Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	1401
Gene name	C-reactive protein
Gene symbol	CRP
Synonyms (NCBI Gene)	PTX1
Chromosome	1
Chromosome location	1q23.2
Summary	The protein encoded by this gene belongs to the pentraxin family which also includes serum amyloid P component protein and pentraxin 3. Pentraxins are involved in complement activation and amplification via communication with complement initiation pattern

27 Show/Hide all (27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT732532	hsa-miR-16-5p	Microarray	32041109
MIRT732623	hsa-miR-10b-5p	qRT-PCR	33787515
MIRT733299	hsa-miR-30a-3p	RNA-seqqRT-PCR	33538126
MIRT733300	hsa-miR-192-3p	RNA-seqqRT-PCR	33538126
MIRT733301	hsa-miR-146a-3p	RNA-seqqRT-PCR	33538126
MIRT733302	hsa-miR-155-3p	RNA-seqqRT-PCR	33538126
MIRT733303	hsa-miR-320a	RNA-seqqRT-PCR	33538126
MIRT734910	hsa-miR-223-3p	qRT-PCRELISA	33238267
MIRT734911	hsa-miR-451a	qRT-PCRELISA	33238267
MIRT910539	hsa-miR-1288	CLIP-seq
MIRT910540	hsa-miR-2276	CLIP-seq
MIRT910541	hsa-miR-3126-5p	CLIP-seq
MIRT910542	hsa-miR-3199	CLIP-seq
MIRT910543	hsa-miR-3653	CLIP-seq
MIRT910544	hsa-miR-3658	CLIP-seq
MIRT910545	hsa-miR-4520a-5p	CLIP-seq
MIRT910546	hsa-miR-4520b-5p	CLIP-seq
MIRT910547	hsa-miR-4796-3p	CLIP-seq
MIRT910548	hsa-miR-539	CLIP-seq
MIRT910549	hsa-miR-580	CLIP-seq
MIRT2205930	hsa-miR-3661	CLIP-seq
MIRT2205931	hsa-miR-4433	CLIP-seq
MIRT2205932	hsa-miR-4459	CLIP-seq
MIRT2205933	hsa-miR-4768-3p	CLIP-seq
MIRT2205934	hsa-miR-631	CLIP-seq
MIRT2205935	hsa-miR-769-5p	CLIP-seq
MIRT2386481	hsa-miR-145	CLIP-seq

11 Show/Hide all (11)

Transcription factor	Regulation	Reference
CEBPB	Activation	12667216;23361365
FOS	Unknown	18292576
HNF1A	Unknown	18292576;8703909
NFKB1	Activation	12667216;17704137
NFKB1	Unknown	17513780
REL	Unknown	18684932
RELA	Activation	12667216;17704137
RELA	Unknown	17513780
STAT3	Activation	12667216;20978825;23361365
STAT3	Unknown	18292576
TBP	Unknown	18684932

31 Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001849	Function	Complement component C1q complex binding	IBA
GO:0001849	Function	Complement component C1q complex binding	IDA	23544079
GO:0001849	Function	Complement component C1q complex binding	IEA
GO:0005509	Function	Calcium ion binding	IDA	23544079
GO:0005515	Function	Protein binding	IPI	17244159, 17293598, 17339482, 17399790, 17785206, 18786923, 19084272, 19680263, 19850925, 20042240, 21037097, 21930971, 25416956, 26922829, 26984957, 28533443, 29374201
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	21323571, 23544079
GO:0006953	Process	Acute-phase response	IBA
GO:0006953	Process	Acute-phase response	IEA
GO:0006953	Process	Acute-phase response	TAS	2477488
GO:0006954	Process	Inflammatory response	TAS	10408362
GO:0008228	Process	Opsonization	TAS	2477488
GO:0010628	Process	Positive regulation of gene expression	IDA	24141169
GO:0010745	Process	Negative regulation of macrophage derived foam cell differentiation	IDA	18322245
GO:0010888	Process	Negative regulation of lipid storage	IDA	18322245
GO:0030169	Function	Low-density lipoprotein particle binding	IBA
GO:0030169	Function	Low-density lipoprotein particle binding	IDA	18322245
GO:0032677	Process	Regulation of interleukin-8 production	IDA	21037097
GO:0032930	Process	Positive regulation of superoxide anion generation	IDA	24141169
GO:0032945	Process	Negative regulation of mononuclear cell proliferation	IDA	29202702
GO:0033265	Function	Choline binding	TAS	2477488
GO:0042310	Process	Vasoconstriction	IDA	24141169
GO:0042310	Process	Vasoconstriction	IMP	24141169
GO:0042802	Function	Identical protein binding	IPI	16642000, 18786923, 19084272, 19680263, 19850925
GO:0045087	Process	Innate immune response	IBA
GO:0046790	Function	Virion binding	IDA	23544079
GO:0046872	Function	Metal ion binding	IEA
GO:0050750	Function	Low-density lipoprotein particle receptor binding	IPI	24141169
GO:0050830	Process	Defense response to Gram-positive bacterium	TAS	2477488

MIM	HGNC	e!Ensembl
123260	2367	ENSG00000132693

P02741

Protein name

C-reactive protein [Cleaved into: C-reactive protein(1-205)]

Protein function

Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones

PDB

1B09 , 1GNH , 1LJ7 , 3L2Y , 3PVN , 3PVO , 7PK9 , 7PKB , 7PKD , 7PKE , 7PKF , 7PKG , 7PKH , 7TBA , 8WV4 , 8WV5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00354	Pentaxin	25 → 220	Pentaxin family	Domain

Tissue specificity

TISSUE SPECIFICITY: Found in plasma.

Sequence

MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE
LSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWES
ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMW
DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP

Sequence length

224

Interactions

View interactions

Reactome Pathway
Classical antibody-mediated complement activation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (58)
ANTIPHOSPHOLIPID SYNDROME	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	20194079	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	1568518	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	16931792	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	32279069	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	19363144	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	12876635, 16332659, 29114965	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR DISORDERS	—	CTD, Disgenet CTD, Disgenet	29114965	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD	24868163	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	11339241	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRP-related disorder	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSED MOOD	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 1	—	CTD	20012460	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	CTD, Disgenet CTD, Disgenet	20012460	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXUDATIVE AGE-RELATED MACULAR DEGENERATION	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASES	—	CTD, Disgenet CTD, Disgenet	17388968	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	16360360	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPARATHYROIDISM, SECONDARY	—	CTD, Disgenet CTD, Disgenet	21350317	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	14620923, 16680063, 19770776, 20667508	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTRIGLYCERIDEMIA	—	CTD, Disgenet CTD, Disgenet	11893366	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammation	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	19539174	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	18385676	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	18385676	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	18385676	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	17114654	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	17718048	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DEGENERATION	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASES	—	CTD, Disgenet CTD, Disgenet	19131468	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	CTD	16644639	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME X	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	11840375	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	24042701	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	CTD, Disgenet CTD, Disgenet	20011938	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet CTD, Disgenet	12559600	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	29329563	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA, OBSTRUCTIVE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	18385676	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD, Disgenet CTD, Disgenet	34142820	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	12858318	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	16931792	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ADIPOQ	5	["Atherosclerosis","Ischemic heart disease","Congestive heart failure","Diabetic retinopathy","Kidney failure"]	[]	21	["CTD (Rheumatoid arthritis)","CTD (Atherosclerosis)","Disgenet (Atherosclerosis)","Disgenet (Cardiovascular disease)","Disgenet (Ischemic heart disease)","Disgenet (Obesity)","Disgenet (Congestive heart failure)","Disgenet (Coronary artery disease)","CTD (Crohn disease)","Disgenet (Crohn disease)","Disgenet (Diabetic retinopathy)","CTD (Hypertension)"]
SOD3	6	["Ischemic heart disease","Obstructive airway disease","Congestive heart failure","Diabetic retinopathy","Heart disease","Chronic obstructive pulmonary disease"]	[]	10	["Disgenet (Ischemic heart disease)","Disgenet (Obstructive airway disease)","Disgenet (Congestive heart failure)","Disgenet (Coronary artery disease)","Disgenet (Diabetic retinopathy)","CTD (Hypertension)","Disgenet (Heart disease)","CTD (Heart failure)","Disgenet (Heart failure)","CTD (Chronic obstructive pulmonary disease)"]
CYBA	5	["Atherosclerosis","Ischemic heart disease","Obstructive airway disease","Heart disease","Kidney failure"]	[]	10	["CTD (Atherosclerosis)","Disgenet (Atherosclerosis)","Disgenet (Ischemic heart disease)","Disgenet (Obstructive airway disease)","Disgenet (Coronary artery disease)","CTD (Hypertension)","Disgenet (Heart disease)","CTD (Heart disease)","Disgenet (Kidney failure)","CTD (Kidney failure)"]
AGER	6	["Atherosclerosis","Ischemic heart disease","Diabetic retinopathy","Kidney failure","Lupus nephritis","Chronic obstructive pulmonary disease"]	[]	15	["CTD (Rheumatoid arthritis)","CTD (Atherosclerosis)","Disgenet (Atherosclerosis)","Disgenet (Systemic lupus erythematosus)","Disgenet (Cardiovascular disease)","Disgenet (Ischemic heart disease)","Disgenet (Obesity)","Disgenet (Coronary artery disease)","Disgenet (Diabetes mellitus type 1)","Disgenet (Diabetic retinopathy)","CTD (Hypertension)","Disgenet (Kidney failure)"]
TLR4	9	["Arthritis","Atherosclerosis","Ischemic heart disease","Obstructive airway disease","Diabetic retinopathy","Macular degeneration","Kidney failure","Lung neoplasms","Chronic obstructive pulmonary disease"]	[]	14	["Disgenet (Arthritis)","CTD (Atherosclerosis)","Disgenet (Atherosclerosis)","Disgenet (Ischemic heart disease)","Disgenet (Obstructive airway disease)","Disgenet (Coronary artery disease)","CTD (Coronary artery disease)","CTD (Crohn disease)","Disgenet (Crohn disease)","Disgenet (Diabetic retinopathy)","CTD (Hypertension)","Disgenet (Macular degeneration)"]

CRP (C-reactive protein)

Bookmark This Gene