Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	1969
Gene name	EPH receptor A2
Gene symbol	EPHA2
Synonyms (NCBI Gene)	ARCC2CTPACTPP1CTRCT6ECK
Chromosome	1
Chromosome location	1p36.13
Summary	This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically ha

9 Show/Hide all (9)

SNP ID	Visualize variation	Clinical significance	Consequence
rs34192549	C>G,T	Likely-pathogenic, benign	Coding sequence variant, missense variant
rs116506614	C>T	Likely-pathogenic, pathogenic, likely-benign	Genic downstream transcript variant, missense variant, coding sequence variant
rs137853199	C>A	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs137853200	G>A	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs145592908	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, genic downstream transcript variant, missense variant
rs786205441	C>A	Likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs886041412	C>T	Pathogenic	Genic downstream transcript variant, intron variant
rs1569602837	C>T	Pathogenic	Stop gained, coding sequence variant
rs1570403798	C>T	Likely-pathogenic	Splice donor variant

670 Show/Hide all (670)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005508	hsa-miR-26b-5p	Luciferase reporter assayqRT-PCRWestern blot	21264258
MIRT016375	hsa-miR-193b-3p	Microarray	20304954
MIRT025420	hsa-miR-34a-5p	Proteomics	21566225
MIRT025420	hsa-miR-34a-5p	Proteomics	21566225
MIRT031603	hsa-miR-16-5p	Proteomics	18668040
MIRT036589	hsa-miR-940	CLASH	23622248
MIRT036589	hsa-miR-940	CLASH	23622248
MIRT054131	hsa-miR-520d-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25063221
MIRT054131	hsa-miR-520d-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25063221
MIRT054131	hsa-miR-520d-3p	ImmunoblotLuciferase reporter assayqRT-PCRWestern blot	24002999
MIRT054131	hsa-miR-520d-3p	ImmunoblotLuciferase reporter assayqRT-PCRWestern blot	24002999
MIRT502531	hsa-miR-141-3p	PAR-CLIP	22012620
MIRT502530	hsa-miR-200a-3p	PAR-CLIP	22012620
MIRT502529	hsa-miR-888-3p	PAR-CLIP	22012620
MIRT502527	hsa-miR-8063	PAR-CLIP	22012620
MIRT502528	hsa-miR-3660	PAR-CLIP	22012620
MIRT502526	hsa-miR-4526	PAR-CLIP	22012620
MIRT502525	hsa-miR-302b-5p	PAR-CLIP	22012620
MIRT502524	hsa-miR-302d-5p	PAR-CLIP	22012620
MIRT537665	hsa-miR-1255a	PAR-CLIP	22012620
MIRT537664	hsa-miR-1255b-5p	PAR-CLIP	22012620
MIRT502523	hsa-miR-302c-5p	PAR-CLIP	22012620
MIRT502531	hsa-miR-141-3p	PAR-CLIP	24398324
MIRT502530	hsa-miR-200a-3p	PAR-CLIP	24398324
MIRT502529	hsa-miR-888-3p	PAR-CLIP	24398324
MIRT502527	hsa-miR-8063	PAR-CLIP	24398324
MIRT502528	hsa-miR-3660	PAR-CLIP	24398324
MIRT502526	hsa-miR-4526	PAR-CLIP	24398324
MIRT502525	hsa-miR-302b-5p	PAR-CLIP	24398324
MIRT502524	hsa-miR-302d-5p	PAR-CLIP	24398324
MIRT502523	hsa-miR-302c-5p	PAR-CLIP	24398324
MIRT477338	hsa-miR-124-3p	PAR-CLIP	23592263
MIRT477336	hsa-miR-3133	PAR-CLIP	23592263
MIRT477337	hsa-miR-186-5p	PAR-CLIP	23592263
MIRT477335	hsa-miR-2392	PAR-CLIP	23592263
MIRT477333	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT477334	hsa-miR-1182	PAR-CLIP	23592263
MIRT477332	hsa-miR-211-3p	PAR-CLIP	23592263
MIRT477330	hsa-miR-4270	PAR-CLIP	23592263
MIRT477331	hsa-miR-4441	PAR-CLIP	23592263
MIRT477329	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT477328	hsa-miR-4744	PAR-CLIP	23592263
MIRT477327	hsa-miR-4509	PAR-CLIP	23592263
MIRT477326	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT477325	hsa-miR-1185-5p	PAR-CLIP	23592263
MIRT477324	hsa-miR-3679-5p	PAR-CLIP	23592263
MIRT477323	hsa-miR-3605-5p	PAR-CLIP	23592263
MIRT477322	hsa-miR-5187-5p	PAR-CLIP	23592263
MIRT477321	hsa-miR-548s	PAR-CLIP	23592263
MIRT477320	hsa-miR-4701-5p	PAR-CLIP	23592263
MIRT477319	hsa-miR-588	PAR-CLIP	23592263
MIRT477318	hsa-miR-4435	PAR-CLIP	23592263
MIRT477316	hsa-miR-3187-3p	PAR-CLIP	23592263
MIRT477317	hsa-miR-1227-5p	PAR-CLIP	23592263
MIRT005508	hsa-miR-26b-5p	Luciferase reporter assay	26843134
MIRT005508	hsa-miR-26b-5p	Luciferase reporter assayqRT-PCRWestern blot	26191168
MIRT005508	hsa-miR-26b-5p	Luciferase reporter assayqRT-PCRWestern blot	27746866
MIRT005508	hsa-miR-26b-5p	Luciferase reporter assayqRT-PCRWestern blot	27746866
MIRT477334	hsa-miR-1182	PAR-CLIP	26701625
MIRT477334	hsa-miR-1182	PAR-CLIP	26701625
MIRT477334	hsa-miR-1182	PAR-CLIP	26701625
MIRT477334	hsa-miR-1182	PAR-CLIP	26701625
MIRT477334	hsa-miR-1182	PAR-CLIP	26701625
MIRT477334	hsa-miR-1182	PAR-CLIP	26701625
MIRT477334	hsa-miR-1182	PAR-CLIP	26701625
MIRT477334	hsa-miR-1182	PAR-CLIP	26701625
MIRT477334	hsa-miR-1182	PAR-CLIP	26701625
MIRT477334	hsa-miR-1182	PAR-CLIP	26701625
MIRT477334	hsa-miR-1182	PAR-CLIP	26701625
MIRT477334	hsa-miR-1182	PAR-CLIP	26701625
MIRT477334	hsa-miR-1182	PAR-CLIP	26701625
MIRT477334	hsa-miR-1182	PAR-CLIP	26701625
MIRT477325	hsa-miR-1185-5p	PAR-CLIP	26701625
MIRT477325	hsa-miR-1185-5p	PAR-CLIP	26701625
MIRT477325	hsa-miR-1185-5p	PAR-CLIP	26701625
MIRT477325	hsa-miR-1185-5p	PAR-CLIP	26701625
MIRT477325	hsa-miR-1185-5p	PAR-CLIP	26701625
MIRT477325	hsa-miR-1185-5p	PAR-CLIP	26701625
MIRT477325	hsa-miR-1185-5p	PAR-CLIP	26701625
MIRT477325	hsa-miR-1185-5p	PAR-CLIP	26701625
MIRT477325	hsa-miR-1185-5p	PAR-CLIP	26701625
MIRT477325	hsa-miR-1185-5p	PAR-CLIP	26701625
MIRT477325	hsa-miR-1185-5p	PAR-CLIP	26701625
MIRT477325	hsa-miR-1185-5p	PAR-CLIP	26701625
MIRT477325	hsa-miR-1185-5p	PAR-CLIP	26701625
MIRT477325	hsa-miR-1185-5p	PAR-CLIP	26701625
MIRT477317	hsa-miR-1227-5p	PAR-CLIP	26701625
MIRT477317	hsa-miR-1227-5p	PAR-CLIP	26701625
MIRT477317	hsa-miR-1227-5p	PAR-CLIP	26701625
MIRT477317	hsa-miR-1227-5p	PAR-CLIP	26701625
MIRT477317	hsa-miR-1227-5p	PAR-CLIP	26701625
MIRT477317	hsa-miR-1227-5p	PAR-CLIP	26701625
MIRT477317	hsa-miR-1227-5p	PAR-CLIP	26701625
MIRT477317	hsa-miR-1227-5p	PAR-CLIP	26701625
MIRT477317	hsa-miR-1227-5p	PAR-CLIP	26701625
MIRT477317	hsa-miR-1227-5p	PAR-CLIP	26701625
MIRT477317	hsa-miR-1227-5p	PAR-CLIP	26701625
MIRT477317	hsa-miR-1227-5p	PAR-CLIP	26701625
MIRT477317	hsa-miR-1227-5p	PAR-CLIP	26701625
MIRT477317	hsa-miR-1227-5p	PAR-CLIP	26701625
MIRT477317	hsa-miR-1227-5p	PAR-CLIP	26701625
MIRT477338	hsa-miR-124-3p	PAR-CLIP	26701625
MIRT477338	hsa-miR-124-3p	PAR-CLIP	26701625
MIRT477338	hsa-miR-124-3p	PAR-CLIP	26701625
MIRT477338	hsa-miR-124-3p	PAR-CLIP	26701625
MIRT477338	hsa-miR-124-3p	PAR-CLIP	26701625
MIRT477338	hsa-miR-124-3p	PAR-CLIP	26701625
MIRT477338	hsa-miR-124-3p	PAR-CLIP	26701625
MIRT477338	hsa-miR-124-3p	PAR-CLIP	26701625
MIRT477338	hsa-miR-124-3p	PAR-CLIP	26701625
MIRT477338	hsa-miR-124-3p	PAR-CLIP	26701625
MIRT477338	hsa-miR-124-3p	PAR-CLIP	26701625
MIRT477338	hsa-miR-124-3p	PAR-CLIP	26701625
MIRT477338	hsa-miR-124-3p	PAR-CLIP	26701625
MIRT477338	hsa-miR-124-3p	PAR-CLIP	26701625
MIRT537665	hsa-miR-1255a	PAR-CLIP	26701625
MIRT537665	hsa-miR-1255a	PAR-CLIP	26701625
MIRT537665	hsa-miR-1255a	PAR-CLIP	26701625
MIRT537665	hsa-miR-1255a	PAR-CLIP	26701625
MIRT537665	hsa-miR-1255a	PAR-CLIP	26701625
MIRT537665	hsa-miR-1255a	PAR-CLIP	26701625
MIRT537665	hsa-miR-1255a	PAR-CLIP	26701625
MIRT537664	hsa-miR-1255b-5p	PAR-CLIP	26701625
MIRT537664	hsa-miR-1255b-5p	PAR-CLIP	26701625
MIRT537664	hsa-miR-1255b-5p	PAR-CLIP	26701625
MIRT537664	hsa-miR-1255b-5p	PAR-CLIP	26701625
MIRT537664	hsa-miR-1255b-5p	PAR-CLIP	26701625
MIRT537664	hsa-miR-1255b-5p	PAR-CLIP	26701625
MIRT537664	hsa-miR-1255b-5p	PAR-CLIP	26701625
MIRT502531	hsa-miR-141-3p	PAR-CLIP	26701625
MIRT502531	hsa-miR-141-3p	PAR-CLIP	26701625
MIRT502531	hsa-miR-141-3p	PAR-CLIP	26701625
MIRT502531	hsa-miR-141-3p	PAR-CLIP	26701625
MIRT502531	hsa-miR-141-3p	PAR-CLIP	26701625
MIRT502531	hsa-miR-141-3p	PAR-CLIP	26701625
MIRT502531	hsa-miR-141-3p	PAR-CLIP	26701625
MIRT502531	hsa-miR-141-3p	PAR-CLIP	26701625
MIRT502531	hsa-miR-141-3p	PAR-CLIP	26701625
MIRT477337	hsa-miR-186-5p	PAR-CLIP	26701625
MIRT477337	hsa-miR-186-5p	PAR-CLIP	26701625
MIRT477337	hsa-miR-186-5p	PAR-CLIP	26701625
MIRT477337	hsa-miR-186-5p	PAR-CLIP	26701625
MIRT477337	hsa-miR-186-5p	PAR-CLIP	26701625
MIRT477337	hsa-miR-186-5p	PAR-CLIP	26701625
MIRT477337	hsa-miR-186-5p	PAR-CLIP	26701625
MIRT477337	hsa-miR-186-5p	PAR-CLIP	26701625
MIRT477337	hsa-miR-186-5p	PAR-CLIP	26701625
MIRT477337	hsa-miR-186-5p	PAR-CLIP	26701625
MIRT477337	hsa-miR-186-5p	PAR-CLIP	26701625
MIRT477337	hsa-miR-186-5p	PAR-CLIP	26701625
MIRT477337	hsa-miR-186-5p	PAR-CLIP	26701625
MIRT477337	hsa-miR-186-5p	PAR-CLIP	26701625
MIRT502530	hsa-miR-200a-3p	PAR-CLIP	26701625
MIRT502530	hsa-miR-200a-3p	PAR-CLIP	26701625
MIRT502530	hsa-miR-200a-3p	PAR-CLIP	26701625
MIRT502530	hsa-miR-200a-3p	PAR-CLIP	26701625
MIRT502530	hsa-miR-200a-3p	PAR-CLIP	26701625
MIRT502530	hsa-miR-200a-3p	PAR-CLIP	26701625
MIRT502530	hsa-miR-200a-3p	PAR-CLIP	26701625
MIRT502530	hsa-miR-200a-3p	PAR-CLIP	26701625
MIRT502530	hsa-miR-200a-3p	PAR-CLIP	26701625
MIRT477332	hsa-miR-211-3p	PAR-CLIP	26701625
MIRT477332	hsa-miR-211-3p	PAR-CLIP	26701625
MIRT477332	hsa-miR-211-3p	PAR-CLIP	26701625
MIRT477332	hsa-miR-211-3p	PAR-CLIP	26701625
MIRT477332	hsa-miR-211-3p	PAR-CLIP	26701625
MIRT477332	hsa-miR-211-3p	PAR-CLIP	26701625
MIRT477332	hsa-miR-211-3p	PAR-CLIP	26701625
MIRT477332	hsa-miR-211-3p	PAR-CLIP	26701625
MIRT477332	hsa-miR-211-3p	PAR-CLIP	26701625
MIRT477332	hsa-miR-211-3p	PAR-CLIP	26701625
MIRT477332	hsa-miR-211-3p	PAR-CLIP	26701625
MIRT477332	hsa-miR-211-3p	PAR-CLIP	26701625
MIRT477332	hsa-miR-211-3p	PAR-CLIP	26701625
MIRT477332	hsa-miR-211-3p	PAR-CLIP	26701625
MIRT477335	hsa-miR-2392	PAR-CLIP	26701625
MIRT477335	hsa-miR-2392	PAR-CLIP	26701625
MIRT477335	hsa-miR-2392	PAR-CLIP	26701625
MIRT477335	hsa-miR-2392	PAR-CLIP	26701625
MIRT477335	hsa-miR-2392	PAR-CLIP	26701625
MIRT477335	hsa-miR-2392	PAR-CLIP	26701625
MIRT477335	hsa-miR-2392	PAR-CLIP	26701625
MIRT477335	hsa-miR-2392	PAR-CLIP	26701625
MIRT477335	hsa-miR-2392	PAR-CLIP	26701625
MIRT477335	hsa-miR-2392	PAR-CLIP	26701625
MIRT477335	hsa-miR-2392	PAR-CLIP	26701625
MIRT477335	hsa-miR-2392	PAR-CLIP	26701625
MIRT477335	hsa-miR-2392	PAR-CLIP	26701625
MIRT477335	hsa-miR-2392	PAR-CLIP	26701625
MIRT502525	hsa-miR-302b-5p	PAR-CLIP	26701625
MIRT502525	hsa-miR-302b-5p	PAR-CLIP	26701625
MIRT502525	hsa-miR-302b-5p	PAR-CLIP	26701625
MIRT502525	hsa-miR-302b-5p	PAR-CLIP	26701625
MIRT502525	hsa-miR-302b-5p	PAR-CLIP	26701625
MIRT502525	hsa-miR-302b-5p	PAR-CLIP	26701625
MIRT502525	hsa-miR-302b-5p	PAR-CLIP	26701625
MIRT502525	hsa-miR-302b-5p	PAR-CLIP	26701625
MIRT502525	hsa-miR-302b-5p	PAR-CLIP	26701625
MIRT502523	hsa-miR-302c-5p	PAR-CLIP	26701625
MIRT502523	hsa-miR-302c-5p	PAR-CLIP	26701625
MIRT502523	hsa-miR-302c-5p	PAR-CLIP	26701625
MIRT502523	hsa-miR-302c-5p	PAR-CLIP	26701625
MIRT502523	hsa-miR-302c-5p	PAR-CLIP	26701625
MIRT502523	hsa-miR-302c-5p	PAR-CLIP	26701625
MIRT502523	hsa-miR-302c-5p	PAR-CLIP	26701625
MIRT502523	hsa-miR-302c-5p	PAR-CLIP	26701625
MIRT502523	hsa-miR-302c-5p	PAR-CLIP	26701625
MIRT502524	hsa-miR-302d-5p	PAR-CLIP	26701625
MIRT502524	hsa-miR-302d-5p	PAR-CLIP	26701625
MIRT502524	hsa-miR-302d-5p	PAR-CLIP	26701625
MIRT502524	hsa-miR-302d-5p	PAR-CLIP	26701625
MIRT502524	hsa-miR-302d-5p	PAR-CLIP	26701625
MIRT502524	hsa-miR-302d-5p	PAR-CLIP	26701625
MIRT502524	hsa-miR-302d-5p	PAR-CLIP	26701625
MIRT502524	hsa-miR-302d-5p	PAR-CLIP	26701625
MIRT502524	hsa-miR-302d-5p	PAR-CLIP	26701625
MIRT477336	hsa-miR-3133	PAR-CLIP	26701625
MIRT477336	hsa-miR-3133	PAR-CLIP	26701625
MIRT477336	hsa-miR-3133	PAR-CLIP	26701625
MIRT477336	hsa-miR-3133	PAR-CLIP	26701625
MIRT477336	hsa-miR-3133	PAR-CLIP	26701625
MIRT477336	hsa-miR-3133	PAR-CLIP	26701625
MIRT477336	hsa-miR-3133	PAR-CLIP	26701625
MIRT477336	hsa-miR-3133	PAR-CLIP	26701625
MIRT477336	hsa-miR-3133	PAR-CLIP	26701625
MIRT477336	hsa-miR-3133	PAR-CLIP	26701625
MIRT477336	hsa-miR-3133	PAR-CLIP	26701625
MIRT477316	hsa-miR-3187-3p	PAR-CLIP	26701625
MIRT477316	hsa-miR-3187-3p	PAR-CLIP	26701625
MIRT477316	hsa-miR-3187-3p	PAR-CLIP	26701625
MIRT477316	hsa-miR-3187-3p	PAR-CLIP	26701625
MIRT477316	hsa-miR-3187-3p	PAR-CLIP	26701625
MIRT477316	hsa-miR-3187-3p	PAR-CLIP	26701625
MIRT477316	hsa-miR-3187-3p	PAR-CLIP	26701625
MIRT477316	hsa-miR-3187-3p	PAR-CLIP	26701625
MIRT477316	hsa-miR-3187-3p	PAR-CLIP	26701625
MIRT477316	hsa-miR-3187-3p	PAR-CLIP	26701625
MIRT477316	hsa-miR-3187-3p	PAR-CLIP	26701625
MIRT477316	hsa-miR-3187-3p	PAR-CLIP	26701625
MIRT477316	hsa-miR-3187-3p	PAR-CLIP	26701625
MIRT477323	hsa-miR-3605-5p	PAR-CLIP	26701625
MIRT477323	hsa-miR-3605-5p	PAR-CLIP	26701625
MIRT477323	hsa-miR-3605-5p	PAR-CLIP	26701625
MIRT477323	hsa-miR-3605-5p	PAR-CLIP	26701625
MIRT477323	hsa-miR-3605-5p	PAR-CLIP	26701625
MIRT477323	hsa-miR-3605-5p	PAR-CLIP	26701625
MIRT477323	hsa-miR-3605-5p	PAR-CLIP	26701625
MIRT477323	hsa-miR-3605-5p	PAR-CLIP	26701625
MIRT477323	hsa-miR-3605-5p	PAR-CLIP	26701625
MIRT477323	hsa-miR-3605-5p	PAR-CLIP	26701625
MIRT477323	hsa-miR-3605-5p	PAR-CLIP	26701625
MIRT477323	hsa-miR-3605-5p	PAR-CLIP	26701625
MIRT477323	hsa-miR-3605-5p	PAR-CLIP	26701625
MIRT477323	hsa-miR-3605-5p	PAR-CLIP	26701625
MIRT502528	hsa-miR-3660	PAR-CLIP	26701625
MIRT502528	hsa-miR-3660	PAR-CLIP	26701625
MIRT502528	hsa-miR-3660	PAR-CLIP	26701625
MIRT502528	hsa-miR-3660	PAR-CLIP	26701625
MIRT502528	hsa-miR-3660	PAR-CLIP	26701625
MIRT502528	hsa-miR-3660	PAR-CLIP	26701625
MIRT502528	hsa-miR-3660	PAR-CLIP	26701625
MIRT502528	hsa-miR-3660	PAR-CLIP	26701625
MIRT502528	hsa-miR-3660	PAR-CLIP	26701625
MIRT477324	hsa-miR-3679-5p	PAR-CLIP	26701625
MIRT477324	hsa-miR-3679-5p	PAR-CLIP	26701625
MIRT477324	hsa-miR-3679-5p	PAR-CLIP	26701625
MIRT477324	hsa-miR-3679-5p	PAR-CLIP	26701625
MIRT477324	hsa-miR-3679-5p	PAR-CLIP	26701625
MIRT477324	hsa-miR-3679-5p	PAR-CLIP	26701625
MIRT477324	hsa-miR-3679-5p	PAR-CLIP	26701625
MIRT477324	hsa-miR-3679-5p	PAR-CLIP	26701625
MIRT477324	hsa-miR-3679-5p	PAR-CLIP	26701625
MIRT477324	hsa-miR-3679-5p	PAR-CLIP	26701625
MIRT477324	hsa-miR-3679-5p	PAR-CLIP	26701625
MIRT477324	hsa-miR-3679-5p	PAR-CLIP	26701625
MIRT477324	hsa-miR-3679-5p	PAR-CLIP	26701625
MIRT477324	hsa-miR-3679-5p	PAR-CLIP	26701625
MIRT477330	hsa-miR-4270	PAR-CLIP	26701625
MIRT477330	hsa-miR-4270	PAR-CLIP	26701625
MIRT477330	hsa-miR-4270	PAR-CLIP	26701625
MIRT477330	hsa-miR-4270	PAR-CLIP	26701625
MIRT477330	hsa-miR-4270	PAR-CLIP	26701625
MIRT477330	hsa-miR-4270	PAR-CLIP	26701625
MIRT477330	hsa-miR-4270	PAR-CLIP	26701625
MIRT477330	hsa-miR-4270	PAR-CLIP	26701625
MIRT477330	hsa-miR-4270	PAR-CLIP	26701625
MIRT477330	hsa-miR-4270	PAR-CLIP	26701625
MIRT477330	hsa-miR-4270	PAR-CLIP	26701625
MIRT477330	hsa-miR-4270	PAR-CLIP	26701625
MIRT477318	hsa-miR-4435	PAR-CLIP	26701625
MIRT477318	hsa-miR-4435	PAR-CLIP	26701625
MIRT477318	hsa-miR-4435	PAR-CLIP	26701625
MIRT477318	hsa-miR-4435	PAR-CLIP	26701625
MIRT477318	hsa-miR-4435	PAR-CLIP	26701625
MIRT477318	hsa-miR-4435	PAR-CLIP	26701625
MIRT477318	hsa-miR-4435	PAR-CLIP	26701625
MIRT477318	hsa-miR-4435	PAR-CLIP	26701625
MIRT477318	hsa-miR-4435	PAR-CLIP	26701625
MIRT477318	hsa-miR-4435	PAR-CLIP	26701625
MIRT477318	hsa-miR-4435	PAR-CLIP	26701625
MIRT477318	hsa-miR-4435	PAR-CLIP	26701625
MIRT477318	hsa-miR-4435	PAR-CLIP	26701625
MIRT477331	hsa-miR-4441	PAR-CLIP	26701625
MIRT477331	hsa-miR-4441	PAR-CLIP	26701625
MIRT477331	hsa-miR-4441	PAR-CLIP	26701625
MIRT477331	hsa-miR-4441	PAR-CLIP	26701625
MIRT477331	hsa-miR-4441	PAR-CLIP	26701625
MIRT477331	hsa-miR-4441	PAR-CLIP	26701625
MIRT477331	hsa-miR-4441	PAR-CLIP	26701625
MIRT477331	hsa-miR-4441	PAR-CLIP	26701625
MIRT477331	hsa-miR-4441	PAR-CLIP	26701625
MIRT477331	hsa-miR-4441	PAR-CLIP	26701625
MIRT477331	hsa-miR-4441	PAR-CLIP	26701625
MIRT477331	hsa-miR-4441	PAR-CLIP	26701625
MIRT477327	hsa-miR-4509	PAR-CLIP	26701625
MIRT477327	hsa-miR-4509	PAR-CLIP	26701625
MIRT477327	hsa-miR-4509	PAR-CLIP	26701625
MIRT477327	hsa-miR-4509	PAR-CLIP	26701625
MIRT477327	hsa-miR-4509	PAR-CLIP	26701625
MIRT477327	hsa-miR-4509	PAR-CLIP	26701625
MIRT477327	hsa-miR-4509	PAR-CLIP	26701625
MIRT477327	hsa-miR-4509	PAR-CLIP	26701625
MIRT477327	hsa-miR-4509	PAR-CLIP	26701625
MIRT477327	hsa-miR-4509	PAR-CLIP	26701625
MIRT477327	hsa-miR-4509	PAR-CLIP	26701625
MIRT477327	hsa-miR-4509	PAR-CLIP	26701625
MIRT477327	hsa-miR-4509	PAR-CLIP	26701625
MIRT477327	hsa-miR-4509	PAR-CLIP	26701625
MIRT502526	hsa-miR-4526	PAR-CLIP	26701625
MIRT502526	hsa-miR-4526	PAR-CLIP	26701625
MIRT502526	hsa-miR-4526	PAR-CLIP	26701625
MIRT502526	hsa-miR-4526	PAR-CLIP	26701625
MIRT502526	hsa-miR-4526	PAR-CLIP	26701625
MIRT502526	hsa-miR-4526	PAR-CLIP	26701625
MIRT502526	hsa-miR-4526	PAR-CLIP	26701625
MIRT502526	hsa-miR-4526	PAR-CLIP	26701625
MIRT502526	hsa-miR-4526	PAR-CLIP	26701625
MIRT477320	hsa-miR-4701-5p	PAR-CLIP	26701625
MIRT477320	hsa-miR-4701-5p	PAR-CLIP	26701625
MIRT477320	hsa-miR-4701-5p	PAR-CLIP	26701625
MIRT477320	hsa-miR-4701-5p	PAR-CLIP	26701625
MIRT477320	hsa-miR-4701-5p	PAR-CLIP	26701625
MIRT477320	hsa-miR-4701-5p	PAR-CLIP	26701625
MIRT477320	hsa-miR-4701-5p	PAR-CLIP	26701625
MIRT477320	hsa-miR-4701-5p	PAR-CLIP	26701625
MIRT477320	hsa-miR-4701-5p	PAR-CLIP	26701625
MIRT477320	hsa-miR-4701-5p	PAR-CLIP	26701625
MIRT477320	hsa-miR-4701-5p	PAR-CLIP	26701625
MIRT477320	hsa-miR-4701-5p	PAR-CLIP	26701625
MIRT477320	hsa-miR-4701-5p	PAR-CLIP	26701625
MIRT477328	hsa-miR-4744	PAR-CLIP	26701625
MIRT477328	hsa-miR-4744	PAR-CLIP	26701625
MIRT477328	hsa-miR-4744	PAR-CLIP	26701625
MIRT477328	hsa-miR-4744	PAR-CLIP	26701625
MIRT477328	hsa-miR-4744	PAR-CLIP	26701625
MIRT477328	hsa-miR-4744	PAR-CLIP	26701625
MIRT477328	hsa-miR-4744	PAR-CLIP	26701625
MIRT477328	hsa-miR-4744	PAR-CLIP	26701625
MIRT477328	hsa-miR-4744	PAR-CLIP	26701625
MIRT477328	hsa-miR-4744	PAR-CLIP	26701625
MIRT477328	hsa-miR-4744	PAR-CLIP	26701625
MIRT477328	hsa-miR-4744	PAR-CLIP	26701625
MIRT477328	hsa-miR-4744	PAR-CLIP	26701625
MIRT477328	hsa-miR-4744	PAR-CLIP	26701625
MIRT477322	hsa-miR-5187-5p	PAR-CLIP	26701625
MIRT477322	hsa-miR-5187-5p	PAR-CLIP	26701625
MIRT477322	hsa-miR-5187-5p	PAR-CLIP	26701625
MIRT477322	hsa-miR-5187-5p	PAR-CLIP	26701625
MIRT477322	hsa-miR-5187-5p	PAR-CLIP	26701625
MIRT477322	hsa-miR-5187-5p	PAR-CLIP	26701625
MIRT477322	hsa-miR-5187-5p	PAR-CLIP	26701625
MIRT477322	hsa-miR-5187-5p	PAR-CLIP	26701625
MIRT477322	hsa-miR-5187-5p	PAR-CLIP	26701625
MIRT477322	hsa-miR-5187-5p	PAR-CLIP	26701625
MIRT477322	hsa-miR-5187-5p	PAR-CLIP	26701625
MIRT477322	hsa-miR-5187-5p	PAR-CLIP	26701625
MIRT477322	hsa-miR-5187-5p	PAR-CLIP	26701625
MIRT477322	hsa-miR-5187-5p	PAR-CLIP	26701625
MIRT477321	hsa-miR-548s	PAR-CLIP	26701625
MIRT477321	hsa-miR-548s	PAR-CLIP	26701625
MIRT477321	hsa-miR-548s	PAR-CLIP	26701625
MIRT477321	hsa-miR-548s	PAR-CLIP	26701625
MIRT477321	hsa-miR-548s	PAR-CLIP	26701625
MIRT477321	hsa-miR-548s	PAR-CLIP	26701625
MIRT477321	hsa-miR-548s	PAR-CLIP	26701625
MIRT477321	hsa-miR-548s	PAR-CLIP	26701625
MIRT477321	hsa-miR-548s	PAR-CLIP	26701625
MIRT477321	hsa-miR-548s	PAR-CLIP	26701625
MIRT477321	hsa-miR-548s	PAR-CLIP	26701625
MIRT477321	hsa-miR-548s	PAR-CLIP	26701625
MIRT477321	hsa-miR-548s	PAR-CLIP	26701625
MIRT477319	hsa-miR-588	PAR-CLIP	26701625
MIRT477319	hsa-miR-588	PAR-CLIP	26701625
MIRT477319	hsa-miR-588	PAR-CLIP	26701625
MIRT477319	hsa-miR-588	PAR-CLIP	26701625
MIRT477319	hsa-miR-588	PAR-CLIP	26701625
MIRT477319	hsa-miR-588	PAR-CLIP	26701625
MIRT477319	hsa-miR-588	PAR-CLIP	26701625
MIRT477319	hsa-miR-588	PAR-CLIP	26701625
MIRT477319	hsa-miR-588	PAR-CLIP	26701625
MIRT477319	hsa-miR-588	PAR-CLIP	26701625
MIRT477319	hsa-miR-588	PAR-CLIP	26701625
MIRT477319	hsa-miR-588	PAR-CLIP	26701625
MIRT477319	hsa-miR-588	PAR-CLIP	26701625
MIRT477326	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT477326	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT477326	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT477326	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT477326	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT477326	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT477326	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT477326	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT477326	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT477326	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT477326	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT477326	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT477326	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT477326	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT477329	hsa-miR-6754-5p	PAR-CLIP	26701625
MIRT477329	hsa-miR-6754-5p	PAR-CLIP	26701625
MIRT477329	hsa-miR-6754-5p	PAR-CLIP	26701625
MIRT477329	hsa-miR-6754-5p	PAR-CLIP	26701625
MIRT477329	hsa-miR-6754-5p	PAR-CLIP	26701625
MIRT477329	hsa-miR-6754-5p	PAR-CLIP	26701625
MIRT477329	hsa-miR-6754-5p	PAR-CLIP	26701625
MIRT477329	hsa-miR-6754-5p	PAR-CLIP	26701625
MIRT477329	hsa-miR-6754-5p	PAR-CLIP	26701625
MIRT477329	hsa-miR-6754-5p	PAR-CLIP	26701625
MIRT477329	hsa-miR-6754-5p	PAR-CLIP	26701625
MIRT477329	hsa-miR-6754-5p	PAR-CLIP	26701625
MIRT477333	hsa-miR-6757-5p	PAR-CLIP	26701625
MIRT477333	hsa-miR-6757-5p	PAR-CLIP	26701625
MIRT477333	hsa-miR-6757-5p	PAR-CLIP	26701625
MIRT477333	hsa-miR-6757-5p	PAR-CLIP	26701625
MIRT477333	hsa-miR-6757-5p	PAR-CLIP	26701625
MIRT477333	hsa-miR-6757-5p	PAR-CLIP	26701625
MIRT477333	hsa-miR-6757-5p	PAR-CLIP	26701625
MIRT477333	hsa-miR-6757-5p	PAR-CLIP	26701625
MIRT477333	hsa-miR-6757-5p	PAR-CLIP	26701625
MIRT477333	hsa-miR-6757-5p	PAR-CLIP	26701625
MIRT477333	hsa-miR-6757-5p	PAR-CLIP	26701625
MIRT477333	hsa-miR-6757-5p	PAR-CLIP	26701625
MIRT502527	hsa-miR-8063	PAR-CLIP	26701625
MIRT502527	hsa-miR-8063	PAR-CLIP	26701625
MIRT502527	hsa-miR-8063	PAR-CLIP	26701625
MIRT502527	hsa-miR-8063	PAR-CLIP	26701625
MIRT502527	hsa-miR-8063	PAR-CLIP	26701625
MIRT502527	hsa-miR-8063	PAR-CLIP	26701625
MIRT502527	hsa-miR-8063	PAR-CLIP	26701625
MIRT502527	hsa-miR-8063	PAR-CLIP	26701625
MIRT502527	hsa-miR-8063	PAR-CLIP	26701625
MIRT502529	hsa-miR-888-3p	PAR-CLIP	26701625
MIRT502529	hsa-miR-888-3p	PAR-CLIP	26701625
MIRT502529	hsa-miR-888-3p	PAR-CLIP	26701625
MIRT502529	hsa-miR-888-3p	PAR-CLIP	26701625
MIRT502529	hsa-miR-888-3p	PAR-CLIP	26701625
MIRT502529	hsa-miR-888-3p	PAR-CLIP	26701625
MIRT502529	hsa-miR-888-3p	PAR-CLIP	26701625
MIRT502529	hsa-miR-888-3p	PAR-CLIP	26701625
MIRT502529	hsa-miR-888-3p	PAR-CLIP	26701625
MIRT502531	hsa-miR-141-3p	PAR-CLIP	22012620
MIRT502530	hsa-miR-200a-3p	PAR-CLIP	22012620
MIRT502529	hsa-miR-888-3p	PAR-CLIP	22012620
MIRT502527	hsa-miR-8063	PAR-CLIP	22012620
MIRT502528	hsa-miR-3660	PAR-CLIP	22012620
MIRT502526	hsa-miR-4526	PAR-CLIP	22012620
MIRT502525	hsa-miR-302b-5p	PAR-CLIP	22012620
MIRT502524	hsa-miR-302d-5p	PAR-CLIP	22012620
MIRT537665	hsa-miR-1255a	PAR-CLIP	22012620
MIRT537664	hsa-miR-1255b-5p	PAR-CLIP	22012620
MIRT502523	hsa-miR-302c-5p	PAR-CLIP	22012620
MIRT502531	hsa-miR-141-3p	PAR-CLIP	24398324
MIRT502530	hsa-miR-200a-3p	PAR-CLIP	24398324
MIRT502529	hsa-miR-888-3p	PAR-CLIP	24398324
MIRT502527	hsa-miR-8063	PAR-CLIP	24398324
MIRT502528	hsa-miR-3660	PAR-CLIP	24398324
MIRT502526	hsa-miR-4526	PAR-CLIP	24398324
MIRT502525	hsa-miR-302b-5p	PAR-CLIP	24398324
MIRT502524	hsa-miR-302d-5p	PAR-CLIP	24398324
MIRT502523	hsa-miR-302c-5p	PAR-CLIP	24398324
MIRT477338	hsa-miR-124-3p	PAR-CLIP	23592263
MIRT477336	hsa-miR-3133	PAR-CLIP	23592263
MIRT477337	hsa-miR-186-5p	PAR-CLIP	23592263
MIRT477335	hsa-miR-2392	PAR-CLIP	23592263
MIRT477333	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT477334	hsa-miR-1182	PAR-CLIP	23592263
MIRT477332	hsa-miR-211-3p	PAR-CLIP	23592263
MIRT477330	hsa-miR-4270	PAR-CLIP	23592263
MIRT477331	hsa-miR-4441	PAR-CLIP	23592263
MIRT477329	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT477328	hsa-miR-4744	PAR-CLIP	23592263
MIRT477327	hsa-miR-4509	PAR-CLIP	23592263
MIRT477326	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT477325	hsa-miR-1185-5p	PAR-CLIP	23592263
MIRT477324	hsa-miR-3679-5p	PAR-CLIP	23592263
MIRT477323	hsa-miR-3605-5p	PAR-CLIP	23592263
MIRT477322	hsa-miR-5187-5p	PAR-CLIP	23592263
MIRT477321	hsa-miR-548s	PAR-CLIP	23592263
MIRT477320	hsa-miR-4701-5p	PAR-CLIP	23592263
MIRT477319	hsa-miR-588	PAR-CLIP	23592263
MIRT477318	hsa-miR-4435	PAR-CLIP	23592263
MIRT477316	hsa-miR-3187-3p	PAR-CLIP	23592263
MIRT477317	hsa-miR-1227-5p	PAR-CLIP	23592263
MIRT755787	MiR-210	Luciferase reporter assayWestern blottingqRT-PCR	37904187
MIRT966346	hsa-miR-103a	CLIP-seq
MIRT966347	hsa-miR-107	CLIP-seq
MIRT966348	hsa-miR-1184	CLIP-seq
MIRT966349	hsa-miR-1255b	CLIP-seq
MIRT966350	hsa-miR-1297	CLIP-seq
MIRT966351	hsa-miR-1321	CLIP-seq
MIRT966352	hsa-miR-141	CLIP-seq
MIRT966353	hsa-miR-1976	CLIP-seq
MIRT966354	hsa-miR-200a	CLIP-seq
MIRT966355	hsa-miR-214	CLIP-seq
MIRT966356	hsa-miR-224	CLIP-seq
MIRT966357	hsa-miR-2276	CLIP-seq
MIRT966358	hsa-miR-2278	CLIP-seq
MIRT966359	hsa-miR-26a	CLIP-seq
MIRT966360	hsa-miR-26b	CLIP-seq
MIRT966361	hsa-miR-3065-3p	CLIP-seq
MIRT966362	hsa-miR-3065-5p	CLIP-seq
MIRT966363	hsa-miR-3180-5p	CLIP-seq
MIRT966364	hsa-miR-3619-5p	CLIP-seq
MIRT966365	hsa-miR-3664-5p	CLIP-seq
MIRT966366	hsa-miR-4263	CLIP-seq
MIRT966367	hsa-miR-4465	CLIP-seq
MIRT966368	hsa-miR-4468	CLIP-seq
MIRT966369	hsa-miR-4659a-3p	CLIP-seq
MIRT966370	hsa-miR-4659b-3p	CLIP-seq
MIRT966371	hsa-miR-4717-5p	CLIP-seq
MIRT966372	hsa-miR-4739	CLIP-seq
MIRT966373	hsa-miR-4746-5p	CLIP-seq
MIRT966374	hsa-miR-4756-5p	CLIP-seq
MIRT966375	hsa-miR-4772-3p	CLIP-seq
MIRT966376	hsa-miR-483-3p	CLIP-seq
MIRT966377	hsa-miR-520a-5p	CLIP-seq
MIRT966378	hsa-miR-525-5p	CLIP-seq
MIRT966379	hsa-miR-576-5p	CLIP-seq
MIRT966380	hsa-miR-761	CLIP-seq
MIRT966381	hsa-miR-891b	CLIP-seq
MIRT966350	hsa-miR-1297	CLIP-seq
MIRT966359	hsa-miR-26a	CLIP-seq
MIRT966360	hsa-miR-26b	CLIP-seq
MIRT966367	hsa-miR-4465	CLIP-seq
MIRT1548381	hsa-miR-630	CLIP-seq
MIRT1986211	hsa-let-7a	CLIP-seq
MIRT1986212	hsa-let-7b	CLIP-seq
MIRT1986213	hsa-let-7c	CLIP-seq
MIRT1986214	hsa-let-7d	CLIP-seq
MIRT1986215	hsa-let-7e	CLIP-seq
MIRT1986216	hsa-let-7f	CLIP-seq
MIRT1986217	hsa-let-7g	CLIP-seq
MIRT1986218	hsa-let-7i	CLIP-seq
MIRT966346	hsa-miR-103a	CLIP-seq
MIRT966347	hsa-miR-107	CLIP-seq
MIRT966348	hsa-miR-1184	CLIP-seq
MIRT1986219	hsa-miR-124	CLIP-seq
MIRT1986220	hsa-miR-1294	CLIP-seq
MIRT1986221	hsa-miR-186	CLIP-seq
MIRT966353	hsa-miR-1976	CLIP-seq
MIRT1986222	hsa-miR-202	CLIP-seq
MIRT966355	hsa-miR-214	CLIP-seq
MIRT966361	hsa-miR-3065-3p	CLIP-seq
MIRT1986223	hsa-miR-3126-5p	CLIP-seq
MIRT966364	hsa-miR-3619-5p	CLIP-seq
MIRT1986224	hsa-miR-3915	CLIP-seq
MIRT1986225	hsa-miR-3928	CLIP-seq
MIRT1986226	hsa-miR-4283	CLIP-seq
MIRT1986227	hsa-miR-4316	CLIP-seq
MIRT1986228	hsa-miR-4458	CLIP-seq
MIRT1986229	hsa-miR-4489	CLIP-seq
MIRT1986230	hsa-miR-4500	CLIP-seq
MIRT966373	hsa-miR-4746-5p	CLIP-seq
MIRT966376	hsa-miR-483-3p	CLIP-seq
MIRT1986231	hsa-miR-506	CLIP-seq
MIRT966380	hsa-miR-761	CLIP-seq
MIRT1986232	hsa-miR-98	CLIP-seq
MIRT966349	hsa-miR-1255b	CLIP-seq
MIRT966351	hsa-miR-1321	CLIP-seq
MIRT966352	hsa-miR-141	CLIP-seq
MIRT2220844	hsa-miR-183	CLIP-seq
MIRT966353	hsa-miR-1976	CLIP-seq
MIRT966354	hsa-miR-200a	CLIP-seq
MIRT966355	hsa-miR-214	CLIP-seq
MIRT966356	hsa-miR-224	CLIP-seq
MIRT966358	hsa-miR-2278	CLIP-seq
MIRT2220845	hsa-miR-2355-5p	CLIP-seq
MIRT2220846	hsa-miR-3136-3p	CLIP-seq
MIRT2220847	hsa-miR-338-3p	CLIP-seq
MIRT966364	hsa-miR-3619-5p	CLIP-seq
MIRT2220848	hsa-miR-3677-5p	CLIP-seq
MIRT2220849	hsa-miR-370	CLIP-seq
MIRT966368	hsa-miR-4468	CLIP-seq
MIRT2220850	hsa-miR-4685-5p	CLIP-seq
MIRT966372	hsa-miR-4739	CLIP-seq
MIRT966374	hsa-miR-4756-5p	CLIP-seq
MIRT2220851	hsa-miR-663b	CLIP-seq
MIRT966380	hsa-miR-761	CLIP-seq
MIRT1986211	hsa-let-7a	CLIP-seq
MIRT1986212	hsa-let-7b	CLIP-seq
MIRT1986213	hsa-let-7c	CLIP-seq
MIRT1986214	hsa-let-7d	CLIP-seq
MIRT1986215	hsa-let-7e	CLIP-seq
MIRT1986216	hsa-let-7f	CLIP-seq
MIRT1986217	hsa-let-7g	CLIP-seq
MIRT1986218	hsa-let-7i	CLIP-seq
MIRT966346	hsa-miR-103a	CLIP-seq
MIRT966347	hsa-miR-107	CLIP-seq
MIRT966348	hsa-miR-1184	CLIP-seq
MIRT2387455	hsa-miR-1207-3p	CLIP-seq
MIRT2387456	hsa-miR-125a-5p	CLIP-seq
MIRT2387457	hsa-miR-125b	CLIP-seq
MIRT1986220	hsa-miR-1294	CLIP-seq
MIRT2387458	hsa-miR-1913	CLIP-seq
MIRT966353	hsa-miR-1976	CLIP-seq
MIRT1986222	hsa-miR-202	CLIP-seq
MIRT2387459	hsa-miR-210	CLIP-seq
MIRT2220845	hsa-miR-2355-5p	CLIP-seq
MIRT2387460	hsa-miR-302a	CLIP-seq
MIRT2387461	hsa-miR-302b	CLIP-seq
MIRT2387462	hsa-miR-302c	CLIP-seq
MIRT2387463	hsa-miR-302d	CLIP-seq
MIRT2387464	hsa-miR-302e	CLIP-seq
MIRT2387465	hsa-miR-3064-3p	CLIP-seq
MIRT966361	hsa-miR-3065-3p	CLIP-seq
MIRT2387466	hsa-miR-324-3p	CLIP-seq
MIRT2387467	hsa-miR-346	CLIP-seq
MIRT2387468	hsa-miR-3591-5p	CLIP-seq
MIRT2387469	hsa-miR-372	CLIP-seq
MIRT2387470	hsa-miR-373	CLIP-seq
MIRT1986224	hsa-miR-3915	CLIP-seq
MIRT1986225	hsa-miR-3928	CLIP-seq
MIRT2387471	hsa-miR-4267	CLIP-seq
MIRT1986226	hsa-miR-4283	CLIP-seq
MIRT2387472	hsa-miR-4290	CLIP-seq
MIRT1986227	hsa-miR-4316	CLIP-seq
MIRT2387473	hsa-miR-4319	CLIP-seq
MIRT1986228	hsa-miR-4458	CLIP-seq
MIRT1986229	hsa-miR-4489	CLIP-seq
MIRT1986230	hsa-miR-4500	CLIP-seq
MIRT2387474	hsa-miR-4639-5p	CLIP-seq
MIRT2387475	hsa-miR-4732-3p	CLIP-seq
MIRT966373	hsa-miR-4746-5p	CLIP-seq
MIRT966376	hsa-miR-483-3p	CLIP-seq
MIRT2387476	hsa-miR-519a	CLIP-seq
MIRT2387477	hsa-miR-519b-3p	CLIP-seq
MIRT2387478	hsa-miR-519c-3p	CLIP-seq
MIRT2387479	hsa-miR-520a-3p	CLIP-seq
MIRT2387480	hsa-miR-520b	CLIP-seq
MIRT2387481	hsa-miR-520c-3p	CLIP-seq
MIRT2387482	hsa-miR-520e	CLIP-seq
MIRT2387483	hsa-miR-622	CLIP-seq
MIRT2387484	hsa-miR-648	CLIP-seq
MIRT2387485	hsa-miR-670	CLIP-seq
MIRT1986232	hsa-miR-98	CLIP-seq
MIRT2524538	hsa-miR-1908	CLIP-seq
MIRT2220845	hsa-miR-2355-5p	CLIP-seq
MIRT2387472	hsa-miR-4290	CLIP-seq
MIRT2524539	hsa-miR-4640-5p	CLIP-seq
MIRT2524540	hsa-miR-4687-5p	CLIP-seq
MIRT2524541	hsa-miR-4726-5p	CLIP-seq
MIRT2524542	hsa-miR-514	CLIP-seq
MIRT2524543	hsa-miR-514b-3p	CLIP-seq
MIRT2524544	hsa-miR-663	CLIP-seq
MIRT2524545	hsa-miR-890	CLIP-seq
MIRT2524538	hsa-miR-1908	CLIP-seq
MIRT2220845	hsa-miR-2355-5p	CLIP-seq
MIRT2524542	hsa-miR-514	CLIP-seq
MIRT2524543	hsa-miR-514b-3p	CLIP-seq
MIRT2524544	hsa-miR-663	CLIP-seq

Transcription factor	Regulation	Reference
HIC1	Repression	22184117
MTA1	Repression	22184117
TP53	Activation	11641774

100 Show/Hide all (100)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001501	Process	Skeletal system development	IEA
GO:0001525	Process	Angiogenesis	IBA
GO:0001525	Process	Angiogenesis	IEA
GO:0001568	Process	Blood vessel development	IEA
GO:0001570	Process	Vasculogenesis	IEA
GO:0001618	Function	Virus receptor activity	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001649	Process	Osteoblast differentiation	ISS
GO:0001818	Process	Negative regulation of cytokine production	IEA
GO:0002043	Process	Blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IBA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IDA	10655584
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0005003	Function	Ephrin receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	10655584, 15777695, 18948590, 19525919, 19573808, 20228801, 20505120, 20679435, 22036564, 22244754, 22939624, 23358419, 27815408, 28065597, 33961781, 35384245
GO:0005524	Function	ATP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	10655584, 16862074, 18794797, 20861311
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IDA	10655584
GO:0005925	Component	Focal adhesion	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006950	Process	Response to stress	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IDA	18339848
GO:0009986	Component	Cell surface	HDA	19581412
GO:0009986	Component	Cell surface	IDA	25063885
GO:0009986	Component	Cell surface	IEA
GO:0010591	Process	Regulation of lamellipodium assembly	IMP	19573808
GO:0014028	Process	Notochord formation	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	IMP	23358419
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019838	Function	Growth factor binding	IPI	22568954
GO:0021915	Process	Neural tube development	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0030027	Component	Lamellipodium	IDA	26158630
GO:0030154	Process	Cell differentiation	IEA
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0030216	Process	Keratinocyte differentiation	IMP	20861311
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0030316	Process	Osteoclast differentiation	ISS
GO:0030334	Process	Regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IDA	24002999
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0031256	Component	Leading edge membrane	IDA	19573808, 20679435
GO:0031258	Component	Lamellipodium membrane	IEA
GO:0032587	Component	Ruffle membrane	IEA
GO:0032682	Process	Negative regulation of chemokine production	IEA
GO:0033598	Process	Mammary gland epithelial cell proliferation	IEA
GO:0033598	Process	Mammary gland epithelial cell proliferation	ISS
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	IDA	10655584
GO:0036342	Process	Post-anal tail morphogenesis	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043235	Component	Receptor complex	IBA
GO:0043535	Process	Regulation of blood vessel endothelial cell migration	IEA
GO:0043535	Process	Regulation of blood vessel endothelial cell migration	ISS
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045765	Process	Regulation of angiogenesis	IEA
GO:0045765	Process	Regulation of angiogenesis	ISS
GO:0046058	Process	CAMP metabolic process	IMP	27385333
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0046849	Process	Bone remodeling	IEA
GO:0046849	Process	Bone remodeling	ISS
GO:0048013	Process	Ephrin receptor signaling pathway	IDA	10655584, 20861311
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048320	Process	Axial mesoderm formation	IEA
GO:0048513	Process	Animal organ development	IEA
GO:0048514	Process	Blood vessel morphogenesis	IEA
GO:0048570	Process	Notochord morphogenesis	IEA
GO:0048870	Process	Cell motility	IMP	26158630
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0060035	Process	Notochord cell development	IEA
GO:0060326	Process	Cell chemotaxis	IMP	19573808, 20679435
GO:0060444	Process	Branching involved in mammary gland duct morphogenesis	IEA
GO:0060444	Process	Branching involved in mammary gland duct morphogenesis	ISS
GO:0070160	Component	Tight junction	IDA	27815408
GO:0070161	Component	Anchoring junction	IEA
GO:0070309	Process	Lens fiber cell morphogenesis	IEA
GO:0070309	Process	Lens fiber cell morphogenesis	ISS
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IMP	20861311
GO:0070848	Process	Response to growth factor	IMP	19573808
GO:0072659	Process	Protein localization to plasma membrane	IMP	27815408
GO:0090630	Process	Activation of GTPase activity	IMP	20679435
GO:0140677	Function	Molecular function activator activity	EXP	12467573
GO:1901491	Process	Negative regulation of lymphangiogenesis	IEA
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IMP	20679435
GO:1903348	Process	Positive regulation of bicellular tight junction assembly	IMP	27815408
GO:1904238	Process	Pericyte cell differentiation	IEA

MIM	HGNC	e!Ensembl
176946	3386	ENSG00000142627

P29317

Protein name

Ephrin type-A receptor 2 (EC 2.7.10.1) (Epithelial cell kinase) (Tyrosine-protein kinase receptor ECK)

Protein function

Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor i

PDB

1MQB , 2E8N , 2K9Y , 2KSO , 2X10 , 2X11 , 3C8X , 3CZU , 3FL7 , 3HEI , 3HPN , 3KKA , 3MBW , 3MX0 , 3SKJ , 4P2K , 4PDO , 4TRL , 5EK7 , 5I9U , 5I9V , 5I9W , 5I9X , 5I9Y , 5I9Z , 5IA0 , 5IA1 , 5IA2 , 5IA3 , 5IA4 , 5IA5 , 5NJZ , 5NK0 , 5NK1 , 5NK2 , 5NK3 , 5NK4 , 5NK5 , 5NK6 , 5NK7 , 5NK8 , 5NK9 , 5NKA , 5NKB , 5NKC , 5NKD , 5NKE , 5NKF , 5NKG , 5NKH , 5NKI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00041	fn3	437 → 519	Fibronectin type III domain	Domain
PF00041	fn3	330 → 424	Fibronectin type III domain	Domain
PF00536	SAM_1	902 → 966	SAM domain (Sterile alpha motif)	Domain
PF01404	Ephrin_lbd	29 → 201	Ephrin receptor ligand binding domain	Domain
PF14575	EphA2_TM	537 → 610	Ephrin type-A receptor 2 transmembrane domain	Domain
PF07714	PK_Tyr_Ser-Thr	613 → 871	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain and glioma tissue and glioma cell lines (at protein level). Expressed most highly in tissues that contain a high proportion of epithelial cells, e.g. skin, intestine, lung, and ovary. {ECO:0000269|PubMed:17332925}.

Sequence

MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMN
DMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL
AFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGG
EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPS
PEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDI
VYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG
LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSN
SYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGG
VAVGVVLLLVLAGVGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQA
VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDF
LGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGML
RGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIP
IRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM
DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSG
SEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAY
SLLGLKDQVNTVGIPI

Sequence length

976

Interactions

View interactions

KEGG Pathway	Reactome Pathway
MAPK signaling pathway	EPH-Ephrin signaling
Ras signaling pathway	EPHA-mediated growth cone collapse
Rap1 signaling pathway	EPH-ephrin mediated repulsion of cells
PI3K-Akt signaling pathway
Axon guidance

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Bilateral microphthalmos	Pathogenic	rs2124283411	RCV002275250	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cataract	Pathogenic	rs2124283411	RCV002275250	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cataract 6 multiple types	Pathogenic; Likely pathogenic	rs2124192639, rs766078852, rs2524538503, rs2524547709, rs757313469, rs886041412, rs137853199, rs137853200, rs1569602837, rs1570403798, rs2024441691	RCV001591931 RCV002250911 RCV002281543 RCV003081426 RCV002948856 View all (6 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Congenital aniridia	Pathogenic	rs2124283411	RCV002275250	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
EPHA2-related disorder	Pathogenic; Likely pathogenic	rs757313469, rs2524522657	RCV004754909 RCV003391536	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (32)
Age-related cortical cataract	Uncertain significance; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANIRIDIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	30595370	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT 6 MULTIPLE TYPE S	—	ClinVar, GWAS catalog	19005574, 19306328, 20361013, 28418495, 31555371, 30450742	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract 6, age-related cortical	Conflicting classifications of pathogenicity	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT 6, MULTIPLE TYPE S	—	CTD, HPO CTD, HPO	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT, POSTERIOR POLAR, 1	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Conflicting classifications of pathogenicity	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL CATARACT	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL TOTAL CATARACT	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental cataract	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY-ONSET NON-SYNDROMIC CATARACT	—	GenCC	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY-ONSET NUCLEAR CATARACT	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	24014202, 24014202	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY-ONSET POSTERIOR POLAR CATARACT	—	Disgenet, Orphanet Disgenet, Orphanet	19306328, 19306328, 23447127, 23447127	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY-ONSET POSTERIOR SUBCAPSULAR CATARACT	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	24014202, 24014202	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEOPARD SYNDROME	—	CTD, Disgenet CTD, Disgenet	22845314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Conflicting classifications of pathogenicity	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meniere disease	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar Disgenet	—	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	35047847	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NOONAN SYNDROME	—	CTD, Disgenet CTD, Disgenet	22845314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary renal cell carcinoma type 1	Conflicting classifications of pathogenicity	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POSTERIOR SUBCAPSULAR CATARACT	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOTAL EARLY-ONSET CATARACT	—	Disgenet, Orphanet Disgenet, Orphanet	19306328, 19306328	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (191)
Adenocarcinoma	Adenocarcinoma	BEFREE	19934338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19934338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	23298804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	29970559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age-related cortical cataract	Cortical cataract	BEFREE	19649315, 21686326		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Age-related cortical cataract	Cortical cataract	GENOMICS_ENGLAND_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22925330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anterior segment mesenchymal dysgenesis	Anterior segment mesenchymal dysgenesis	Pubtator	39870121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	22247258, 25613580, 28487392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	17519535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	18172271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	22247258, 25613580, 28487392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	21479221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16428472, 29367676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19573808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	18794797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11968011, 12810680, 15359289, 16103880, 18079969, 19089910, 20602165, 21737611, 21935409, 22184117, 23629968, 24586375, 26833123, 27619642, 29392452 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15649254, 17050670, 21935409, 22184117, 22261062, 24586375, 26861043, 29759486, 33977106, 37063424, 37816703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	23037715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	14564515, 19396818, 24980480, 26722543, 30833656, 32417448, 35668076, 37816703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15297167, 17146615, 18485799, 23588386, 25418013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	24606764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	19396818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19140237, 19828693, 26191168, 26520689, 26843134, 30551417, 34445353, 35005012, 35227773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16428472, 29367676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24135899, 24293999, 25142939, 25418013, 26158630, 26744526, 27438907, 31747482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	22925330, 33213062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25025847, 26177500, 26722543, 32384514, 32814829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17158642, 18566674, 20360610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16061279, 16300469, 16969087, 19395869, 19861960, 20430760, 23386691, 23913239, 24503464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32887275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	19005574, 22412971, 24014202, 24940039, 26622071, 27380975, 29267365, 31842807, 33339270, 33923544, 34220184, 34267496, 34638995	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cataract	Cataract	BEFREE	19005574, 19649315, 21092079, 22412971, 22570727, 24014202, 26900323, 28602916, 28648759, 29267365, 29800803, 31539542		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cataract posterior polar 1	Congenital cataract	Pubtator	21686326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, POSTERIOR POLAR, 1	Cataract	UNIPROT_DG	19005574, 19306328, 19649315, 22570727		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT, POSTERIOR POLAR, 1	Cataract	CLINVAR_DG	19306328, 24014202		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT, POSTERIOR POLAR, 1	Cataract	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT, POSTERIOR POLAR, 1	Cataract	GENOMICS_ENGLAND_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	17519535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15297167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35070505	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Choroideremia	Choroideremia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	24647573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16103880, 28165374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	14564515, 34691070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19089910, 21852108, 25193853, 26283684, 27401248, 28165374, 28560458, 29262644, 30501625, 30824612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	14564515, 14965363, 24457997, 25193853, 26283684, 27110571, 27246245, 35595748, 35668076, 35914269, 36401637, 37980165, 38044399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	14767510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	26283684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34092605	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital cataract	Congenital Cataract	BEFREE	19306328, 20361013, 24014202, 24673449, 24940039, 26900323, 31725171		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital total cataract	Congenital Cataract	ORPHANET_DG	19306328		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25025847, 26177500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	19649315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	25990246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Early-onset nuclear cataract	Cataract	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Early-onset posterior polar cataract	Cataract	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Early-onset posterior subcapsular cataract	Cataract	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	20948320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19396818, 34691070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	16061279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29552129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29552129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	16080548, 25366905, 26510908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	23227212, 23951165, 29582409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Female Pseudo-Turner Syndrome	Noonan syndrome	CTD_human_DG	22845314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	29948146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	30488756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16254188, 17090523, 23070117, 23238013, 23939024, 29016929, 29552579, 29626472, 29849945, 29945963, 31152846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	16254188, 18794797, 21408136, 27132626, 31152846, 35105853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18097589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16254188, 17090523, 18794797, 23070117, 23939024, 24488013, 29016929, 29552579, 29626472, 29849945, 29945963, 31152846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	16254188, 17255279, 18324354, 19573808, 21264258, 23179498, 33545987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17332925, 19573808, 21264258, 23070117, 24488013, 25142939, 29552579, 29901110, 29969628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	18425361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21408136	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25122487, 35227773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30412282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	28957431, 29167336, 30176543		★★★★★ ★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	LEOPARD Syndrome	CTD_human_DG	22845314		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEOPARD Syndrome	LEOPARD Syndrome	BEFREE	23318428		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leopard Syndrome 1	LEOPARD Syndrome	CTD_human_DG	22845314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20061560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19642143, 24969670, 26191168, 26843134, 28587437, 29449527, 30521133, 30551417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	19642143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	26520689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12576426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24285539, 24293999, 35668076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	27438907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16080548, 19140237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19048396	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	30412282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	18425361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	17041885, 17949899, 21869823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	21142802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11968011, 12810680, 15359289, 16098464, 16103880, 18079969, 19089910, 20602165, 21935409, 22184117, 24586375, 26833123, 27619642, 28581527, 29392452 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	20948320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	16080548, 29552129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	19089910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16428472, 24135899, 24293999, 25142939, 25418013, 26158630, 26542681, 26744526, 27438907, 31747482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16300469, 16969087, 19395869, 19861960, 20430760, 23386691, 23913239, 24503464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	16300469, 17146615, 19260747, 19522026, 22925330, 29072678, 30604411, 30613276, 31355777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22659453, 23155185, 31704854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25063221, 25418013, 29273006, 30210634, 30451837, 31376289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	16428472, 29367676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11741747, 12650608, 15147954, 16103880, 16300469, 17090523, 17374733, 18485799, 19074825, 19089910, 19531623, 19552627, 19948216, 21142802, 21148069 View all (31 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	21479221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16103880, 28165374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12810680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21737611, 30771434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	22723427, 25258252, 35315927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11095400, 16103880, 16189525, 16481735, 19223760, 21666714, 25542448, 29470068, 29848674, 30110533, 7814145		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	11891198, 16481735, 19010823, 21666714, 22568947, 24690323, 25542447, 29048432	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	16481735		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	33082316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	17041885, 36471440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	17041885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	17041885, 24293999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	17146615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27246973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25351620, 30583071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11146556, 12494475, 12810680, 15297167, 15359289, 16061279, 16061675, 16080548, 16103880, 16300469, 16428472, 16969087, 17041885, 17090523, 17106249 View all (66 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	21479221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	29024629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19724921, 24190252, 9119409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19724921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	9119409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	30583071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19531623, 19934338, 22236865, 23370317, 24293999, 24713656, 27533087, 28804547, 29132013, 31484920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	CTD_human_DG	22845314		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Noonan Syndrome	Noonan Syndrome	BEFREE	23318428		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Noonan Syndrome 1	Noonan Syndrome	CTD_human_DG	22845314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nuclear cataract	Cataract	ORPHANET_DG	24014202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nuclear cataract	Cataract	BEFREE	29039721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	ORPHANET_DG	24014202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	29039721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29138859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21166698, 29110283, 30013340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24064975, 30013340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	16969087, 19395869		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15297418, 16969087		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16300469, 19395869, 19861960, 20430760, 23386691, 23913239, 24503464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16969087	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17154180, 18376140, 25803614, 33893375, 36362153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16300469, 17146615, 19522026, 22925330, 29072678, 30604411, 30613276, 31355777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17146615, 19949912, 28294115, 30613276, 31317745, 31355777, 32945400, 33213062, 38180878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23238013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	17146615	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	ORPHANET_DG	19306328, 23447127		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Posterior subcapsular cataract	Capsular cataract	BEFREE	31725171		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	23155185, 31704854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14633601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19573808, 23037715, 24152675, 35869144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28743499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Stenosis	Pulmonary Stenosis	BEFREE	23318428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	15671550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26177500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	29554915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	29554915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	23227212	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	28957431, 30176543	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28560458, 30824612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	23318428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29242524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	23070117, 25142939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	28338017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	32460312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	31558317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	36377249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16080548, 18485799, 31484920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	12494475, 16080548, 25366905, 26510908, 29997940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21955398, 24022400, 24864260, 25056374, 28435450, 31422218, 33834064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	CLINVAR_DG	20360610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	31484920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	18425361, 20614133, 21955398, 22086185, 24864260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	18485799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25063221, 25310629, 25418013, 29273006, 30210634, 30451837, 31376289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15649254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15649254, 19048396, 29565486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28624791	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	21873938	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Total early-onset cataract	Cataract	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28581527, 30459358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome, Male	Turner Syndrome, Male	CTD_human_DG	22845314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32233022, 32417448, 36471440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	16428472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	BEFREE	20948320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18566674	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
MIP	6	["Cataract","Congenital cataract","Congenital total cataract","Nuclear cataract","Posterior polar cataract","Posterior subcapsular cataract"]	0	[]	13	["GWAS catalog (Cataract)","CTD (Cataract)","Disgenet (Cataract)","Orphanet (Cataract)","ClinVar (Cataract)","HPO (Cataract)","Disgenet (Congenital cataract)","Disgenet (Congenital total cataract)","GWAS catalog (Nuclear cataract)","Orphanet (Nuclear cataract)","Orphanet (Posterior polar cataract)","Disgenet (Posterior polar cataract)"]
GJA3	5	["Cataract","Congenital cataract","Nuclear cataract","Posterior polar cataract","Posterior subcapsular cataract"]	0	[]	8	["GWAS catalog (Cataract)","ClinVar (Cataract)","HPO (Cataract)","Disgenet (Congenital cataract)","Orphanet (Nuclear cataract)","Orphanet (Posterior polar cataract)","Disgenet (Posterior polar cataract)","Disgenet (Posterior subcapsular cataract)"]
FYCO1	4	["Cataract","Congenital cataract","Congenital total cataract","Nuclear cataract"]	0	[]	8	["GWAS catalog (Cataract)","Orphanet (Cataract)","ClinVar (Cataract)","HPO (Cataract)","Disgenet (Congenital cataract)","Disgenet (Congenital total cataract)","GWAS catalog (Nuclear cataract)","Orphanet (Nuclear cataract)"]
EFNA3	1	["Cataract"]	7	["MAPK signaling pathway","Ras signaling pathway","Rap1 signaling pathway","Axon guidance","EPH-ephrin mediated repulsion of cells","EPH-Ephrin signaling","EPHA-mediated growth cone collapse"]	2	["GWAS catalog (Cataract)","GWAS catalog (Nonalcoholic fatty liver disease)"]
CRYBA1	5	["Cataract","Congenital cataract","Nuclear cataract","Posterior polar cataract","Posterior subcapsular cataract"]	0	[]	8	["GWAS catalog (Cataract)","ClinVar (Cataract)","HPO (Cataract)","Disgenet (Congenital cataract)","GWAS catalog (Nuclear cataract)","Orphanet (Nuclear cataract)","Orphanet (Posterior polar cataract)","Disgenet (Posterior subcapsular cataract)"]

EPHA2 (EPH receptor A2)

Bookmark This Gene