EFNA4 (ephrin A4)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 1945
• Gene name: Ephrin A4
• Gene symbol: EFNA4
• Synonyms (NCBI Gene): EFL4, EPLG4, LERK-4, LERK4
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system a

miRNA Show/Hide all (77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029402	hsa-miR-26b-5p	Microarray	19088304
MIRT2217410	hsa-miR-1207-3p	CLIP-seq
MIRT2217411	hsa-miR-361-3p	CLIP-seq
MIRT2521290	hsa-miR-146b-3p	CLIP-seq
MIRT2521291	hsa-miR-18a	CLIP-seq
MIRT2521292	hsa-miR-18b	CLIP-seq
MIRT2521293	hsa-miR-1913	CLIP-seq
MIRT2521294	hsa-miR-1915	CLIP-seq
MIRT2521295	hsa-miR-2278	CLIP-seq
MIRT2521296	hsa-miR-3150a-3p	CLIP-seq
MIRT2521297	hsa-miR-3152-5p	CLIP-seq
MIRT2521298	hsa-miR-3157-3p	CLIP-seq
MIRT2521299	hsa-miR-3173-5p	CLIP-seq
MIRT2521300	hsa-miR-3175	CLIP-seq
MIRT2521301	hsa-miR-3189-5p	CLIP-seq
MIRT2521302	hsa-miR-324-3p	CLIP-seq
MIRT2521303	hsa-miR-331-3p	CLIP-seq
MIRT2521304	hsa-miR-338-3p	CLIP-seq
MIRT2521305	hsa-miR-3616-3p	CLIP-seq
MIRT2521306	hsa-miR-3977	CLIP-seq
MIRT2521307	hsa-miR-4292	CLIP-seq
MIRT2521308	hsa-miR-431	CLIP-seq
MIRT2521309	hsa-miR-4530	CLIP-seq
MIRT2521310	hsa-miR-4659a-3p	CLIP-seq
MIRT2521311	hsa-miR-4659b-3p	CLIP-seq
MIRT2521312	hsa-miR-4667-5p	CLIP-seq
MIRT2521313	hsa-miR-4668-5p	CLIP-seq
MIRT2521314	hsa-miR-4700-5p	CLIP-seq
MIRT2521315	hsa-miR-4728-5p	CLIP-seq
MIRT2521316	hsa-miR-4735-3p	CLIP-seq
MIRT2521317	hsa-miR-4758-3p	CLIP-seq
MIRT2521318	hsa-miR-4761-5p	CLIP-seq
MIRT2521319	hsa-miR-4778-3p	CLIP-seq
MIRT2521320	hsa-miR-4786-5p	CLIP-seq
MIRT2521321	hsa-miR-511	CLIP-seq
MIRT2521322	hsa-miR-518a-3p	CLIP-seq
MIRT2521323	hsa-miR-518a-5p	CLIP-seq
MIRT2521324	hsa-miR-518b	CLIP-seq
MIRT2521325	hsa-miR-518c	CLIP-seq
MIRT2521326	hsa-miR-518d-3p	CLIP-seq
MIRT2521327	hsa-miR-518f	CLIP-seq
MIRT2521328	hsa-miR-527	CLIP-seq
MIRT2521329	hsa-miR-596	CLIP-seq
MIRT2521330	hsa-miR-759	CLIP-seq
MIRT2521331	hsa-miR-769-5p	CLIP-seq
MIRT2521332	hsa-miR-874	CLIP-seq
MIRT2521333	hsa-miR-939	CLIP-seq
MIRT2521291	hsa-miR-18a	CLIP-seq
MIRT2521292	hsa-miR-18b	CLIP-seq
MIRT2521293	hsa-miR-1913	CLIP-seq
MIRT2521294	hsa-miR-1915	CLIP-seq
MIRT2521295	hsa-miR-2278	CLIP-seq
MIRT2521296	hsa-miR-3150a-3p	CLIP-seq
MIRT2521300	hsa-miR-3175	CLIP-seq
MIRT2521301	hsa-miR-3189-5p	CLIP-seq
MIRT2521302	hsa-miR-324-3p	CLIP-seq
MIRT2521303	hsa-miR-331-3p	CLIP-seq
MIRT2521305	hsa-miR-3616-3p	CLIP-seq
MIRT2521307	hsa-miR-4292	CLIP-seq
MIRT2521312	hsa-miR-4667-5p	CLIP-seq
MIRT2521313	hsa-miR-4668-5p	CLIP-seq
MIRT2521314	hsa-miR-4700-5p	CLIP-seq
MIRT2521315	hsa-miR-4728-5p	CLIP-seq
MIRT2521316	hsa-miR-4735-3p	CLIP-seq
MIRT2521317	hsa-miR-4758-3p	CLIP-seq
MIRT2521318	hsa-miR-4761-5p	CLIP-seq
MIRT2521320	hsa-miR-4786-5p	CLIP-seq
MIRT2521322	hsa-miR-518a-3p	CLIP-seq
MIRT2521323	hsa-miR-518a-5p	CLIP-seq
MIRT2521324	hsa-miR-518b	CLIP-seq
MIRT2521325	hsa-miR-518c	CLIP-seq
MIRT2521326	hsa-miR-518d-3p	CLIP-seq
MIRT2521327	hsa-miR-518f	CLIP-seq
MIRT2521328	hsa-miR-527	CLIP-seq
MIRT2521329	hsa-miR-596	CLIP-seq
MIRT2521331	hsa-miR-769-5p	CLIP-seq
MIRT2521333	hsa-miR-939	CLIP-seq

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005005	Function	Transmembrane-ephrin receptor activity	TAS	8660976
GO:0005515	Function	Protein binding	IPI	15777695, 19836338, 32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8660976
GO:0007267	Process	Cell-cell signaling	TAS	8660976
GO:0007411	Process	Axon guidance	IBA
GO:0016020	Component	Membrane	IEA
GO:0046875	Function	Ephrin receptor binding	IBA
GO:0046875	Function	Ephrin receptor binding	IEA
GO:0046875	Function	Ephrin receptor binding	IPI	11519828, 15777695
GO:0048013	Process	Ephrin receptor signaling pathway	IBA
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0098552	Component	Side of membrane	IEA

Other IDs

• MIM: 601380
• HGNC: 3224
• e!Ensembl: ENSG00000243364

Protein

• UniProt ID: P52798
• Protein name: Ephrin-A4 (EPH-related receptor tyrosine kinase ligand 4) (LERK-4)
• Protein function: Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on ad
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00812	Ephrin	25 → 156	Ephrin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the adult spleen, lymph node, prostate, ovary, small intestine, and colon, and in fetal heart, lung, liver and kidney. Also detected in hematopoietic cell lines.
• Sequence:

  MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPH
  YEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSL
  GFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDT
  PSPLCLLLLLLLLILRLLRIL

• Sequence length: 201

Pathways

KEGG Pathway	Reactome Pathway
MAPK signaling pathway	EPH-Ephrin signaling
Ras signaling pathway	EPHA-mediated growth cone collapse
Rap1 signaling pathway	EPH-ephrin mediated repulsion of cells
PI3K-Akt signaling pathway
Axon guidance
MicroRNAs in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Cervical cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	37398645	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (15)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	28851287		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33977106	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28669080, 36404439	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18819711		★☆☆☆☆ Found in Text Mining only
Craniofrontonasal dysplasia	Craniofrontonasal Dysplasia	BEFREE	28135115		★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	29215649, 36140816	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	16540516, 28135115		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	20462350		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20071790	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	25258252	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30680712		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	12209731, 20071790	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35918384	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30680712		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	20462350		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

EFNA1 7 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Axon guidance, EPH-ephrin mediated repulsion of cells, EPH-Ephrin signaling, EPHA-mediated growth cone collapse Related via 7 shared pathways including MAPK signaling pathway, Ras signaling pathway. EFNA2 7 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Axon guidance, EPH-ephrin mediated repulsion of cells, EPH-Ephrin signaling, EPHA-mediated growth cone collapse Related via 7 shared pathways including MAPK signaling pathway, Ras signaling pathway. EFNA3 7 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Axon guidance, EPH-ephrin mediated repulsion of cells, EPH-Ephrin signaling, EPHA-mediated growth cone collapse Related via 7 shared pathways including MAPK signaling pathway, Ras signaling pathway. EFNA5 7 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Axon guidance, EPH-ephrin mediated repulsion of cells, EPH-Ephrin signaling, EPHA-mediated growth cone collapse Related via 7 shared pathways including MAPK signaling pathway, Ras signaling pathway. EPHA2 7 shared pathwaysMAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Axon guidance, EPH-ephrin mediated repulsion of cells, EPH-Ephrin signaling, EPHA-mediated growth cone collapse Related via 7 shared pathways including MAPK signaling pathway, Ras signaling pathway.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
EFNA1	0	[]	7	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Axon guidance","EPH-ephrin mediated repulsion of cells","EPH-Ephrin signaling","EPHA-mediated growth cone collapse"]	0	[]
EFNA2	0	[]	7	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Axon guidance","EPH-ephrin mediated repulsion of cells","EPH-Ephrin signaling","EPHA-mediated growth cone collapse"]	0	[]
EFNA3	0	[]	7	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Axon guidance","EPH-ephrin mediated repulsion of cells","EPH-Ephrin signaling","EPHA-mediated growth cone collapse"]	0	[]
EFNA5	0	[]	7	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Axon guidance","EPH-ephrin mediated repulsion of cells","EPH-Ephrin signaling","EPHA-mediated growth cone collapse"]	0	[]
EPHA2	0	[]	7	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Axon guidance","EPH-ephrin mediated repulsion of cells","EPH-Ephrin signaling","EPHA-mediated growth cone collapse"]	0	[]

Diseases Linked via Similar Genes

Cataract Linked via 3 of 5 related genesEFNA3, EFNA5, EPHA2 Nonalcoholic fatty liver disease Linked via 2 of 5 related genesEFNA3, EPHA2 Schizophrenia Linked via 2 of 5 related genesEFNA3, EFNA5 Bladder exstrophy Linked via 1 of 5 related genesEFNA1 Breast neoplasms Linked via 1 of 5 related genesEFNA1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Cataract	3	["EFNA3","EFNA5","EPHA2"]
Nonalcoholic fatty liver disease	2	["EFNA3","EPHA2"]
Schizophrenia	2	["EFNA3","EFNA5"]
Bladder exstrophy	1	["EFNA1"]
Breast neoplasms	1	["EFNA1"]