AGER (advanced glycosylation end-product specific receptor)

Gene

• Entrez ID: 177
• Gene name: Advanced glycosylation end-product specific receptor
• Gene symbol: AGER
• Synonyms (NCBI Gene): RAGE, SCARJ1, sRAGE
• Chromosome: 6
• Chromosome location: 6p21.32
• Summary: The advanced glycosylation end product (AGE) receptor encoded by this gene is a member of the immunoglobulin superfamily of cell surface receptors. It is a multiligand receptor, and besides AGE, interacts with other molecules implicated in homeostasis, de

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs138178120	C>G,T	Conflicting-interpretations-of-pathogenicity	Missense variant, non coding transcript variant, intron variant, coding sequence variant
rs140930365	A>T	Conflicting-interpretations-of-pathogenicity	Missense variant, non coding transcript variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051103	hsa-miR-16-5p	CLASH	23622248
MIRT047532	hsa-miR-10a-5p	CLASH	23622248
MIRT044860	hsa-miR-195-5p	CLASH	23622248

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	18622638;19616578
PPARG	Repression	18855759
RELA	Activation	18622638;19616578

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IDA	29518356
GO:0001540	Function	Amyloid-beta binding	IPI	22406537, 23973487
GO:0001540	Function	Amyloid-beta binding	NAS	18367618
GO:0001540	Function	Amyloid-beta binding	TAS	15457210, 26871627
GO:0001650	Component	Fibrillar center	IDA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001774	Process	Microglial cell activation	IEA
GO:0001774	Process	Microglial cell activation	IGI	15457210
GO:0001774	Process	Microglial cell activation	ISS	22406537
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001891	Component	Phagocytic cup	IDA	35974093
GO:0001891	Component	Phagocytic cup	IEA
GO:0001914	Process	Regulation of T cell mediated cytotoxicity	IDA	22473704
GO:0003677	Function	DNA binding	IDA	35974093
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	IDA	35974093
GO:0003723	Function	RNA binding	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	1378843
GO:0005044	Function	Scavenger receptor activity	TAS	11240025
GO:0005055	Function	Laminin receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	16061848, 16716307, 16954185, 17474147, 17660747, 17726019, 18922799, 19386136, 19944695, 21706016, 21829704, 24474694, 25910212, 26758977, 32296183, 32814053, 36807739
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IDA	36807739
GO:0005634	Component	Nucleus	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	1378843, 15457210
GO:0005886	Component	Plasma membrane	TAS	1378843
GO:0006260	Process	DNA replication	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0006909	Process	Phagocytosis	IMP	35974093
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	10399917
GO:0006974	Process	DNA damage response	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	10835680
GO:0007611	Process	Learning or memory	IGI	15457210
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009611	Process	Response to wounding	TAS	10399917
GO:0009890	Process	Negative regulation of biosynthetic process	IEA
GO:0009986	Component	Cell surface	IDA	35974093
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	NAS	15457210
GO:0010255	Process	Glucose mediated signaling pathway	IDA	25689357
GO:0014002	Process	Astrocyte development	IEA
GO:0014002	Process	Astrocyte development	IEA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	26005850
GO:0030054	Component	Cell junction	IDA
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0031175	Process	Neuron projection development	IEA
GO:0031175	Process	Neuron projection development	IGI	10391939
GO:0032693	Process	Negative regulation of interleukin-10 production	IDA	22473704
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032722	Process	Positive regulation of chemokine production	ISS	22406537
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS	22406537
GO:0032735	Process	Positive regulation of interleukin-12 production	IMP	15944249
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS	22406537
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS	22406537
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	IGI	11078691
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038023	Function	Signaling receptor activity	IMP	15457210
GO:0038023	Function	Signaling receptor activity	TAS	8751438
GO:0042104	Process	Positive regulation of activated T cell proliferation	IMP	15944249
GO:0042393	Function	Histone binding	IDA	35974093
GO:0042802	Function	Identical protein binding	IPI	24119142
GO:0042995	Component	Cell projection	IEA
GO:0044548	Function	S100 protein binding	IEA
GO:0044548	Function	S100 protein binding	IPI	15033494
GO:0044877	Function	Protein-containing complex binding	IPI	29518356
GO:0045056	Process	Transcytosis	IEA
GO:0045056	Process	Transcytosis	ISS	12808450, 22406537
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IGI	20739563
GO:0048143	Process	Astrocyte activation	IGI	15457210
GO:0048167	Process	Regulation of synaptic plasticity	TAS	18367618, 19221410, 20739563
GO:0050727	Process	Regulation of inflammatory response	IBA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050785	Function	Advanced glycation end-product receptor activity	NAS	15457210
GO:0050930	Process	Induction of positive chemotaxis	IEA
GO:0051054	Process	Positive regulation of DNA metabolic process	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	10391939
GO:0051241	Process	Negative regulation of multicellular organismal process	IEA
GO:0060090	Function	Molecular adaptor activity	EXP	22194616
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IGI	15457210
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071639	Process	Positive regulation of monocyte chemotactic protein-1 production	IEA
GO:0072657	Process	Protein localization to membrane	IEA
GO:0098794	Component	Postsynapse	TAS	26224839
GO:0150003	Process	Regulation of spontaneous synaptic transmission	IGI	15457210
GO:0150104	Process	Transport across blood-brain barrier	IDA	23973487
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1900271	Process	Regulation of long-term synaptic potentiation	IEA
GO:1900271	Process	Regulation of long-term synaptic potentiation	ISS
GO:1900272	Process	Negative regulation of long-term synaptic potentiation	IEA
GO:1900272	Process	Negative regulation of long-term synaptic potentiation	IGI	15457210
GO:1900272	Process	Negative regulation of long-term synaptic potentiation	ISS
GO:1900453	Process	Negative regulation of long-term synaptic depression	IGI	20739563
GO:1900744	Process	Regulation of p38MAPK cascade	IBA
GO:1900744	Process	Regulation of p38MAPK cascade	IEA
GO:1900744	Process	Regulation of p38MAPK cascade	ISS
GO:1900745	Process	Positive regulation of p38MAPK cascade	IGI	20739563
GO:1901222	Process	Regulation of non-canonical NF-kappaB signal transduction	NAS	15457210
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IGI	15457210
GO:1902993	Process	Positive regulation of amyloid precursor protein catabolic process	IGI	22406537
GO:1903523	Process	Negative regulation of blood circulation	IEA
GO:1903523	Process	Negative regulation of blood circulation	ISS	12808450
GO:1904472	Process	Positive regulation of endothelin production	IEA
GO:1904472	Process	Positive regulation of endothelin production	ISS	12808450
GO:1904597	Process	Negative regulation of connective tissue replacement involved in inflammatory response wound healing	IEA
GO:1904645	Process	Response to amyloid-beta	IEA
GO:1904645	Process	Response to amyloid-beta	ISS
GO:1904645	Process	Response to amyloid-beta	TAS	18367618, 20739563
GO:1904646	Process	Cellular response to amyloid-beta	IEA
GO:1904646	Process	Cellular response to amyloid-beta	ISS
GO:2000105	Process	Positive regulation of DNA-templated DNA replication	IMP	36807739
GO:2000439	Process	Positive regulation of monocyte extravasation	IMP	11078691
GO:2000514	Process	Regulation of CD4-positive, alpha-beta T cell activation	IDA	22473704
GO:2000781	Process	Positive regulation of double-strand break repair	IEA
GO:2001200	Process	Positive regulation of dendritic cell differentiation	IMP	15944249

Other IDs

• MIM: 600214
• HGNC: 320
• e!Ensembl: ENSG00000204305

Protein

• UniProt ID: Q15109
• Protein name: Advanced glycosylation end product-specific receptor (Receptor for advanced glycosylation end products)
• Protein function: Cell surface pattern recognition receptor that senses endogenous stress signals with a broad ligand repertoire including advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic
• PDB: 2E5E, 2ENS, 2L7U, 2LE9, 2LMB, 2M1K, 2MJW, 2MOV, 3CJJ, 3O3U, 4LP4, 4LP5, 4OF5, 4OFV, 4OI7, 4OI8, 4P2Y, 4XYN, 4YBH, 5D7F, 6VXG, 6XQ1, 6XQ3, 6XQ5, 6XQ6, 6XQ7, 6XQ8, 6XQ9, 7LML, 7LMW, 8I9M
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00047	ig	21 → 112	Immunoglobulin domain	Domain
  PF08205	C2-set_2	124 → 219	CD80-like C2-set immunoglobulin domain	Domain
  PF13895	Ig_2	237 → 320	Immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Endothelial cells. Increased expression in pre-term labor and preeclampsia placentas compared to controls (PubMed:33918759). {ECO:0000269|PubMed:33918759}.
• Sequence:

  MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEA
  WKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQI
  PGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRH
  PETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQL
  VVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS
  CVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGV
  ILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP

• Sequence length: 404

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA, OCCUPATIONAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BORDERLINE SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, OVARIAN EPITHELIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COPD, severe early onset	Likely risk allele; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC ANGIOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC PERIPHERAL ANGIOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATENT SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MILD COGNITIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MORBID OBESITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSEUDONEUROTIC SCHIZOPHRENIAS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSEUDOPSYCHOPATHIC SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE, SEVERE EARLY-ONSET	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIC PRODROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, VASCULAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AA amyloidosis	AA amyloidosis	BEFREE	12651613		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	30485425		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	19451748, 28755135		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11793367, 15539404, 16033829		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17549666		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	11700025, 31266264		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	17549666, 28056871, 29693146, 29849788, 30320403, 30556321		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15789216		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	15789216		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	11567048		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	26431165, 29317590		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15882940, 18431028, 18952609, 20504772, 20567859, 21844192, 25582438, 25689357, 26313784, 26745632, 29702093, 32114455, 33119615, 35154571	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18657529, 19277685	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	26502815		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	29332040		★☆☆☆☆ Found in Text Mining only
Amyloid Neuropathies Familial	Amyloid neuropathy	Pubtator	11567048	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	10082470, 22571615, 22572854, 24966375, 28056871, 28115220, 28205565, 28274609, 29022894, 30319347, 31746246		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	LHGDN	12651613		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	8787669	Associate	★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	11567048		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28537420, 28713206, 30782181		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	25423568		★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	19252206	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	30367158, 31396093		★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	18279705		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22718861, 28867179, 29529089, 31046874		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	28558055, 29410969, 30923525		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	30923525	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	25789318	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	19652591, 25789318, 29181036		★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	28024939		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	32552251	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10082470, 15547674, 16305050, 17761193, 18079485, 18089449, 18279705, 18473849, 19875725, 21472666, 21512281, 23708564, 23936343, 24078092, 26083729, 26226616, 26323666, 26515415, 26664786, 26988587, 27930580, 28092162, 28535664, 28546110, 28826719, 29509268, 30323247, 30402462, 30783474, 31185146, 31378770, 31569571		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12070776, 27792788		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	21749686, 27792788	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16385501, 17425804, 19591173, 21749686, 24302816, 33301474, 37198231, 37565866, 40190499	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	21804548, 25503556, 27035254, 31141790, 36945930	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	25441632, 28926576, 29257350, 29656209, 30113140, 30261222, 30940519, 31003767, 31141790		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	10082470, 15547674, 16305050, 17761193, 18079485, 18089449, 18279705, 18473849, 19875725, 21472666, 21512281, 23708564, 23936343, 24078092, 26083729, 26226616, 26323666, 26515415, 26664786, 26988587, 27930580, 28092162, 28535664, 28546110, 28826719, 29509268, 30323247, 30402462, 30783474, 31185146, 31378770, 31569571		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	15155381, 18079965, 18777492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	15893388, 16316350, 16573830, 22966766, 25832424, 26226616, 26408307, 26664786, 28259164, 28535664, 30402462	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	19939336, 20372816		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	21089112	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	27372036		★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	31415766		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	37894820	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	21491613		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	27655844, 28461027	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27967251, 28226412, 28461027, 31266174		★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	34648622, 37108591	Stimulate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	24624928, 32665403	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	30685821		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	8787669	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	LHGDN	16728681, 19071026		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	31675694		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18058469, 22497255, 22983919, 23579957, 24619131, 27241711, 27669433, 28533055, 28695773, 30015912, 30633331		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23579957, 24619131, 25983116, 27241711, 28415882, 28533055, 28695773, 28712835, 30139236, 30633331, 31311926, 35346972, 35610613, 37461077	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	28320035		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	34156100	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	30822709		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18080716, 23298486, 23571222, 25582438, 25860956, 26018980, 26313784, 26931562, 27814276, 30265210, 30964104, 37497166, 37746694, 38148054	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16033829, 16166741, 21947242		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	24705787	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	26106610	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18080716, 22553402, 22754344, 24050307, 24510323, 26313784, 28187002, 30265210	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15331390, 15539404, 18575778, 20578941, 23333461, 23874853, 28056871, 29055529, 29068471, 29421442, 30664219		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23571222	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31046874, 32375296, 34771150	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21947243, 25407489, 26261503, 30964104, 32283652	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25811984, 37442189	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37497166	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	25854354	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23571222, 27814276		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	CTD_human_DG	28811376		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	37967839	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	12606536, 16159602, 18089449, 20040351, 20367988, 23527722, 26429324, 28660308, 28864204, 29259621, 29477598, 30402462, 30786741		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	12606536, 17224333		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	25582438, 26226616, 30402462, 33891554	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Stenosis	Carotid artery stenosis	Pubtator	32076951	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	16896921, 31491943		★☆☆☆☆ Found in Text Mining only
Cavitary Optic Disc Anomalies	Cavitary optic disc anomalies	Pubtator	31818258	Associate	★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	31049061		★☆☆☆☆ Found in Text Mining only
Centriacinar Emphysema	Pulmonary Emphysema	CTD_human_DG	30659203		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	19005067, 19071026		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	24107402	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	16728681, 19005067		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	19071026, 23252485, 23288172, 24107402, 25042092, 26429324, 29540615, 30900719		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	12837757, 7887450	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23144152, 30410591		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	23144152		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28045617		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	25385222	Stimulate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	17497647		★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	31840738		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	24520905, 25503556, 31160611, 33776579, 38148054	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	18089449, 26429324, 26607824, 31409386		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	20353610, 23921255, 24855059, 29477239, 29610703, 30778553		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	BEFREE	20353610		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	29946821		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21137019, 23947473, 24286382, 24520905, 27532455, 27755550, 28287180, 28704797, 29468936, 30457049, 30918021, 30971245, 31141790		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	28166215, 30804561		★☆☆☆☆ Found in Text Mining only
Chronic obstructive asthma (with obstructive pulmonary disease)	Asthma	BEFREE	25441632		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	11811511, 25988707, 31078654		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	22460069		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	39343816	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	26745632	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29248482		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	26745632	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	12740341	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21311028, 30542111		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	19558426, 39252247	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26193421, 26975699		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12579287, 15789216, 21945853, 24248547, 26931562, 30456802, 31620141		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12579287		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23693020, 24248547, 24952599, 26193421, 26931562, 32031046, 35352707, 35408786, 36033553	Associate	★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	30838867		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	22964273, 23527722, 28092162, 28546110, 30319444, 31371263		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21947243, 30122942		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	15547674, 15748606, 17172923, 18179750, 18279705, 19576587, 19766904, 20023238, 20668462, 21521347, 21861709, 21947881, 23236395, 23527722, 23894685, 24078092, 26515415, 26788516, 27930580, 29789792, 31275446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	15547674, 15748606, 17172923, 17924846, 18179750, 18279705, 19576587, 19766904, 20023238, 20668462, 21282351, 21521347, 21861709, 21947881, 23236395, 23894685, 24078092, 24155913, 26515415, 26788516, 27930580, 28427050, 30783474, 31275446		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	15547674, 17024691, 17172923, 17924846, 18279705		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	20023238, 23527722, 24155913, 26788516, 31275446, 38049831	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	15547674, 16159602, 17172923, 18179750, 18279705, 19576587, 19766904, 20023238, 20668462, 21521347, 21861709, 21947881, 23236395, 23894685, 24078092, 26515415, 26788516, 27930580, 31275446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary restenosis	Pubtator	18179750	Associate	★☆☆☆☆ Found in Text Mining only
CRANIOOSTEOARTHROPATHY	Cranioosteoarthropathy	BEFREE	25441632		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	25772690		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	19604442, 21311028, 24605038		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	24363518, 24605038	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	22860029, 25754382		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic fibrosis	Pubtator	22860029, 25754382	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	LHGDN	16052547, 17434489		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	16948116		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	18523305, 19342682, 22987041, 24905701, 26436377, 28474284, 29477598, 31146362		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	21297263, 27699858, 29098526, 30389362		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	21297263, 33416887, 39596595	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	LHGDN	16286548		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	37745719	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	39312335	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29702284		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	11457670		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	LHGDN	15986224		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10553500, 11334430, 11457670, 11723045, 16305050, 16728681, 17284935, 17924846, 18079485, 18089449, 18331236, 18473849, 19477910, 19833897, 20028726, 20053941, 20359471, 20726839, 21298413, 21861709, 22718861, 23432638, 25495026, 25754382, 25988707, 26323666, 26607824, 27156888, 27279795, 27297874, 27684793, 27869797, 27914528, 28099448, 28223295, 28385802, 28474638, 28504654, 28546110, 28695466, 28830942, 29373651, 29477598, 29702126, 29930087, 29948786, 30045252, 30132346, 30582209, 30613302, 31378770, 31492153, 31818258, 9044300		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	12837757, 16931519, 18575614, 18777492, 18952609, 20504772, 20943659, 21844192, 26325204, 31797865, 31863035, 32778679, 32802835, 33274206, 33891554, 34805401, 34964782, 35002537, 35154571, 35256890, 35590353, 35956419, 35993048, 37745719, 37800753, 37883761, 37895148, 37907428, 37967839, 38041088, 39533565	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	30781793	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	20568058	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10553500, 11334430, 11457670, 11723045, 16305050, 16728681, 17284935, 17924846, 18079485, 18089449, 18331236, 18473849, 19275604, 19477910, 19502378, 19833897, 20028726, 20053941, 20359471, 20398646, 20726839, 21298413, 21861709, 22402134, 22718861, 22966766, 23432638, 23894685, 24665124, 25042092, 25495026, 25754382, 25988707, 26323666, 26607824, 27156888, 27279795, 27297874, 27304070, 27684793, 27869797, 27914528, 28092162, 28099448, 28223295, 28385802, 28401370, 28474638, 28504654, 28546110, 28695466, 28830942, 29373651, 29477598, 29509268, 29693146, 29702126, 29930087, 29948786, 30045252, 30132346, 30324763, 30582209, 30613302, 30786741, 31378770, 31491943, 31492153, 31747350, 31818258, 9044300		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	10829018, 15933755, 16305072, 16931519, 17508727, 19591173, 20023238, 20215707, 22509345, 22966766, 24624928, 25582438, 25754382, 26313784, 26408307, 26745632, 27279795, 31818258, 33261162, 33416887, 34156100, 34512554, 35993048, 36363476, 37461077, 39312335	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	17588956		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31479091, 32552684, 33629304, 38139276, 7887450	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18575614, 26325204, 27655844, 29027826, 32986722, 37558746	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22509345	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	15203887, 20463655, 21996642, 26745632, 26770981, 28761062, 29222432, 33261162, 33274206, 38139276	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10553500, 16504296, 21298413, 23337054, 23432638, 24742661, 26456846, 26607824, 27883367, 29027826		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17632545		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11457670, 11586486, 12477623, 15052533, 15790669, 15896660, 17924846, 18079485, 18796298, 19502378, 19542745, 19766904, 20051912, 20410680, 21067489, 21067572, 22100610, 22354095, 22475522, 23721855, 24418399, 25666934, 25707513, 26745632, 26770981, 27033231, 27448675, 27873077, 28811295, 29222432, 30354109, 31027433, 31285784		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	12941744		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	21298413		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	10829018, 15203887, 16305072, 18765528, 23984879, 25582325, 32936764, 33274206	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	11375354, 11723045, 15290845, 20410680, 24418399, 27914528, 28713911, 29106804		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Angiopathies	Diabetic cardiomyopathy	LHGDN	15019601, 15663911, 16037279		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Angiopathies	Diabetic cardiomyopathy	CTD_human_DG	20372816		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Ketoacidosis	Diabetic Ketoacidosis	LHGDN	18775683		★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic ketoacidosis	Pubtator	31514489	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	16679697, 17697525, 18575614, 20463655, 26770981, 29027826, 32283652, 36181090	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	12606536, 14747204, 15052533, 15790669, 16969646		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	14747204, 15180953, 15790669, 16037279, 17345061, 18575614, 20040351, 21458563, 22475522, 24476693, 25707513, 26323666, 26770981, 27448675, 28385802, 28931523, 29844451, 30393200, 30672023, 31409386		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	LHGDN	15599399		★☆☆☆☆ Found in Text Mining only
Diabetic Polyneuropathies	Diabetic polyneuropathy	BEFREE	28223295		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	11375354, 12477623, 16440015, 19542745, 21067489, 21067572, 22116960, 22154374, 22354095, 22475522, 23545311, 24138043, 24303504, 27033231, 27684793, 29375686		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	12477623, 12941744, 14704946, 16440015, 17560613		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	21067572, 22116960, 24303504, 34125766, 34706712, 35590353	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disorders of Sex Development	Disorders of sex development	Pubtator	35237235	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	37446230	Associate	★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	22116960	Associate	★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	32028223	Associate	★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	25123133		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	25306249	Associate	★☆☆☆☆ Found in Text Mining only
Encapsulating Peritoneal Sclerosis	Encapsulating Peritoneal Sclerosis	BEFREE	15630905		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	29127203		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31665084		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29017437, 33922995	Associate	★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	30542111		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	21414994, 26828298, 28386293		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23571222		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	20578941		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	20578941		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36112883	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	27421025, 28974473, 29222432		★☆☆☆☆ Found in Text Mining only
Eye Neoplasms	Eye neoplasms	Pubtator	17325164	Associate	★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	30180189	Associate	★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	34445297	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	19822091	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	29928018	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28696785, 29928018, 30323247		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	29541234		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	18421017, 25673150, 29800549		★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia	Focal cortical dysplasia	BEFREE	21414994		★☆☆☆☆ Found in Text Mining only
Focal Emphysema	Emphysema	CTD_human_DG	30659203		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	23298486	Associate	★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	21414994		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28399536		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	28399536		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28379612		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	22966766	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33776579	Stimulate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	34269815	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	28226412		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	12206267		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	20028726, 22964273, 23527722, 28092162, 28546110, 30319444, 31371263		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	22964273, 23527722, 29784904	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	26664786	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	26391982	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	27241711, 30139236	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	17347281, 20185929		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	17347281, 20185929, 29625216		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	26011179, 35154571	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	22818582, 28024939		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	19477910, 19833897, 20112183, 20835858, 22818582, 24313337, 24420848, 27084094, 27156888, 28504654, 28505121, 30132524, 31569571		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	Pubtator	21996642	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	CTD_human_DG	24036142		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	11254667		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31569571		★☆☆☆☆ Found in Text Mining only
Hyperphosphatemia (disorder)	Hyperphosphatemia	BEFREE	29357413		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22966766, 29222432	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	20668462, 22353366, 22966766, 27084094, 27421025, 28407046, 30604625, 31246263		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophy	Hypertrophy	Pubtator	26788516	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoglycemia	Hypoglycemia	Pubtator	37558746	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	28226412		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	18080716, 20151982, 24952599	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30402462, 34445297	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28407046, 28975966, 30031694, 30180189, 30604625		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	18245812, 18421017, 19898558, 21137019, 26545872, 28198072, 28248552, 28977635, 30220079, 31211697		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	18245812		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	21278261	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	24427342, 27816054, 28248552, 32527263, 39529063, 39896814	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28115220, 28401370, 29127203, 29248482, 31521721		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	26048613		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17003481, 26349055, 28551086, 30542111		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	34156100, 35352707, 36706698	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	16305072, 26788516, 33274206, 34103691, 34745571	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	22914463	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	30704538, 30915367, 38041088	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis	Intrahepatic Cholestasis	BEFREE	22771726		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	28551086		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	16728681, 23252485, 24107402, 27930580, 29054968, 29245967		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	35075374	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	15213278, 18256374		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	15803111, 23894685, 26323666, 27638909, 30132346, 31396093		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	20463655, 25582438	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	18089449, 26429324, 26607824, 31409386		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	26261503	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	35280439	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31781300		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	24855059, 27421025, 31186521		★☆☆☆☆ Found in Text Mining only
Left ventricular systolic dysfunction	Ventricular Systolic Dysfunction	BEFREE	22964273		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30485425	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30485425		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	CTD_human_DG	16141792		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	16127291, 25330185, 25582438		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21717246, 22754344, 25888859, 26313784, 28187002, 28403886, 29445087, 29848691, 30265210		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	29928018	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	16941014, 20010835, 22860029, 25513711, 27026438, 32732977, 38148054	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	21137019, 22860029, 27913191, 28304347, 28926576, 30918021		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	12859967, 15247020, 15539404		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16166741		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23874853, 26042604, 28848092, 30664219, 32468030	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	31266174		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23628898, 28485798	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	31266174		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22513366, 31266174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	22513366		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus nephritis	Pubtator	23270666	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Vulgaris	Lupus Vulgaris	BEFREE	31266174		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18765528, 33629304	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24441189	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37497166	Inhibit	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	29317590, 32666702	Associate	★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Malformation of cortical development	BEFREE	21414994		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	12206267		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18058469, 22497255, 22983919, 23579957, 24619131, 27241711, 27669433, 28533055, 28695773, 30015912, 30633331		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31665084		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	20578941		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	20028726, 25407489		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15539404, 18575778, 20578941, 23333461, 23874853, 26782423, 28056871, 29055529, 29068471, 29421442, 30664219		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	25330185, 25582438		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	30822709		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27814276		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20398646, 25908451, 28811077, 28867179, 29529089, 29533466, 29573228, 29998364, 31590760		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15666359, 22206663, 28428279		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18519797, 28184178, 30719146		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11793367, 15539404, 15666359, 16127291, 18058469, 18331236, 19452310, 19477910, 20028726, 20398646, 22718861, 22843047, 23298486, 24697697, 25330185, 25407489, 25511739, 25603950, 25854354, 26011358, 26733160, 26782423, 26857858, 27669433, 27814276, 28011467, 28428279, 28546110, 28695773, 28712719, 28811077, 29262634, 29373651, 29421442, 29477598, 29541234, 29660374, 29987748, 30613302, 30864510, 31046874, 31534114		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23144152		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26193421, 26975699		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18058469		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15009731		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20093728, 24613454, 39266214	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24613454, 26018980, 26928771, 28011467, 29079306, 29387865		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26018980	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	26788516, 30047241, 37675469	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28101123, 29928018		★☆☆☆☆ Found in Text Mining only
Microangiopathy, Diabetic	Diabetic cardiomyopathy	BEFREE	18765528, 18855759		★☆☆☆☆ Found in Text Mining only
Microangiopathy, Diabetic	Diabetic cardiomyopathy	CTD_human_DG	20372816		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	26745632, 30389362		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	27372036		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	30323247		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25330185, 25582438	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30447136		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10741395		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	19757202, 21511691, 26382057, 28433998, 29617694, 31068938		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	24248547, 29617694, 36755464	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	30085099		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	24705787, 28461027	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	28461027		★☆☆☆☆ Found in Text Mining only
Myasthenias	Myasthenia Gravis	BEFREE	28461027		★☆☆☆☆ Found in Text Mining only
Myasthenic Syndromes Congenital	Myasthenic syndrome	Pubtator	28461027	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	29533466		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	29946821		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	16159602, 16728681, 19910580, 21208063, 28956473		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	15896660, 29789792		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	LHGDN	15896660		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	BEFREE	30085099		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	26048613, 30085099		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	20023238, 27297874, 31818258	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	34512554	Stimulate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	23337054		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	Pubtator	34745571	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	25503556, 25772690		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	25503556, 34653793	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18765528, 26382001, 30822709		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18765528, 25031745	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	25671828, 25772690	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10741395, 12206267, 12859967, 15331390, 15539404, 17640970, 18331236, 18575778, 19477910, 19834494, 20028726, 20509035, 21947242, 21947243, 22470535, 22571615, 24286852, 24613454, 24697697, 25407489, 26018980, 26106610, 27669433, 27814276, 28056871, 29421442, 29445087, 29693146, 29880821, 29987748, 30633331, 30719146, 31100066, 31428521, 31665084		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	37478256	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29127203		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17726019, 27804051		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	15933755, 17325164, 20943659, 21172926, 22843047, 33416887	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	20028726, 28108276, 29477598, 29625216, 30613302, 30902646		★☆☆☆☆ Found in Text Mining only
Neuronal Ceroid-Lipofuscinoses	Neuronal Ceroid Lipofuscinosis	LHGDN	18948101		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28179090, 28551086, 29409822		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11282423, 15539404, 17023736, 23071492, 28056871, 28670367, 31173265		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	28722189		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29928018, 30323247		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22987041, 24723555, 25681682, 26991258, 27188863, 28409494, 31231489, 31293451, 31315054, 31363816, 31412337, 31661887		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24388654, 37675469, 38139276	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29784904	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29928018, 30388921, 34103691, 37461077	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	16052547, 21172926, 23776688	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Knee	Osteoarthritis	Pubtator	27320800	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	22987041, 30912672		★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	16948116		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30685821		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29702126, 31555683		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27323159		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27323159	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34512554	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27814276		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27814276	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34886812	Associate	★☆☆☆☆ Found in Text Mining only
Panacinar Emphysema	Panacinar emphysema	CTD_human_DG	30659203		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20398646, 25908451, 28811077, 28867179, 29529089, 29533466, 29573228, 29998364, 31590760		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	CTD_human_DG	24036142		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15239215, 16061848		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	19834494, 21126167, 25908451		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30558665, 31046874, 31590760, 33086527, 33763295	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	34964698	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23169921, 24304868, 28385921, 28760504, 29387348, 29477598		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34745571	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	29477598		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	28385921		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	29533466		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	28849117	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	11811511, 27739344		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	31160611	Inhibit	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	29644926, 30429883		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	29644926		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	11567048	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Peripheral vascular disease	Pubtator	7887450	Stimulate	★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	31421026		★☆☆☆☆ Found in Text Mining only
Pleuropulmonary blastoma	Pleuropulmonary blastoma	BEFREE	31661887		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	24515114		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	24515114		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	27279795, 28125989		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	27279795	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	29946821		★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	30923525		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	LHGDN	15986224		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	21297263, 29098526, 30389362		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	31421026		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15666359, 22206663, 28428279		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	15666359		★☆☆☆☆ Found in Text Mining only
Prostatic Hypertrophy	Prostatic Hypertrophy	BEFREE	15666359		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	16033829		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15666359, 18302220		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	22206663		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29845254, 34708514	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30806068	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	12029499		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	28060905, 28707649		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28975966, 30180189		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	28975966, 30180189, 33334933, 34445297	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21659657, 21965014, 22461431, 23267696, 23886569, 24520905, 27117828, 27755550, 30971245, 31141790, 32336055, 34233669, 35331221, 36945930, 37442582	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32099002	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	23947473, 30659203		★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	CTD_human_DG	30659203		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	18245812, 18421017, 26545872, 28248552, 30536600		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	32732977	Associate	★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	12651613		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	25407489		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30122942		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	22966766		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	30113140		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28320035, 28775380, 29040215, 29422518, 31239497		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	25503556	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	18575614, 22116960, 22154374, 22354095, 22427038		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	30781346		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	30781346	Inhibit	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	17640970		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	LHGDN	17640970		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	32488134	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12070776, 17425804, 19604442, 24437572, 24556692		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12070776, 18078623, 18322992		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	16385501		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	17804836, 21156761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	BEFREE	17170388, 28469621		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	LHGDN	17170388		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22146151, 29875007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22146151		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	33334933	Associate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	18855584		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	22827914, 25572180, 26052716, 27172264, 28052995, 28358333, 28470354, 28760085, 29040215, 29127203, 30457049, 30826057, 31440260		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29728859		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	30402462	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	32076951	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	30402462, 31629469		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28056871		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16127291, 21617715, 25582438, 25811984, 28011467		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16127291, 17593216		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26316588		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31781300, 35280439	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	15539404, 29421442		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	25811984		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	12206267		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	27831944		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	30045252		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18519797, 28184178, 30719146		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23755764, 24248547, 24441189, 25652880, 30554489	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25860956, 33629304	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	24107402	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	26768594, 26823474, 28606778, 30144440, 31675694		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	29667227		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	GWASDB_DG	20383147		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	30594066		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	25854354		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	28504650, 28504654		★☆☆☆☆ Found in Text Mining only
Thromboembolism	Thromboembolism	Pubtator	24624928	Associate	★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	29929491		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	26605646, 36366933	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	25854354		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26125438, 28415882, 29880821, 31844158		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26125438, 30334817	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	21414994		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	26349055, 26782577		★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	28282589		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	26988587		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34796446	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36030212	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23144152, 33455114	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	32552251	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	10082470, 15290845, 16728681, 18179750, 18796298, 19275767, 23252485, 31492153, 9044300		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	17425804, 18179750, 22964273, 26664786, 33895357, 7887450	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	22966766	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	34445297	Stimulate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	33896376	Associate	★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	20528783	Associate	★☆☆☆☆ Found in Text Mining only