVPKASGAPPAGLGSARETQAQACPQEGTEAHGARLGP
  SIEDKGSGDPFGRQRLKAEEMDTEDRPEASGVDTEPRSGGREANTKRSGVRAGEAEESSA
  VCQVDAEQRSKVRHVDTKGPEATGVMPEARCRGTPEAPPRGSQGRLGVRTRDEAPSGLSL
  PPAEPAGHSGQLGDLEGARAAAGQEREGAEVRGGAPGIEGTGLEQGPSVGAISTRPQVSS
  WQGALLSTAQGAISRGLGGWEAEAGGSGDLETETEVVGLEVLGTQEKEVEGSGFPETRTL
  EIEILGALEKEAARSRVLESEVAGTAQCEGLETQETEVGVIETPGTETEVLGTQKTEAGG
  SGVLQTRTTIAETEVLVTQEISGDLGPLKIEDTIQSEMLGTQETEVEASRVPESEAEGTE
  AKILGTQEITARDSGVREIEAEIAESDILVAQEIEVGLLGVLGIETGAAEGAILGTQEIA
  SRDSGVPGLEADTTGIQVKEVGGSEVPEIATGTAETEILGTQEIASRSSGVPGLESEVAG
  AQETEVGGSGISGPEAGMAEARVLMTRKTEIIVPEAEKEEAQTSGVQEAETRVGSALKYE
  ALRAPVTQPRVLGSQEAKAEISGVQGSETQVLRVQEAEAGVWGMSEGKSGAWGAQEAEMK
  VLESPENKSGTFKAQEAEAGVLGNEKGKEAEGSLTEASLPEAQVASGAGAGAPRASSPEK
  AEEDRRLPGSQAPPALVSSSQSLLEWCQEVTTGYRGVRITNFTTSWRNGLAFCAILHRFY
  PDKIDYASLDPLNIKQNNKQAFDGFAALGVSRLLEPADMVLLSVPDKLIVMTYLCQIRAF
  CTGQELQLVQLEGGGGAGTYRVGSAQPSPPDDLDAGGLAQRLRGHGAEGPQEPKEAADRA
  DGAAPGVASRNAVAGRASKDGGAEAPRESRPAEVPAEGLVNGAGAPGGGGVRLRRPSVNG
  EPGSVPPPRAHGSFSHVRDADLLKKRRSRLRNSSSFSMDDPDAGAMGAAAAEGQAPDPSP
  APGPPTAADSQQPPGGSSPSEEPPPSPGEEAGLQRFQDTSQYVCAELQALEQEQRQIDGR
  AAEVEMQLRSLMESGANKLQEEVLIQEWFTLVNKKNALIRRQDQLQLLMEEQDLERRFEL
  LSRELRAMLAIEDWQKTSAQQHREQLLLEELVSLVNQRDELVRDLDHKERIALEEDERLE
  RGLEQRRRKLSRQLSRRERCVLS

• Sequence length: 1523

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (17)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
BREAST CARCINOMA	—	GWAS catalog	35803233	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	20708005	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	29212778, 33020668	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EHBP1L1-related disorder	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYDROPS FETALIS, NON-IMMUNE	—	Disgenet	34645488,26833786	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	36808568	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	33532862, 38072966	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	20708005	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-immune hydrops fetalis	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	34450027	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	34450027	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	34594039	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36775874	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	39198424	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	GWASCAT_DG	20708005		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	GWASCAT_DG	20708005		★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CHST2 1 shared diseaseLiver cirrhosis 2 shared evidence sourcesGWAS catalog (Liver cirrhosis), GWAS catalog (Nonalcoholic fatty liver disease) Related via 1 shared disease including Liver cirrhosis — evidence mostly GWAS catalog. DDX60L 1 shared diseaseLiver cirrhosis 2 shared evidence sourcesGWAS catalog (Liver cirrhosis), GWAS catalog (Nonalcoholic fatty liver disease) Related via 1 shared disease including Liver cirrhosis — evidence mostly GWAS catalog. HSD17B13 1 shared diseaseLiver cirrhosis 2 shared evidence sourcesGWAS catalog (Liver cirrhosis), GWAS catalog (Nonalcoholic fatty liver disease) Related via 1 shared disease including Liver cirrhosis — evidence mostly GWAS catalog. LCP1 1 shared diseaseLiver cirrhosis 2 shared evidence sourcesGWAS catalog (Liver cirrhosis), GWAS catalog (Nonalcoholic fatty liver disease) Related via 1 shared disease including Liver cirrhosis — evidence mostly GWAS catalog. SEL1L3 1 shared diseaseLiver cirrhosis 2 shared evidence sourcesGWAS catalog (Liver cirrhosis), GWAS catalog (Nonalcoholic fatty liver disease) Related via 1 shared disease including Liver cirrhosis — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CHST2	1	["Liver cirrhosis"]	0	[]	2	["GWAS catalog (Liver cirrhosis)","GWAS catalog (Nonalcoholic fatty liver disease)"]
DDX60L	1	["Liver cirrhosis"]	0	[]	2	["GWAS catalog (Liver cirrhosis)","GWAS catalog (Nonalcoholic fatty liver disease)"]
HSD17B13	1	["Liver cirrhosis"]	0	[]	2	["GWAS catalog (Liver cirrhosis)","GWAS catalog (Nonalcoholic fatty liver disease)"]
LCP1	1	["Liver cirrhosis"]	0	[]	2	["GWAS catalog (Liver cirrhosis)","GWAS catalog (Nonalcoholic fatty liver disease)"]
SEL1L3	1	["Liver cirrhosis"]	0	[]	2	["GWAS catalog (Liver cirrhosis)","GWAS catalog (Nonalcoholic fatty liver disease)"]

Diseases Linked via Similar Genes

Schizophrenia Linked via 1 of 5 related genesCHST2 Obesity Linked via 1 of 5 related genesDDX60L Psoriasis Linked via 1 of 5 related genesDDX60L Scoliosis Linked via 1 of 5 related genesDDX60L Alzheimer disease Linked via 1 of 5 related genesLCP1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Schizophrenia	1	["CHST2"]
Obesity	1	["DDX60L"]
Psoriasis	1	["DDX60L"]
Scoliosis	1	["DDX60L"]
Alzheimer disease	1	["LCP1"]