TLR4 (toll like receptor 4)

Gene

• Entrez ID: 7099
• Gene name: Toll like receptor 4
• Gene symbol: TLR4
• Synonyms (NCBI Gene): ARMD10, CD284, TLR-4, TOLL
• Chromosome: 9
• Chromosome location: 9q33.1
• Summary: The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003050	hsa-let-7i-5p	Luciferase reporter assay, qRT-PCR, Western blot	17660297
MIRT003050	hsa-let-7i-5p	Luciferase reporter assay, qRT-PCR, Western blot	17660297
MIRT006530	hsa-miR-146a-5p	ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21329689
MIRT006530	hsa-miR-146a-5p	ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21329689
MIRT006530	hsa-miR-146a-5p	ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21329689
MIRT006530	hsa-miR-146a-5p	ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21329689
MIRT018411	hsa-miR-335-5p	Microarray	18185580
MIRT023907	hsa-miR-1-3p	Microarray	18668037
MIRT031004	hsa-miR-21-5p	Microarray	18591254
MIRT053375	hsa-miR-146b-5p	Luciferase reporter assay, qRT-PCR	23798430
MIRT438116	hsa-let-7b-5p	Luciferase reporter assay	23437218
MIRT438116	hsa-let-7b-5p	Luciferase reporter assay	23437218
MIRT438116	hsa-let-7b-5p	Luciferase reporter assay	23437218
MIRT438116	hsa-let-7b-5p	Luciferase reporter assay	23437218
MIRT722926	hsa-miR-548g-3p	HITS-CLIP	19536157
MIRT722925	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT722924	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT722923	hsa-miR-4738-3p	HITS-CLIP	19536157
MIRT722922	hsa-miR-630	HITS-CLIP	19536157
MIRT722921	hsa-miR-4279	HITS-CLIP	19536157
MIRT722920	hsa-miR-3658	HITS-CLIP	19536157
MIRT722919	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT722918	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT449831	hsa-miR-4694-3p	PAR-CLIP	22100165
MIRT449830	hsa-miR-4698	PAR-CLIP	22100165
MIRT449829	hsa-miR-1468-3p	PAR-CLIP	22100165
MIRT449828	hsa-miR-7-5p	PAR-CLIP	22100165
MIRT449827	hsa-miR-6077	PAR-CLIP	22100165
MIRT449826	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT732201	hsa-miR-26b-5p	qPCR, Luciferase reporter assay	26222045
MIRT732201	hsa-miR-26b-5p	qRT-PCR, Luciferase reporter assay	26222045
MIRT732436	hsa-miR-485-3p	ELISA, Luciferase reporter assay, qRT-PCR, Western blotting	34103911
MIRT449829	hsa-miR-1468-3p	Immunofluorescence, qRT-PCR	34073556
MIRT732637	hsa-miR-5787	ELISA, Immunofluorescence, Luciferase reporter assay, Western blotting	33165670
MIRT732899	hsa-miR-140-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR, Flow cytometry	33122931
MIRT733048	hsa-miR-202-3p	ELISA, qRT-PCR	33893248
MIRT733483	hsa-miR-4268	Immunofluorescence, RNA-seq, qRT-PCR, Western blotting	34120606
MIRT733771	hsa-miR-23b-5p	Luciferase reporter assay, qRT-PCR, Western blotting	34110366
MIRT734334	hsa-miR-146a-3p	qRT-PCR, Western blotting	32176822
MIRT732899	hsa-miR-140-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR, Flow cytometry, ELISA	32073611
MIRT735023	hsa-miR-301a-3p	ELISA	33121303
MIRT006530	hsa-miR-146a-5p	qRT-PCR	31739406
MIRT735567	hsa-miR-329-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	33262815
MIRT735572	hsa-miR-885-3p	ELISA, Luciferase reporter assay, qRT-PCR, Western blotting	31763742
MIRT735623	hsa-miR-216a-5p	Luciferase reporter assay, Western blotting, Microarray, Immunofluorescence, qRT-PCR, ELISA	32019561
MIRT732899	hsa-miR-140-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), Immunofluorescence, In situ hybridization, Flow cytometry	31769066
MIRT736832	hsa-miR-103a-3p	qRT-PCR	32941517
MIRT736833	hsa-miR-107	qRT-PCR	32941517
MIRT737245	hsa-miR-145-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32801865
MIRT737392	hsa-miR-1178-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), RNA-seq, qRT-PCR	32059341
MIRT722926	hsa-miR-548g-3p	HITS-CLIP	19536157
MIRT722925	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT722924	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT722923	hsa-miR-4738-3p	HITS-CLIP	19536157
MIRT722922	hsa-miR-630	HITS-CLIP	19536157
MIRT722921	hsa-miR-4279	HITS-CLIP	19536157
MIRT722920	hsa-miR-3658	HITS-CLIP	19536157
MIRT722919	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT722918	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT449831	hsa-miR-4694-3p	PAR-CLIP	22100165
MIRT449830	hsa-miR-4698	PAR-CLIP	22100165
MIRT449829	hsa-miR-1468-3p	PAR-CLIP	22100165
MIRT449828	hsa-miR-7-5p	PAR-CLIP	22100165
MIRT449827	hsa-miR-6077	PAR-CLIP	22100165
MIRT449826	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT735572	hsa-miR-885-3p	Luciferase reporter assay, Western blotting, qRT-PCR	35156897
MIRT755856	hsa-miR-711	Luciferase reporter assay, Western blotting, qRT-PCR	36114541
MIRT755896	hsa-miR-16-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunofluorescence, ELISA	34854364
MIRT755916	hsa-miR-145-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35722425
MIRT722922	hsa-miR-630	Luciferase reporter assay, qRT-PCR	36926413
MIRT756208	hsa-miR-4512	Luciferase reporter assay, Western blotting, qRT-PCR	34721432
MIRT2127863	hsa-miR-1273g	CLIP-seq
MIRT2127864	hsa-miR-181a	CLIP-seq
MIRT2127865	hsa-miR-181b	CLIP-seq
MIRT2127866	hsa-miR-181c	CLIP-seq
MIRT2127867	hsa-miR-181d	CLIP-seq
MIRT2127868	hsa-miR-197	CLIP-seq
MIRT2127869	hsa-miR-203	CLIP-seq
MIRT2127870	hsa-miR-2053	CLIP-seq
MIRT2127871	hsa-miR-216a	CLIP-seq
MIRT2127872	hsa-miR-216b	CLIP-seq
MIRT2127873	hsa-miR-23a	CLIP-seq
MIRT2127874	hsa-miR-23b	CLIP-seq
MIRT2127875	hsa-miR-23c	CLIP-seq
MIRT2127876	hsa-miR-3160-5p	CLIP-seq
MIRT2127877	hsa-miR-3689a-5p	CLIP-seq
MIRT2127878	hsa-miR-3689b	CLIP-seq
MIRT2127879	hsa-miR-3689e	CLIP-seq
MIRT2127880	hsa-miR-3689f	CLIP-seq
MIRT2127881	hsa-miR-3929	CLIP-seq
MIRT2127882	hsa-miR-4262	CLIP-seq
MIRT2127883	hsa-miR-4289	CLIP-seq
MIRT2127884	hsa-miR-4311	CLIP-seq
MIRT2127885	hsa-miR-4318	CLIP-seq
MIRT2127886	hsa-miR-433	CLIP-seq
MIRT2127887	hsa-miR-4419b	CLIP-seq
MIRT2127888	hsa-miR-4427	CLIP-seq
MIRT2127889	hsa-miR-4478	CLIP-seq
MIRT2127890	hsa-miR-4645-3p	CLIP-seq
MIRT2127891	hsa-miR-4693-5p	CLIP-seq
MIRT2127892	hsa-miR-4761-5p	CLIP-seq
MIRT2127893	hsa-miR-548ag	CLIP-seq
MIRT2127894	hsa-miR-548ai	CLIP-seq
MIRT2127895	hsa-miR-550b	CLIP-seq
MIRT2127896	hsa-miR-569	CLIP-seq
MIRT2127897	hsa-miR-889	CLIP-seq
MIRT2127898	hsa-miR-892a	CLIP-seq
MIRT2127899	hsa-miR-944	CLIP-seq
MIRT2127863	hsa-miR-1273g	CLIP-seq
MIRT2127877	hsa-miR-3689a-5p	CLIP-seq
MIRT2127878	hsa-miR-3689b	CLIP-seq
MIRT2127879	hsa-miR-3689e	CLIP-seq
MIRT2127880	hsa-miR-3689f	CLIP-seq
MIRT2349552	hsa-miR-3940-5p	CLIP-seq
MIRT2127883	hsa-miR-4289	CLIP-seq
MIRT2349553	hsa-miR-4507	CLIP-seq
MIRT2349554	hsa-miR-587	CLIP-seq
MIRT2395856	hsa-miR-619	CLIP-seq
MIRT2643048	hsa-miR-122	CLIP-seq
MIRT2127863	hsa-miR-1273g	CLIP-seq
MIRT2643049	hsa-miR-1279	CLIP-seq
MIRT2643050	hsa-miR-145	CLIP-seq
MIRT2643051	hsa-miR-18a	CLIP-seq
MIRT2643052	hsa-miR-18b	CLIP-seq
MIRT2127869	hsa-miR-203	CLIP-seq
MIRT2643053	hsa-miR-2052	CLIP-seq
MIRT2643054	hsa-miR-219-5p	CLIP-seq
MIRT2643055	hsa-miR-2355-3p	CLIP-seq
MIRT2643056	hsa-miR-3064-3p	CLIP-seq
MIRT2643057	hsa-miR-3117-5p	CLIP-seq
MIRT2643058	hsa-miR-3180-5p	CLIP-seq
MIRT2643059	hsa-miR-345	CLIP-seq
MIRT2127877	hsa-miR-3689a-5p	CLIP-seq
MIRT2127878	hsa-miR-3689b	CLIP-seq
MIRT2127879	hsa-miR-3689e	CLIP-seq
MIRT2127880	hsa-miR-3689f	CLIP-seq
MIRT2643060	hsa-miR-3913-3p	CLIP-seq
MIRT2643061	hsa-miR-3920	CLIP-seq
MIRT2643062	hsa-miR-4256	CLIP-seq
MIRT2127883	hsa-miR-4289	CLIP-seq
MIRT2643063	hsa-miR-4303	CLIP-seq
MIRT2127885	hsa-miR-4318	CLIP-seq
MIRT2643064	hsa-miR-4328	CLIP-seq
MIRT2643065	hsa-miR-4445	CLIP-seq
MIRT2643066	hsa-miR-4635	CLIP-seq
MIRT2643067	hsa-miR-4652-3p	CLIP-seq
MIRT2643068	hsa-miR-4680-3p	CLIP-seq
MIRT2643069	hsa-miR-4735-3p	CLIP-seq
MIRT2643070	hsa-miR-4762-3p	CLIP-seq
MIRT2643071	hsa-miR-4782-3p	CLIP-seq
MIRT2643072	hsa-miR-4793-5p	CLIP-seq
MIRT2643073	hsa-miR-489	CLIP-seq
MIRT2643074	hsa-miR-508-3p	CLIP-seq
MIRT2643075	hsa-miR-511	CLIP-seq
MIRT2643076	hsa-miR-514	CLIP-seq
MIRT2643077	hsa-miR-514b-3p	CLIP-seq
MIRT2643078	hsa-miR-526b	CLIP-seq
MIRT2643079	hsa-miR-549	CLIP-seq
MIRT2643080	hsa-miR-578	CLIP-seq
MIRT2643081	hsa-miR-579	CLIP-seq
MIRT2395856	hsa-miR-619	CLIP-seq
MIRT2643082	hsa-miR-676	CLIP-seq
MIRT2643083	hsa-miR-943	CLIP-seq
MIRT2643048	hsa-miR-122	CLIP-seq
MIRT2127863	hsa-miR-1273g	CLIP-seq
MIRT2643049	hsa-miR-1279	CLIP-seq
MIRT2693220	hsa-miR-1298	CLIP-seq
MIRT2643050	hsa-miR-145	CLIP-seq
MIRT2643051	hsa-miR-18a	CLIP-seq
MIRT2643052	hsa-miR-18b	CLIP-seq
MIRT2127869	hsa-miR-203	CLIP-seq
MIRT2643053	hsa-miR-2052	CLIP-seq
MIRT2643054	hsa-miR-219-5p	CLIP-seq
MIRT2643055	hsa-miR-2355-3p	CLIP-seq
MIRT2643056	hsa-miR-3064-3p	CLIP-seq
MIRT2643057	hsa-miR-3117-5p	CLIP-seq
MIRT2643058	hsa-miR-3180-5p	CLIP-seq
MIRT2643059	hsa-miR-345	CLIP-seq
MIRT2127877	hsa-miR-3689a-5p	CLIP-seq
MIRT2127878	hsa-miR-3689b	CLIP-seq
MIRT2127879	hsa-miR-3689e	CLIP-seq
MIRT2127880	hsa-miR-3689f	CLIP-seq
MIRT2643060	hsa-miR-3913-3p	CLIP-seq
MIRT2643061	hsa-miR-3920	CLIP-seq
MIRT2643062	hsa-miR-4256	CLIP-seq
MIRT2693221	hsa-miR-4275	CLIP-seq
MIRT2127883	hsa-miR-4289	CLIP-seq
MIRT2127885	hsa-miR-4318	CLIP-seq
MIRT2643064	hsa-miR-4328	CLIP-seq
MIRT2643065	hsa-miR-4445	CLIP-seq
MIRT2643066	hsa-miR-4635	CLIP-seq
MIRT2643068	hsa-miR-4680-3p	CLIP-seq
MIRT2643069	hsa-miR-4735-3p	CLIP-seq
MIRT2643070	hsa-miR-4762-3p	CLIP-seq
MIRT2693222	hsa-miR-4774-5p	CLIP-seq
MIRT2643071	hsa-miR-4782-3p	CLIP-seq
MIRT2643072	hsa-miR-4793-5p	CLIP-seq
MIRT2643073	hsa-miR-489	CLIP-seq
MIRT2643074	hsa-miR-508-3p	CLIP-seq
MIRT2643075	hsa-miR-511	CLIP-seq
MIRT2643076	hsa-miR-514	CLIP-seq
MIRT2643077	hsa-miR-514b-3p	CLIP-seq
MIRT2643078	hsa-miR-526b	CLIP-seq
MIRT2643079	hsa-miR-549	CLIP-seq
MIRT2643080	hsa-miR-578	CLIP-seq
MIRT2643081	hsa-miR-579	CLIP-seq
MIRT2395856	hsa-miR-619	CLIP-seq
MIRT2643082	hsa-miR-676	CLIP-seq
MIRT2643083	hsa-miR-943	CLIP-seq
MIRT2127899	hsa-miR-944	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
IRF3	Unknown	22208359
IRF8	Unknown	10734131
SPI1	Activation	16785240;20956019
SPI1	Unknown	10734131
STAT6	Repression	16433852
ZNF160	Repression	19846881

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IBA
GO:0001530	Function	Lipopolysaccharide binding	IMP	16514062
GO:0001530	Function	Lipopolysaccharide binding	NAS	10835634
GO:0001540	Function	Amyloid-beta binding	IC	20037584
GO:0001726	Component	Ruffle	IEA
GO:0001875	Function	Lipopolysaccharide immune receptor activity	IBA
GO:0001875	Function	Lipopolysaccharide immune receptor activity	IDA	19252480
GO:0001891	Component	Phagocytic cup	IDA	30883606
GO:0002218	Process	Activation of innate immune response	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	IDA	14607928
GO:0002224	Process	Toll-like receptor signaling pathway	IEA
GO:0002246	Process	Wound healing involved in inflammatory response	IEA
GO:0002322	Process	B cell proliferation involved in immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002537	Process	Nitric oxide production involved in inflammatory response	IEA
GO:0002730	Process	Regulation of dendritic cell cytokine production	IEA
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	IBA
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	IDA	20037584, 38670073
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	IEA
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	ISS
GO:0004888	Function	Transmembrane signaling receptor activity	IDA	15618008
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	NAS	11970998
GO:0005102	Function	Signaling receptor binding	IPI	20037584
GO:0005515	Function	Protein binding	IPI	11441107, 11544529, 12925853, 15356101, 15728506, 16622205, 17064675, 17126326, 17258210, 17803912, 19060881, 19252480, 19509286, 20037584, 20547845, 21383675, 21829704, 21903422, 22474354, 22532668, 25187624, 29150600, 29190778, 36232715
GO:0005737	Component	Cytoplasm	IDA	19740627
GO:0005737	Component	Cytoplasm	IPI	20037584
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12055629, 38670073
GO:0005886	Component	Plasma membrane	IDA	11274165, 15027902, 16338228, 19740627, 36232715
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	NAS	33576548
GO:0005886	Component	Plasma membrane	TAS
GO:0006809	Process	Nitric oxide biosynthetic process	IEA
GO:0006909	Process	Phagocytosis	IDA	30883606
GO:0006952	Process	Defense response	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	10426995
GO:0007165	Process	Signal transduction	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	1406630, 9346484, 25038658, 34721373
GO:0007254	Process	JNK cascade	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0009897	Component	External side of plasma membrane	IDA	16514062
GO:0009986	Component	Cell surface	IDA	25204797
GO:0010008	Component	Endosome membrane	IDA	18222170
GO:0010008	Component	Endosome membrane	TAS
GO:0010467	Process	Gene expression	IEA
GO:0010572	Process	Positive regulation of platelet activation	IEA
GO:0010572	Process	Positive regulation of platelet activation	ISS	16514062
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	23817958
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0014002	Process	Astrocyte development	IEA
GO:0014004	Process	Microglia differentiation	IEA
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IEA
GO:0016020	Component	Membrane	IEA
GO:0016046	Process	Detection of fungus	NAS	11254600
GO:0022008	Process	Neurogenesis	IEA
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IDA	1406630, 9346484, 25038658, 34721373
GO:0030890	Process	Positive regulation of B cell proliferation	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IDA	10880523
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IGI	10880523
GO:0032496	Process	Response to lipopolysaccharide	IC	16514062
GO:0032496	Process	Response to lipopolysaccharide	IDA	12594207
GO:0032496	Process	Response to lipopolysaccharide	IDA	14607928
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032497	Process	Detection of lipopolysaccharide	IBA
GO:0032497	Process	Detection of lipopolysaccharide	IDA	19252480
GO:0032497	Process	Detection of lipopolysaccharide	IEA
GO:0032680	Process	Regulation of tumor necrosis factor production	IEA
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032689	Process	Negative regulation of type II interferon production	ISS
GO:0032700	Process	Negative regulation of interleukin-17 production	IEA
GO:0032700	Process	Negative regulation of interleukin-17 production	ISS
GO:0032707	Process	Negative regulation of interleukin-23 production	IEA
GO:0032707	Process	Negative regulation of interleukin-23 production	ISS
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	ISS
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	ISS
GO:0032722	Process	Positive regulation of chemokine production	IDA	19740627
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032727	Process	Positive regulation of interferon-alpha production	IEA
GO:0032727	Process	Positive regulation of interferon-alpha production	ISS
GO:0032728	Process	Positive regulation of interferon-beta production	IEA
GO:0032728	Process	Positive regulation of interferon-beta production	ISS
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	ISS
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	11432859
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032732	Process	Positive regulation of interleukin-1 production	IEA
GO:0032732	Process	Positive regulation of interleukin-1 production	ISS
GO:0032733	Process	Positive regulation of interleukin-10 production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	15027902
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	19740627
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	21329689, 30321456
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	17951129, 19740627, 21329689
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	17951129
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	30321456
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	IEA
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IBA
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	16751103
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	10196138, 15618008, 18222170
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IEA
GO:0034143	Process	Regulation of toll-like receptor 4 signaling pathway	IDA	19289601
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	IEA
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	ISS
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IEA
GO:0038023	Function	Signaling receptor activity	IDA	15618008, 16751103, 18222170
GO:0038023	Function	Signaling receptor activity	TAS	10426995
GO:0042088	Process	T-helper 1 type immune response	NAS	11970998
GO:0042100	Process	B cell proliferation	IEA
GO:0042116	Process	Macrophage activation	IMP	10835634
GO:0042742	Process	Defense response to bacterium	IGI	30321456
GO:0042742	Process	Defense response to bacterium	TAS	10426995
GO:0042802	Function	Identical protein binding	IPI	23059983, 23155421, 31319868
GO:0042995	Component	Cell projection	IEA
GO:0043032	Process	Positive regulation of macrophage activation	IEA
GO:0043032	Process	Positive regulation of macrophage activation	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	16968406, 19740627
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IGI	20037584
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	30233718
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0043235	Component	Receptor complex	IEA
GO:0043235	Component	Receptor complex	IPI	19252480, 20037584
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	NAS	33576548
GO:0045087	Process	Innate immune response	TAS	15356140
GO:0045321	Process	Leukocyte activation	IEA
GO:0045342	Process	MHC class II biosynthetic process	IEA
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	ISS
GO:0045671	Process	Negative regulation of osteoclast differentiation	NAS	12133979
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046651	Process	Lymphocyte proliferation	IEA
GO:0046696	Component	Lipopolysaccharide receptor complex	IBA
GO:0046696	Component	Lipopolysaccharide receptor complex	IDA	11274165, 19252480
GO:0046982	Function	Protein heterodimerization activity	IPI	20037584
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	15027902
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0050671	Process	Positive regulation of lymphocyte proliferation	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	19740627
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IMP	21329689
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA
GO:0050829	Process	Defense response to Gram-negative bacterium	IC	16514062
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	12594207
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	29038465
GO:0051132	Process	NK T cell activation	IDA	17057721
GO:0051403	Process	Stress-activated MAPK cascade	IEA
GO:0051606	Process	Detection of stimulus	IEA
GO:0060729	Process	Intestinal epithelial structure maintenance	IEA
GO:0060729	Process	Intestinal epithelial structure maintenance	ISS
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0061809	Function	NAD+ nucleosidase activity, cyclic ADP-ribose generating	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IDA	16314496
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070427	Process	Nucleotide-binding oligomerization domain containing 1 signaling pathway	IEA
GO:0070430	Process	Positive regulation of nucleotide-binding oligomerization domain containing 1 signaling pathway	IEA
GO:0070431	Process	Nucleotide-binding oligomerization domain containing 2 signaling pathway	IEA
GO:0070434	Process	Positive regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	11432859
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IGI	30321456
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0071223	Process	Cellular response to lipoteichoic acid	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071346	Process	Cellular response to type II interferon	IDA	11672593
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	26370079
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IDA	20037584
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IEA
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	ISS
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IDA	16968406
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IDA	16968406
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IMP	30321456
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	ISS
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IEA
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	ISS
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	IEA
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	ISS
GO:1903974	Process	Positive regulation of cellular response to macrophage colony-stimulating factor stimulus	IDA	11672593
GO:1904466	Process	Positive regulation of matrix metallopeptidase secretion	IMP	21329689
GO:1904646	Process	Cellular response to amyloid-beta	IDA	20037584
GO:1904646	Process	Cellular response to amyloid-beta	IGI	20037584
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	IMP	21329689
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	ISS

Other IDs

• MIM: 603030
• HGNC: 11850
• e!Ensembl: ENSG00000136869

Protein

• UniProt ID: O00206
• Protein name: Toll-like receptor 4 (hToll) (CD antigen CD284)
• Protein function: Transmembrane receptor that functions as a pattern recognition receptor recognizing pathogen- and damage-associated molecular patterns (PAMPs and DAMPs) to induce innate immune responses via downstream signaling pathways (PubMed:10835634, PubMed
• PDB: 2Z62, 2Z63, 2Z65, 2Z66, 3FXI, 3UL7, 3UL8, 3UL9, 3ULA, 4G8A, 5NAM, 5NAO, 8WO1, 8WTA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	55 → 114	Leucine rich repeat	Repeat
  PF13855	LRR_8	78 → 138	Leucine rich repeat	Repeat
  PF13855	LRR_8	126 → 187	Leucine rich repeat	Repeat
  PF13855	LRR_8	150 → 207	Leucine rich repeat	Repeat
  PF13855	LRR_8	447 → 508	Leucine rich repeat	Repeat
  PF13855	LRR_8	485 → 532	Leucine rich repeat	Repeat
  PF13855	LRR_8	496 → 556	Leucine rich repeat	Repeat
  PF01582	TIR	674 → 839	TIR domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in placenta, spleen and peripheral blood leukocytes (PubMed:9237759, PubMed:9435236). Detected in monocytes, macrophages, dendritic cells and several types of T-cells (PubMed:27022195, PubMed:9237759). Expressed in pan
• Sequence:

  MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLD
  LSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALG
  AFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHL
  DLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSL
  NVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDI
  IDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTS
  NKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLG
  LEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAG
  NSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPY
  KCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQL
  LVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLML
  LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAA
  NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLR
  QQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI

• Sequence length: 839

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMBLYOPIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGINA, STABLE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTERIOR UVEITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC RHINITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet disease	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COPD, severe early onset	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSBIOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENTEROCOLITIS, NECROTIZING	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GIANT CELL ARTERITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING IMPAIRMENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary angioedema with normal C1Inh	not provided	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog, GenCC GWAS catalog, GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISABILITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung adenocarcinoma	Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DEGENERATION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROTIZING ENTEROCOLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pericementitis	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY OPEN ANGLE GLAUCOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE, SEVERE EARLY-ONSET	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to severe coronavirus disease (COVID-19)	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to severe COVID-19	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TLR4 POLYMORPHISM	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TLR4-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY TRACT INFECTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION, LEFT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AA amyloidosis	AA amyloidosis	BEFREE	20714796		★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	22085193		★☆☆☆☆ Found in Text Mining only
Acne	Acne	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	22085193		★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	31081044		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	29910175		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	14563652, 15883205, 18373609, 25179298		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	14563652		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	CTD_human_DG	20981132		★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	19500628, 28921377		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	29286200		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	23890253, 24819208, 25624047		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21403649, 27277333		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	30336978		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	17124436, 17414051, 18288881, 19122498, 19280717, 24914392, 25872171, 28592850, 29620213, 30272284		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	16786156, 17324405, 21920464, 25797291, 28484456, 29968427, 30292843		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16786156		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	CTD_human_DG	23525077		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	23955118, 30292843		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28521455, 29788922		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	20556833		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	19496069		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	29802748		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	31650683		★☆☆☆☆ Found in Text Mining only
Adrenal Cancer	Adrenal Cancer	BEFREE	20826579		★☆☆☆☆ Found in Text Mining only
Adrenal Cortex Diseases	Adrenal Cortex Diseases	BEFREE	29782315		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	20238398, 21284667, 23009036, 28849499, 28849551, 30589437, 30756376, 31116255, 31235522		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21403649, 27277333		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	16971956		★☆☆☆☆ Found in Text Mining only
Adult Learning Disorders	Learning Disorders	CTD_human_DG	29107071		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	19953283, 25365350		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	15829498, 16936080, 18172114, 18385087, 19628747, 26936827, 31083239		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	CTD_human_DG	15829498		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	18172114		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	20826579		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	15875057, 17309585, 18983635, 19046305, 19426173, 26079505, 29105764		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	19763595, 21103885, 22402138, 23639307, 24524443, 24973272, 31281453, 31361168		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	12486107, 15801242, 19037967, 26086549, 26586036		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	23272070, 29671417, 30584014, 39183433, 39266981	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	18586243, 29851146		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	16157451, 21236243, 23272070		★☆☆☆☆ Found in Text Mining only
Amelogenesis imperfecta nephrocalcinosis	Amelogenesis Imperfecta	BEFREE	30979838		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	17982277, 21827663, 26936827, 29417448, 29520228, 29782315		★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	28342908, 29507585		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	25962427, 26640075, 27080948, 28763002		★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	20884065	Stimulate	★☆☆☆☆ Found in Text Mining only
Anaphylaxis	Anaphylaxis	Pubtator	30189430	Stimulate	★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	22180778		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	24036988		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	16779724, 22426798		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	16779724		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	40481763	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	15725697	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	18373609, 19556696, 23023379, 28407320	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	15725697	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	15883205, 29935876		★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	LHGDN	15883205, 17600225		★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	31236065	Associate	★☆☆☆☆ Found in Text Mining only
Angiolymphoid hyperplasia	Angiolymphoid Hyperplasia	LHGDN	18996347		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	28237711		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	15647432, 16277694, 16567359, 16837493, 17143969, 17459079, 18034244, 18634146, 20952467, 22717291, 26996117, 27692393, 31456484		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	LHGDN	17143969		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia	Anorexia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anterior uveitis	Uveitis	LHGDN	17389503		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anterior uveitis	Uveitis	BEFREE	30297336		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	17261530, 21901230, 22932793, 22964479, 24180619, 31654747		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	22106343, 22932793	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	29649455, 30530865, 30922233		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	30530865, 30922233	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	29549671, 30922233, 34348653	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	25120286, 30530865	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	26299839, 26318106, 26741694, 29549671		★☆☆☆☆ Found in Text Mining only
Aortic Valve Disease	Aortic valve disease	Pubtator	26515875	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	31739216		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	19195606, 25275309, 32074942, 33189669	Associate	★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	20826579		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	15273551, 29029533		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	24336024	Associate	★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial Occlusive Disease	BEFREE	12370224		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	32022379	Stimulate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11748108, 12124407, 12957699, 14522407, 14563652, 14764071, 15147329, 15249654, 15367917, 15528321, 15829498, 15864121, 15875151, 15882292, 15953129, 16890863, 16893397, 16907704, 16954131, 17101559, 17367503, 17849054, 17996871, 18000963, 18029454, 18456733, 18611449, 18690351, 19398177, 19661481, 19852543, 19900676, 19922963, 20375592, 20467793, 20504212, 20505314, 21298446, 21346151, 22360682, 22699754, 22857799, 23060524, 23239459, 23800176, 24108365, 24116867, 24376657, 25196434, 25348362, 25478796, 25757594, 26125411, 26318106, 26318748, 26399924, 26427793, 27224005, 27368140, 27807703, 27876618, 28344199, 28474755, 28609685, 28849148, 28957799, 29224353, 29226948, 29257345, 29570822, 29622163, 29663503, 29673358, 29737518, 30005060, 30007438, 30107164, 30120976, 30254012, 30283459, 30302814, 30351354, 30468503, 30551396, 30799593, 30881312, 31001118, 31125703, 31182969, 31231385, 31580158, 31597445, 31632534, 31654747, 31794767		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	BEFREE	17599732, 18060042, 19395541, 21858160, 22037282, 24243911, 26835987, 27271273, 28645307, 28724396, 28849116, 29501867, 31298290		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	LHGDN	17599732		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis Gouty	Gouty arthritis	Pubtator	23738004	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	25412934	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	15498795, 19248102, 23121667, 28222760, 28935693, 31941549	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	26830904, 34580414	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12847679, 15593217, 16052591, 16606645, 17255320, 18584044, 18765427, 19035519, 20615213, 21647866, 21654189, 22661088, 24286242, 24302816, 24643522, 24708416, 24936783, 26385789, 27716430, 28114971, 28222760, 28424490, 28677621, 31376255, 31620132, 31785408, 32674360, 34580414, 34635730, 37796367	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15986373, 17599732, 33377396	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35126351	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	23152086, 23738004		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	24696367, 26830904, 29547450, 30103798		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	LHGDN	17530716		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	19809335		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12406828, 12897738, 14735148, 15356557, 16215326, 16266379, 17877764, 17884733, 17989521, 18517079, 19067129, 19096003, 19159017, 19330007, 19842845, 19968634, 20072849, 20375592, 20711470, 21570715, 21905500, 22151743, 22402138, 23574398, 24243740, 24376096, 24524443, 24851022, 25036518, 25331070, 25530138, 25722071, 26588249, 26831416, 27495363, 28252235, 28858111, 28966674, 29337391, 29540770, 29935094, 30140039, 30186353, 30713767, 31525576, 31530336, 31588340, 31825792		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	12897738, 15356557, 16215326, 19159017		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	19159017, 21570715, 21905500, 22151743, 22994343, 23861935, 24524443, 24851022, 25036518, 26191227, 26831416, 27084682, 27977294, 29486764, 29504915, 30140039, 30530896, 31304782, 34246209, 34621380, 40650018	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	19842845	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Occupational	Asthma	BEFREE	27035106		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	23684765, 29912993	Associate	★☆☆☆☆ Found in Text Mining only
Asymmetric Diabetic Proximal Motor Neuropathy	Asymmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	14693986		★☆☆☆☆ Found in Text Mining only
Asymmetric Septal Hypertrophy	Septal Hypertrophy	BEFREE	23855302, 28878132		★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	32967147	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	20488792	Associate	★☆☆☆☆ Found in Text Mining only
Atelosteogenesis type 2	Atelosteogenesis	Pubtator	34425224	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11748108, 12124407, 12957699, 14522407, 14563652, 14764071, 15147329, 15249654, 15367917, 15528321, 15829498, 15864121, 15875151, 15882292, 15953129, 16890863, 16893397, 16907704, 16954131, 17101559, 17367503, 17849054, 17996871, 18000963, 18029454, 18456733, 18611449, 18690351, 19661481, 19852543, 19900676, 19922963, 20375592, 20467793, 20504212, 20505314, 21298446, 21346151, 22360682, 22699754, 22857799, 23060524, 23239459, 23800176, 24108365, 24116867, 24376657, 25196434, 25348362, 25478796, 25757594, 26125411, 26318106, 26318748, 26399924, 26427793, 27224005, 27368140, 27807703, 27876618, 28344199, 28474755, 28609685, 28849148, 28957799, 29224353, 29226948, 29570822, 29622163, 29663503, 29673358, 29737518, 30005060, 30007438, 30107164, 30120976, 30254012, 30283459, 30302814, 30351354, 30468503, 30551396, 30799593, 30881312, 31125703, 31182969, 31231385, 31580158, 31597445, 31632534, 31654747, 31794767		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	12124407, 16270639, 17681703, 17872459		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	12124407		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	12124407, 12796470, 15882292, 15953129, 16388712, 16890863, 17587646, 18029454, 18373609, 21298446, 21346151, 22357188, 22596222, 23121518, 23573259, 23816956, 24307759, 24346141, 24423463, 24518547, 25179298, 25196434, 25478796, 25757594, 26135899, 28344199, 28607410, 29547441, 30005060, 32345778, 34020127, 36158875, 36733418, 36890438	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	16412050, 35941971	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	29375116, 30760287, 33755965	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28034626		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	35082275	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	17082602, 19094215, 20810248, 22024499, 22582345, 23129427, 24176535, 24352680, 27067450, 28446897, 28645307, 29757592, 30740114, 31419926		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	17235555		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	24975964, 26830904, 34418898, 35449863	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome Type 2B	Autoimmune Lymphoproliferative Disorder	BEFREE	15746428		★☆☆☆☆ Found in Text Mining only
Autoimmune Pancreatitis	Autoimmune pancreatitis	Pubtator	28921377	Associate	★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	28342908, 29507585		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	18042837		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29363726, 30324684, 30536340, 30608918, 31090056, 31115023, 31378910, 31441362		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	28083607		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	23955118, 28530841		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	27008696	Associate	★☆☆☆☆ Found in Text Mining only
	Behcet Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	18234118, 18336589, 18411217, 19395541, 19796532, 23633568, 23940075, 25849652, 27467286		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	LHGDN	18234118, 18408113		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	18234118, 18336589, 23633568, 23940075, 32756992, 39838177	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	ORPHANET_DG	23633568		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	27243216, 30944713		★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	30872037, 31363123		★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	31363123	Associate	★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	LHGDN	16006099		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	22832610	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	24176535, 25790282, 28284355		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	24176535		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	25790282	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16094077, 18825409, 23065466, 23142523, 23612802, 25472584, 25499923, 26634514, 29844686, 30711948, 31448424		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18608206		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	23209568		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	29383704, 29869943	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	28746278		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	38367924	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	34905501	Associate	★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	25931355	Associate	★☆☆☆☆ Found in Text Mining only
Brachydactyly Type D	Brachydactyly	Pubtator	28504607	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Abscess	Brain Abscess	BEFREE	21496301		★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	24610929	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	BEFREE	20700129, 28547529		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	26437797	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30720218		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17979839, 19810822, 20618976, 21129170, 22560646, 22903472, 23510418, 23720768, 25299052, 25332681, 26063617, 26261595, 27187369, 28212583, 28280355, 28296189, 28927120, 28991224, 29435026, 29904116, 29932226, 30066873, 30317464, 30543015, 31287789, 31535397		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20618976, 21129170, 22560646, 23338716, 25274031, 25332681, 25360699, 26063617, 26261595, 26369701, 26392082, 26448179, 27187369, 28212583, 28950845, 29486738, 30066873, 31287789, 31789409, 32230799, 34299224, 35346972, 37771087, 37914385, 39375417	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25332681	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36224342	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	12897738, 19330007, 24851022, 30419239		★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	18684966	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	15143473, 16542364, 17471431, 19773677, 20575099, 22872782, 24376096, 25555213, 29253610		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	16542364, 29253610, 34332337	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	19497921	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	15640363		★☆☆☆☆ Found in Text Mining only
Bronchitis Chronic	Bronchitis	Pubtator	23514217	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	22348075, 23518821		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	22348075	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	26515875, 29227975	Associate	★☆☆☆☆ Found in Text Mining only
Camurati-Engelmann Syndrome	Diaphyseal dysplasia	BEFREE	15746428		★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	24376595		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	30610800	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20177675, 20618976, 21239458, 23430757, 24518707, 25034527, 25400780, 26158864, 29602239, 29670922, 30710321, 32050430	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35955552	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21152870, 24977712		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	22180778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	23338716	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21559380, 23465595, 25034527, 25053598, 25177689, 25179842, 27492456, 29338742, 29602239, 31340754, 31477445, 33576897, 35955552, 36012696, 37554278	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	30093453	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16094077, 18825409, 23065466, 23142523, 23612802, 25472584, 25499923, 26634514, 29844686, 30711948, 31448424		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	20164024		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17328955, 18763053, 26299699, 27545207, 28332554, 28484456, 29343453, 31218844, 31289487		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19619321, 22533866, 22985132, 24452475, 24977712, 27118139, 27460076, 29502561	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20556833, 30246618, 39518973	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23816956, 30287405, 32481352, 36932108, 38579915	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21527067, 23803172	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	27849634		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19826413, 24452475, 25681684, 27460076, 29502561		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	22180778		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	31681945	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	16714144, 28370906	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28256509, 31281454		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	14688801, 22645142	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated with Left Ventricular Noncompaction	Dilated cardiomyopathy	Pubtator	22645142	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	30309485	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	14688801, 30046376		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	14688801, 22645142, 30046376		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	15576653, 16803999, 17008589, 17332447, 21126202, 21220319, 22360682, 27321310, 27368140, 27495090, 28154178, 28668304, 28743964, 29547441, 29693119, 29767672, 30344664, 31016532, 31247943, 31328431, 31601156		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17100625		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	22357188, 24803744, 27495090, 29547441, 31328431, 36012132	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	31336567	Inhibit	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	12124407, 15953129, 17587646	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	12742999, 12957699, 15258789, 15953129, 16125159, 17587646		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	21393601, 25196434, 32076951	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	31715293, 34643941	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	25720378, 28492699		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	16984219, 17667714, 17927684, 18728522, 20483368, 30057921		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	16984219, 28028951, 30057921	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	LHGDN	17927684		★☆☆☆☆ Found in Text Mining only
Cerebral Aneurysm	Cerebral Aneurysm	BEFREE	19852543		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	15258789, 18523439, 20504212, 20700129, 21999375, 25590839, 25738964, 28392361, 28810574, 29113143, 29620142, 29867706, 30936996, 31432179, 31784084		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	18549840, 21206505, 21236709	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	26437797	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	19566553		★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	31256136, 31288981		★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	27738873		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	15576653, 15910856, 18523439, 21236709, 22580394, 24108365, 28428349, 28552908, 28963650, 29075930, 29085577, 29749502, 29909454, 29910175, 30386214, 30911939, 31038184, 31059808, 31451099, 31526124		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	23952655		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19541348, 20177675, 26548749, 28009429, 28013346, 28653898, 29207048, 29556281, 31278284, 31796857		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	20177675, 21527067, 22127462, 24878539		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19541348, 20177675, 24878539, 26548749, 28009429, 28013346, 28653898, 29207048, 29556281, 31278284, 31796857		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	22302853	Associate	★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	18368233	Associate	★☆☆☆☆ Found in Text Mining only
Chediak-Higashi Syndrome	Chediak-Higashi Syndrome	BEFREE	25528552		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21403649, 27277333		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	16107886		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	19148143, 20685742, 24376096		★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	28530841		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30457560, 30764893, 30989725		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	30457560	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	20492496		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	20492496, 31453712		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	30141207	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholesteatoma	Cholesteatoma	BEFREE	25922834		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	31947538, 32915926, 33627146	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma Middle Ear	Middle ear cholesteatoma	Pubtator	31947538	Stimulate	★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	31465768		★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	28843904		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	31065010	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	26490558		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	21677444, 27614743, 27897392, 29481790, 31049139		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	LHGDN	16738534		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24144314, 28083607		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	29946821		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	18034897		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20888880, 21439805, 21730072, 22438960, 22952638, 26361369, 27442627, 28025440, 28536249, 28537664, 28714001, 29025711, 29535517, 29704988, 30298576, 30972742, 31543817, 31640653		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic otitis media	Otitis media	BEFREE	26055429		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	15664906, 15875057, 16246938, 17309585, 17555409, 17559631, 19426173, 19811440, 21899586, 26174031, 26771980, 28025440, 29488617, 31772831		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	15664906, 17176826, 24363500, 27411657, 28025440, 30571680	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	16428799	Inhibit	★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	BEFREE	27070349		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	22182736		★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	21466684	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	12610323, 18666712, 19085953, 22173161, 22330637, 25014492, 25516666, 27391584, 30304545		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	27585667		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	31068207, 31580163		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	21827663		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	16622187, 16790781, 16952555, 17653282, 18586081, 19238529, 21674704, 22918682, 24740503, 24992835, 27105524, 27995407, 28102669, 28189973, 28683149, 29247612, 30445455, 30664156, 30672380, 31336879, 31497551		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	15194649, 16085746, 16840031, 18040078, 20360984, 22185629, 23811547, 24971461, 27895398, 28408791, 29794741, 36768553, 39252247	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	19664152, 24828022, 24971461, 26462859	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20228668, 21054580, 21792899, 21920464, 23691015, 24390484, 24934366, 26760960, 26771524, 27837433, 28417458, 29122314, 29308184, 29696632, 30214578, 30472806, 31484704		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	21054580, 23949880, 28765705, 39223499	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16706818, 16879199, 17549384, 19760027, 21625017, 21633598, 22180778, 22999059, 23318418, 23691015, 23949880, 24114613, 24446182, 24705379, 25216863, 25633197, 25705893, 26167073, 27177773, 27713159, 27837433, 28423670, 28521455, 28753429, 28765705, 28815730, 29206292, 29508166, 29566186, 29883450, 30121899, 30649440, 30710321, 30850734, 31117848, 31132191, 31484704, 31620141		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	16879199, 22180778		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16706818, 16879199, 17549384, 19106585		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	16879199, 22180778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19436306, 19596916, 19760027, 20145615, 21625017, 21792899, 21845432, 22180778, 23071493, 23949880, 24390484, 24446182, 24887394, 24934366, 25705893, 26167073, 26771524, 26894861, 27713159, 28408791, 28417458, 28765705, 29566186, 29883450, 30598580, 30612312, 30649440, 30710321, 32050430, 32210720, 32862585, 34689394, 36649244, 37628686, 38415550	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25547486	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	21548449, 29618830, 29757592, 30698158		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	29757592, 37626865	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	17187404, 27391584, 28082516, 28414577, 29276096		★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	BEFREE	28302458		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	28934735, 30229811		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	Pubtator	32765497	Associate	★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	20127226		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	29534643, 30764893		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	28108421		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	21538184, 22645142, 23754516, 27228349, 28753907, 28824368, 29257294, 29807331, 31196626		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	18725520		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29637002		★☆☆☆☆ Found in Text Mining only
Corneal Injuries	Corneal injury	Pubtator	32016117	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	30595046		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	28344199	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	32022379	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12742999, 12957699, 15864121, 17101559, 19140875, 19273219, 20524934, 21126202, 21226932, 21628510, 24146036, 25542811, 25882064, 26959040, 28002812, 28092654, 28793055, 30536340, 30784241, 30854968, 30857550, 31082501, 31644579		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	20524934		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	12742999, 12957699, 17172927		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	12957699, 15632890, 15864121, 17045300, 19140875, 19273219, 20524934, 21899916, 24146036, 25385173, 25542811, 25882064, 26841679, 26936111, 26959040, 28002812, 28092654, 28427050, 28793055, 30021655, 30784241, 30857550, 31082501		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	15725697, 26959040, 28002812, 28092654, 28407320, 33506919, 36184551, 37222220, 38275751	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	16412050, 23121518, 30857550	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	20524934		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	12957699, 15367917, 15864121, 15910856, 18220812, 19140875, 19273219, 20524934, 24146036, 25542811, 25882064, 26959040, 28002812, 28092654, 28793055, 30367682, 30784241, 30857550, 31082501		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Stenosis	Coronary Stenosis	BEFREE	12957699, 17101559, 19140875, 24146036, 31780868		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	LHGDN	19140875		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	19140875, 31780868	Associate	★☆☆☆☆ Found in Text Mining only
Cranial nerve palsies	Cranial Nerve Paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Crisponi syndrome	Crisponi syndrome	Pubtator	37335026	Inhibit	★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	20957032, 32035159	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	15190267, 15194649, 15655821, 15905704, 15973118, 16010583, 16024933, 16148063, 16907704, 17325555, 17333217, 17504508, 17538633, 17850411, 17914947, 18028374, 18174680, 18213697, 18397186, 18493210, 18680223, 19275920, 19664207, 20093834, 21039068, 21406388, 22573572, 22605977, 22783049, 22918682, 23470644, 23575333, 24776844, 24971461, 25492126, 26023918, 26316104, 26830904, 27107867, 27290609, 27714784, 27895399, 28452812, 29055077, 29421805, 30142321, 30517639, 30901719		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	15194649, 15655821, 15770725, 17538633, 18028374, 18336589, 18680223, 19095953, 21079743, 21157977, 24971461, 26830904, 27895399, 33743589, 35529850, 36462956, 37550393	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	LHGDN	15655821, 15905704, 17827066		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	CTD_human_DG	17914947		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	18040078, 19664152, 24828022, 37567009	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	32872480	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	17914947		★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	17914947		★☆☆☆☆ Found in Text Mining only
Cryopyrin-Associated Periodic Syndromes	Cryopyrin-Associated Periodic Syndromes	BEFREE	30352992		★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Proximal symphalangism	Pubtator	28002812	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	28886315, 29338742		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	29588627		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	15661927, 15776129, 16830219, 17890129, 19502387, 22466961, 23316065, 30177416, 31813753	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	15776129, 16830219, 17890129, 19502387, 21649525, 22466961, 25239913, 29775649, 31813753		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	18684966, 25329529	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	Pubtator	19543401	Inhibit	★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	Pubtator	19543401	Associate	★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	29475562, 29717937, 31091120		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	16319097, 18584044, 21474483, 21748790, 21798884, 22037282, 22225630, 27271273, 28093922, 28883757, 30299441, 30565728, 30569118, 30922122, 31113580, 31715293, 31781260		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	24992835		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30071285		★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	26907088, 28783736, 29508680, 29510469		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	24243911, 26415953, 29463000, 29561292, 29765402, 30847567, 31068207		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	33903586	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	33112414	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29851146, 30246296, 31226360, 31811054		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	22032785, 22686584, 22710427, 28593178, 28713916, 35349724	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	37187734	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	28342908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	20109744, 20631729, 22032785, 22686584, 26534745, 28593178, 28713916, 29851146, 30273064		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	28713916		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	19953283, 25365350		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	19953283	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	25365350	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	25365350		★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15632890, 19187771, 19455302, 21306745, 21628510, 22217446, 25746357, 27591966, 27650857, 28695466, 28830942, 28933050, 29059081, 29066305, 29490521, 29787520, 29850615, 29909454, 29960272, 30129410, 30145096, 30171701, 30211669, 30221655, 30287405, 30953645, 31110312, 31432707, 31678553, 31732468		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	27340831	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	33019392, 39397405	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15632890, 19187771, 19455302, 21306745, 21628510, 22217446, 25746357, 27591966, 27650857, 28695466, 28830942, 28933050, 29059081, 29066305, 29490521, 29658605, 29787520, 29850615, 29909454, 29960272, 30129410, 30145096, 30171701, 30211669, 30221655, 30287405, 30953645, 31110312, 31432707, 31678553, 31732468		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	18306470, 20846165, 21125016, 22357188, 29547441, 30287405, 37773841, 39397405	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18029454, 20153491, 33071971	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19455302, 25942429	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18298826, 23465595, 23936790, 24085443, 24883015, 27095356, 30287405, 31065010, 31785408, 36552771, 37830554, 37876569	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18633101, 20067962, 24786705, 27904654, 34657898	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25959254	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	14693986, 17130564, 18029454, 18728522, 19148143, 19455302, 22217446, 31677982, 31763742		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	18029454		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	14693986, 15258789, 18298826, 19135114, 19395279, 20067962, 21628510, 22956123, 23163570, 23465595, 23936790, 24085443, 24444085, 24779014, 24786705, 24845156, 24883015, 25095741, 25104099, 25479716, 25648392, 25947554, 26255137, 26345801, 27321310, 27904654, 28620993, 28933050, 29066305, 29073942, 29319180, 29426925, 29428931, 29735607, 30211669, 30254418, 30272307, 30287405, 30403590, 30510205, 30536833, 30953645, 31222667, 31299021, 31678553, 31785408		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Amyotrophy	Diabetic Amyotrophy	CTD_human_DG	14693986		★☆☆☆☆ Found in Text Mining only
Diabetic Asymmetric Polyneuropathy	Diabetic Asymmetric Polyneuropathy	CTD_human_DG	14693986		★☆☆☆☆ Found in Text Mining only
Diabetic Autonomic Neuropathy	Diabetic Autonomic Neuropathy	CTD_human_DG	14693986		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	23936790, 39702546	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Mononeuropathy	Diabetic Mononeuropathy	CTD_human_DG	14693986		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	24786705, 35291915	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	22021706, 24357461, 24558454, 24779014, 24786705, 25196431, 28641285, 28946139, 29018490, 29059081, 29207360, 29207635, 29384065, 29861832, 30171701, 30211669, 30229838, 30257355, 30295314, 30476082, 30959575, 31208912, 31608008, 31630796, 31696221		★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	CTD_human_DG	14693986		★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	BEFREE	29719281		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	14693986		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic Nephropathy	LHGDN	14693986		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic Nephropathy	CTD_human_DG	14693986		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	27981790	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Polyneuropathies	Diabetic polyneuropathy	CTD_human_DG	14693986		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	19135114, 21628510, 24883015, 25610879, 25947554, 27173229, 27321310		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	24883015, 25610879, 28858846, 36506045	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diarrhea	Diarrhea	Pubtator	34583337	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	34583337	Inhibit	★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	30273982	Associate	★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	25246042, 30953960		★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular disease	Pubtator	25133198	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	30390640		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	30390640	Stimulate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	30008389		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	17309748, 18809506		★☆☆☆☆ Found in Text Mining only
Dysgerminoma	Dysgerminoma	BEFREE	15331405		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	19661481, 29622163, 30139760, 30211669, 30872037, 31661889		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	33426065	Associate	★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	19135114, 21628510, 24845156, 26255137		★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	24740503, 31638207		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	31477211		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	20109744, 20631729, 20646366, 22032785, 22686584, 26534745, 28593178, 29851146, 30273064		★☆☆☆☆ Found in Text Mining only
Elliptocytosis 4	Elliptocytosis	BEFREE	22470535		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	22251849, 23170858	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	29555931, 30554160		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Encephalomyelitis Acute Disseminated	Acute disseminated encephalomyelitis	Pubtator	33597947	Stimulate	★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	31369614		★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	24361409		★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	18775079		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18775079, 20646321, 26872033	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	18596029, 21214494, 23252918, 26362992, 26872033, 28470452		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	18596029, 18775079		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18775079, 36339397, 40187212	Associate	★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	18586081, 28281719		★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	34362295	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	26274503, 29276042, 39342173	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	24968337, 29357863		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia	Eosinophilia	Pubtator	25069610	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia	Eosinophilia	CTD_human_DG	26882889		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia, Tropical	Eosinophilia	CTD_human_DG	26882889		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	29691386	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	37967572	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	20807077, 27939857, 29382328, 29393419, 29682548, 29808547, 31241711, 31702493		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	23706953, 29382328, 37946105	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	37946105	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	23810712, 28176142, 28867282, 31026566		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27460076, 29502561		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	29032115, 30145096, 30484894		★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Esophageal achalasia	Pubtator	27511445	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	21609936, 27323819, 30292843, 31293986		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	21609936, 27323819, 30292843, 31293986		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26369701, 27323819, 28531216, 29670922, 29968427	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21990957	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29968427	Associate	★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	22831837, 27892755		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	31221509		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	31221509	Stimulate	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	28531216		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	19647494, 24054763	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	18641190, 27022031		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	BEFREE	23075869, 23816536, 24349054, 28351520, 28632732, 29884546, 30174308, 31788011		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	31001563	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	24997224	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	21046243, 23855302, 24997224, 25989356, 26113297, 28038359, 28878132, 29077272, 29190550, 29335857, 29884546, 30737662, 30841442, 31101239, 31113580, 31421545, 31574193, 31786271, 31808577		★☆☆☆☆ Found in Text Mining only
Fatty Liver, Alcoholic	Alcoholic Fatty Liver	BEFREE	29884546		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibroadenoma	Fibroadenoma	BEFREE	26261595		★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	29589070		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	18694726, 19586676, 19809335, 20400193, 22173161, 23093310, 24378685, 24448807, 24657401, 25177689, 28412299, 28601590, 28623125, 28634394, 29268190, 29321784, 29366780, 29743985, 30194936, 30858122, 31200771, 31295018		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	29382328		★☆☆☆☆ Found in Text Mining only
FOCAL CORTICAL DYSPLASIA OF TAYLOR	Focal cortical dysplasia	BEFREE	29382328		★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	29382328	Associate	★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	28407405, 30125459		★☆☆☆☆ Found in Text Mining only
Focal Segmental Glomerulosclerosis, Not Otherwise Specified	Focal segmental glomerulosclerosis	BEFREE	28407405		★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	31712142		★☆☆☆☆ Found in Text Mining only
Functional Gastrointestinal Disorders	Functional Gastrointestinal Disorders	BEFREE	29085211		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	20492496, 21283657		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	21283657	Associate	★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	BEFREE	15273551		★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastric Cardia Carcinoma	Gastric Cardia Carcinoma	BEFREE	17324405, 29670922		★☆☆☆☆ Found in Text Mining only
Gastric lymphoma	Gastric lymphoma	BEFREE	16019531		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	15240737, 17309748, 18082569, 20332463, 24508388, 26161647, 31690518		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	LHGDN	18082569		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	22468087, 25400780, 28368946, 32719215	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	18755634, 19191896, 20721625, 25084512		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	29968427, 33686512	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	27055018, 30497076		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	24717721, 29085211	Associate	★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	28196704		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	19531762, 19646345, 21586524, 21726670, 22011399, 23065292, 24447403		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gingivitis	Gingival diseases	Pubtator	17176826, 31448244	Associate	★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	18454672, 30571680		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	LHGDN	18586872		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	22831837, 27064537, 28214954, 29845210, 30877182		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	22773901, 27861595, 38240248	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	31428642		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	22773901, 22831837, 27064537, 27526043, 27892755, 28214954, 30612922, 30877182, 31697008		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21127066, 28089910, 28583844, 28641579, 29679017, 29740218, 30680070		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21127066, 21705839, 29679017, 31037147, 33476981, 36520928	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33446690	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21127066, 28089910, 28583844, 28641579, 29679017, 29740218, 30680070		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27669113, 34110366	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28641579, 28881826, 30145468, 30385233, 31123407		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	17082602, 31220697		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	35484716	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	19891659, 27818460, 33324395	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	31489594, 32388684	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	26808548	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	11529488	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	11529488, 22703024		★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	21412229		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	21412229	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	24830583, 31554206		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	31554206	Associate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	15081257, 19913922, 25954926, 31019995		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	17850411, 20079790		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	30924423		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	12591988, 15289356, 21854645, 30865385		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	21854645, 30865385	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Disorders	Headache	Pubtator	39488053	Inhibit	★☆☆☆☆ Found in Text Mining only
Hearing Disorders	Headache	Pubtator	39488053, 40023593	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	22662111, 40023593	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hearing Loss	Hearing loss	Pubtator	32553077	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hearing Loss Sensorineural	Hearing loss	Pubtator	32553077	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	27226520	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29176403		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	LHGDN	16714144		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	16714144, 22645142, 36733418	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	21538184, 22645142, 23754516, 27228349, 28753907, 28824368, 29257294, 29807331, 31196626		★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	18382655		★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	LHGDN	18382655		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	24356089, 28484092		★☆☆☆☆ Found in Text Mining only
HEMIHYPERPLASIA, ISOLATED	Hemihyperplasia	BEFREE	29673358		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	19809335, 24409064		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	24409064	Associate	★☆☆☆☆ Found in Text Mining only
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	19809335		★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	16738534	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	21969092, 31153054		★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia	BEFREE	25417755		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	22300618	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	19597734, 28905155		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	25516666	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	24997224	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	25337250	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	24349054, 25177689	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	19586676, 31962161	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	26276725		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	19809335		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	24295404		★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	23106544		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	16971956, 29429793, 29481790		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29429793, 29481790, 31580163, 31724242		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	31724242	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	17849054		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	14764071		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	19447045, 19455302, 25610879, 26908090, 26959040, 29719281, 30129410, 30175447, 30194878, 30953645, 30959575, 31088634, 31501716, 31731054, 31732468		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	19447045, 21996642, 26959040, 32806763	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	25610879, 25894202	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	28386844, 28665886, 28738166, 31782769		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	28154178, 31110312		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	26497845, 28668302, 29649455, 29960272, 31507457		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	26959040	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22533660	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	23272070, 25120286, 28359064, 29504915, 30530896	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	25050807	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	25329529	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension, Goldblatt	Hypertension	BEFREE	29863269		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18382655, 22229967, 23269975, 24637196, 25050807, 25182168, 26917360, 28330785, 28359064, 28386844, 28665886, 28738166, 28743964, 29215742, 29767672, 29981161, 30211669, 30276527, 30610955, 30793936, 31432707, 31641986, 31708733		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	27292124		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	30211669		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30309485		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30309485		★☆☆☆☆ Found in Text Mining only
Hypertrophy of tonsils	Hypertrophy Of Tonsils	BEFREE	21159925		★☆☆☆☆ Found in Text Mining only
Hypotrichosis simplex	Hypotrichosis simplex	BEFREE	20945369		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30226538, 31075559, 32028672, 34299186	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37377965	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	29956801		★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	28210837		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19898558, 27815256, 31020321		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	24613046	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	19891659, 21677444, 22131235, 24756968, 27818460, 28397719, 29230705		★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	17914947		★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	BEFREE	28647362		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	26273144, 29149705		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	27895398	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	33114004	Stimulate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	28412855		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	21842208, 23890253, 28166799		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21827663, 27738803, 28684969, 28738878, 30272307, 30541786, 30613303, 30962497, 31724242, 31786271		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	25365350		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	19218437, 40462131	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Female	Female infertility	Pubtator	40462131	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	30111215		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11396812, 15207785, 15655821, 15879143, 15905704, 16840031, 17206636, 17538633, 17850411, 17991289, 18034244, 18174680, 18338763, 18680223, 18972554, 19230040, 19275920, 19710105, 21068720, 21203467, 22664939, 22918682, 23170831, 23239925, 23437263, 23470644, 24971461, 25492126, 26023918, 26462859, 26755160, 27417569, 27903427, 28089357, 28452812, 29055077, 30423580, 30617966, 30885307, 31063017, 31539144		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	15194649, 15655821, 16840031, 17538633, 17595233, 18040078, 18680223, 19230040, 23239925, 24828022, 26462859, 31063017, 31539144, 32478906, 32661180, 36462956, 36768553, 37550393, 37567009, 37931537, 38415550	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17538633, 17850411, 18680223		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17991289, 19710105, 23437263	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29851146, 30246296, 31226360		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	18633101, 21125016, 21952248, 22357188, 23454694, 24043885, 27340831, 28270597, 28858846, 29410345, 29649324, 31162913, 32708841, 33686181, 34034759, 36221354	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	24846769	Stimulate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	30584014		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	30584014	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	24997157	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	27737814, 29115481, 29908959		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	18336589, 22810014, 25400780	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	20580721, 24789205, 26349656		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	30650348		★☆☆☆☆ Found in Text Mining only
Intestinal Perforation	Intestinal Perforation	BEFREE	27290609		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	28400792, 28433851, 29754966, 30961678		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	35833148	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	23651260, 24269697		★☆☆☆☆ Found in Text Mining only
Intravascular hemolysis	Intravascular Hemolysis	BEFREE	30850533		★☆☆☆☆ Found in Text Mining only
Intrinsic Factor Deficiency	Intrinsic Factor Deficiency	BEFREE	31845221		★☆☆☆☆ Found in Text Mining only
Intussusception	Intussusception	BEFREE	29487699		★☆☆☆☆ Found in Text Mining only
IRAK4 Deficiency	IRAK4 Deficiency	BEFREE	17893200		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	19809335		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	33046755	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	18972554, 23028414, 28246611, 31689935		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	23028414, 27150852, 28246611	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	33750831, 37404119	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ischemic stroke	Ischemic Stroke	BEFREE	15910856, 18549840, 23726813, 24108365, 28963650, 29075930, 29275013, 29909454, 30001721, 30377701, 30794438, 31526124, 31784084		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	24784586	Associate	★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	31671112		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	15498795, 20571165, 23121667, 25920454		★☆☆☆☆ Found in Text Mining only
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	23417289		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	18996347, 29051178, 30651761		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	16926427, 19234168, 19474209, 22809755, 27694040, 29675369, 30647960		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratitis	Keratitis	Pubtator	31856463	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	HPO_DG			★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	29021606		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	29021606	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	17082602, 20810248, 21677444, 22021706, 29384065, 30221655, 30254418, 31151053		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	19218437, 21220755, 24773611, 28530841, 29923769, 32388684, 35484716	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	18622290		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure	Kidney Failure	CTD_human_DG	27585667		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	24646859, 27602552, 28569136, 28685413, 28805489, 28898406, 28978536, 29261164, 29500224, 30053391, 30706443, 30716318, 30915370, 30968541, 31017010, 31115903		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	29286200		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	LHGDN	17390084		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	26490558, 29309503		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	24786705	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	38579915	Inhibit	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	20164024, 21478107	Associate	★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	CTD_human_DG	29107071		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disabilities	Learning disorders	Pubtator	30584014	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disorders	Learning Disorders	CTD_human_DG	29107071		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disturbance	Learning Disorders	CTD_human_DG	29107071		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	26588247		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	26617709	Associate	★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	Leopard syndrome	Pubtator	38049739	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	19430824, 22348338, 23784377, 24169261, 28327786		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	19430824, 28327786, 37187734	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19631641, 20307689, 21403649, 23071570		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	18155167	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20814675, 25412934, 33247673, 36076988, 39251712	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23263202, 25412934, 25427560, 25624047, 28137827, 30336978, 31845221		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	21403649		★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	31129425		★☆☆☆☆ Found in Text Mining only
Leukostasis	Leukostasis	BEFREE	28400700		★☆☆☆☆ Found in Text Mining only
Lichenoid Eruptions	Lichenoid Eruptions	BEFREE	30883858		★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	24786705, 28210837		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21559380, 22286521, 22330637, 22516259, 23465595, 23828139, 23921128, 25014492, 25179842, 25511737, 26514586, 26928313, 27391584, 28472619, 28578348, 28875549, 28945461, 29036356, 29085012, 29221801, 29331341, 29338742, 29916535, 29928336, 29928340, 30034633, 30421643, 30957973, 31028612, 31068809, 31340754, 31477445, 31531018, 31582017, 31612014, 31615295		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	27022031		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	12610323, 18666712, 19085953, 19811087, 22173161, 22330637, 25014492, 25516666, 27391584, 29996772, 30304545, 30421643		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	17177978	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	19586676, 21917890, 24448807, 25177689, 25516666, 26785354, 27399683, 27815256, 34651657, 35916814, 40332363	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	24260493	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	17599732	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	23009036, 24260493		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	19586676, 20153491	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	19165171, 31962161, 36012696	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	25516666		★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	27284092, 37506138	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	28145460, 28197212, 29147012, 29852455, 31032922, 31077206		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	19171902, 26582088		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	20884065	Associate	★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	18586872, 21921986, 22831837, 23286385, 27892755, 30877182		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	16830219, 28599265, 29337590	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	29337590, 29547450, 29940963, 31718931		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	24613046	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	32164729	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17328955		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	19925653		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	24321786, 29788922, 35422093, 37311357, 37443143	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	32468028	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	18822317, 20810248, 26568960, 28530841		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	28530841	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17469140, 19843090, 22932793, 25485543, 28530841, 29061842	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21039738	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	40011954	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	18822317, 20810248, 26568960, 28530841		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	14651524, 17261530, 18822317, 20810248, 20833510, 20952467, 21039738, 22932793, 24243911, 25182168, 26386242, 26568960, 26762473, 27018624, 27652268, 29925508		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	20810248, 28530841, 29630120, 31806961		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	28530841, 31806961	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	18822317, 20810248, 26568960		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21990957, 22180778, 23949880, 25274031, 30066873	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22611320, 23338716, 28347236, 29968427	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	27713159, 28598999		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	38579915	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	19631641		★☆☆☆☆ Found in Text Mining only
Lysinuric Protein Intolerance	Lysinuric Protein Intolerance	BEFREE	26210182		★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	27296321		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	18172114, 31083239, 31795454	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	24786705, 28210837		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30180869		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	GWASCAT_DG	30718901		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	12591988, 15289356, 21854645, 30865385		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17979839, 19810822, 20618976, 21129170, 22560646, 22903472, 23510418, 23720768, 25299052, 25332681, 26063617, 26261595, 26392082, 27187369, 28212583, 28280355, 28296189, 28802057, 28927120, 28991224, 29435026, 29904116, 29932226, 30066873, 30317464, 30543015, 30930249, 31287789, 31535397		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	21609936, 27323819, 30292843, 31293986		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	20492496, 21283657		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	24337704, 29602239, 31571899		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17328955, 18763053, 26299699, 27545207, 28332554, 28484456, 29343453, 31218844, 31289487		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	19925653		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19826413		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	21616060		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20556833, 22487528, 24532253, 25290620, 27426724, 30246618, 30317640, 30664982, 31521276		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of penis	Penile cancer	BEFREE	28982864		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15087412, 15812078, 16357190, 17301271, 19267370, 19380025, 19496069, 19643479, 20200442, 21553150, 21563195, 22648782, 23179660, 23185615, 25360682, 25833062, 26782430, 29928275, 30098292, 31152147		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17301271		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	31020719		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17462092, 18755634, 18826495, 19191896, 19847953, 20721625, 21864388, 22468087, 22611320, 23565226, 23592020, 23824692, 24007538, 24030146, 24295404, 24365597, 24929142, 25084512, 25092897, 25290654, 26675260, 28347236, 29762851, 30242897, 30636642, 30863783, 31733580		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	16094077, 18825409, 23065466, 23142523, 23612802, 25472584, 25499923, 26634514, 29844686, 30711948, 31448424		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16525349, 16585214, 18763053, 19082487, 19496069, 19643479, 21081146, 21674704, 21842208, 21920464, 22322306, 22441122, 22468087, 22487528, 22560646, 22614440, 23010686, 23084080, 23170831, 23510418, 23691015, 23828139, 23949880, 24269697, 24376595, 24446182, 24977712, 25092897, 25175033, 25179302, 25511737, 25705893, 26081583, 26782430, 27426724, 28108356, 28242239, 28280355, 28296189, 28347875, 28472619, 28484456, 28668500, 28881826, 29187284, 29246004, 29437671, 29523762, 29602239, 29632721, 29661854, 29740218, 29845217, 29902933, 29928275, 29968427, 29968710, 30025492, 30104241, 30226786, 30311146, 30322956, 30365988, 30421643, 30472806, 30569516, 30679086, 30854106, 30906626, 30957973, 31020719, 31092437, 31646090		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19541348, 20177675, 26548749, 28009429, 28013346, 28653898, 29207048, 29556281, 31278284, 31796857		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21792899, 21920464, 23691015, 24390484, 24934366, 26760960, 26771524, 27837433, 28417458, 29122314, 29308184, 29696632, 30214578, 30472806, 31484704		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	26658898, 27637169, 29429793		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	27861595	Associate	★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26063617, 26261595, 28280355, 31287789		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	25790282		★☆☆☆☆ Found in Text Mining only
Mannose-Binding Protein Deficiency	Mannose-Binding Protein Deficiency	BEFREE	20079790		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	22915070		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	37445606	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	29909409		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	24997224	Associate	★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	26992684		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15922507, 22159452, 22552381, 23774118, 25175033, 29359608, 29486738, 30701576, 30922374, 31175545, 31253871, 31509504		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	17156435, 19001446, 21931695, 22552381, 25175033, 29359608, 29486738, 32312954, 36113897, 39266214	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	18031543, 19001446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	22842228		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	30414341		★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	28901374		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	18688857		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	24243911, 26415953, 29463000, 29561292, 29765402, 30847567, 31068207		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	30584014		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	31020719		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	23239997, 23275193, 26189548, 28785099, 31467416		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	23239997, 29673059, 37964189	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	22357188, 22991262	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	26930651, 32708841	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19922963, 21306745, 25329057, 25978344, 29019365, 29363671, 31151053		★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	39672520	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	23023380	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	HPO_DG			★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	16982657, 30639993		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	35832490	Associate	★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	28511117		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	18775079	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	12630564		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	33112414	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	28061462, 37773705	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30447136		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	LHGDN	16019531		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	16971956		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	20629663	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	21248470, 26564000, 30280787, 30824741, 36401285	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26564000, 30280787, 30824741		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	12622779, 15932772, 17967488, 18644848, 22028223, 22210239, 25957268, 27036414, 28251686, 28511117, 29146546, 29168181, 30043528, 30740110, 30804245, 30897575, 31036429, 31065973, 31509962		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	12622779, 15932772		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	19664140, 24975964, 25957268, 26996115, 27036414, 29168181, 33112414, 34418898, 35335126, 37849336	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30740110	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	28234259	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	25552658, 28821969		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	15972959	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	LHGDN	18543224		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	24036458, 24397961		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	37975358	Stimulate	★☆☆☆☆ Found in Text Mining only
Myasthenic Syndromes Congenital	Myasthenic syndrome	Pubtator	15972959	Associate	★☆☆☆☆ Found in Text Mining only
MYD88 Deficiency	MYD88 Deficiency	BEFREE	29622163, 30650348		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	17317824, 18084608, 20132814		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	18084608, 23403315, 34130612, 37852977	Associate	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	30733282		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	29946821		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	15302104, 15576653, 15864121, 16388712, 16516951, 16803999, 16954131, 17101559, 17493663, 18220812, 18549840, 18832728, 20237756, 24269693, 28888669, 29375116, 29524303, 29532872, 29960272, 30116385, 30399463, 30978539, 31280453, 31378910		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	15547160, 15883205, 16714144		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	15953129, 16388712, 17587646, 18282141, 18549840, 29375116, 29869943, 32594092, 33506919, 39261934	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	23121518	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	21126202, 21628510, 30536340, 30854968		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	26030867	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	12589705, 27228349, 28370906, 29940584, 30586589, 31636246		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	28370906	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	22582345, 28911136		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	32164729	Stimulate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	25365350	Stimulate	★☆☆☆☆ Found in Text Mining only
Myositis Ossificans	Myositis	Pubtator	34954853	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	34830017, 37876569	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	17602875, 23957339, 29285053, 29921378		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	25973005	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16969132, 22320262		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	16969132, 22320262, 33767586, 38567476	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	23338716	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	16385250, 19109197, 19786028, 20976181, 22796522, 23455503, 23776545, 24519940, 27849634, 28846670		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrotizing Enterocolitis	Necrotizing Enterocolitis	LHGDN	17878380, 19109197		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrotizing Enterocolitis	Necrotizing Enterocolitis	CTD_human_DG	23650378		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	16385250, 19109197, 19786028, 20007974, 20580721, 20976181, 22796522, 22902431, 23455503, 23776545, 24519940, 25521917, 26690704, 26845626, 27191060, 27849634, 28056921, 28450472, 28846670, 29131241, 29281615, 29360809, 29680746, 29980346, 30148762, 30541786, 30771815		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12591988, 16531815, 17979839, 18519658, 18608206, 18996347, 19082487, 19318560, 19496069, 19811770, 19826413, 19925653, 20083228, 20164024, 20177675, 20556833, 20826579, 21129170, 21169414, 21527067, 21616060, 21674704, 22042369, 22088941, 22115967, 22123294, 22159452, 22180778, 22240197, 22468087, 22470535, 22487528, 22552381, 22648782, 23194516, 23300844, 23318418, 23691015, 23720768, 23921128, 24390484, 24878539, 24889928, 24977712, 25092897, 25217977, 25633197, 25833062, 25936433, 26063617, 26165843, 26167073, 26276725, 26514586, 26548749, 26582088, 27061118, 27177773, 27460076, 27876571, 28013346, 28088520, 28303957, 28332554, 28347875, 28484456, 28521455, 28531216, 28578348, 28811960, 28927120, 28982115, 28982864, 29029545, 29270668, 29338742, 29500244, 29523762, 29637002, 29928336, 29928340, 29968427, 30034633, 30111860, 30145468, 30311146, 30680070, 30843319, 30854106, 31081044, 31175545, 31200766, 31218844, 31324798, 31329159, 31477571, 31646090, 31721657		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	27818460, 28849172		★☆☆☆☆ Found in Text Mining only
Nephrocalcinosis	Nephrocalcinosis	BEFREE	31735555		★☆☆☆☆ Found in Text Mining only
Nephrogenic Fibrosing Dermopathy	Nephrogenic Fibrosing Dermopathy	BEFREE	22649203		★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	27355219	Associate	★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	24786705	Stimulate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	28485782		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	28210837		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	24803744, 32967147	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28235660		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	17156435	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28958207		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	24975964, 30584014	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26142666, 29221855, 29486776, 30018656, 30550933, 30804245, 30928412, 31134076, 31580163		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	31229737		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	21628510, 27902567, 29656686, 30365084		★☆☆☆☆ Found in Text Mining only
Neuropsychiatric Systemic Lupus Erythematosus	Neuropsychiatric Systemic Lupus Erythematosus	BEFREE	24243911		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	21403649		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	20888880, 24968337		★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	26992684		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Diseases	Sphingomyelinase deficiency	LHGDN	17314284		★☆☆☆☆ Found in Text Mining only
Nocturia	Nocturia	BEFREE	27243216		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	19165171, 24443993, 26212089, 27895422, 28349964, 28481357, 28551086, 28604704, 29077272, 29269727, 29319180, 29666152, 29673059, 30015859, 30034633, 30221732, 31004566, 31388096, 31388695		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24889928, 28484456, 30854106, 31382038, 31432177		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	28346354		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	24997224, 25989356, 29335857, 30737662, 31101239, 31574193		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17053832, 18633101, 19922963, 20339530, 20824098, 21125016, 23958744, 24794440, 24929539, 25840582, 26498675, 27714571, 27812198, 28154178, 28323977, 28933050, 29264745, 29365334, 29428931, 29453396, 29632147, 29636416, 29667734, 29914624, 30034633, 30113718, 30396359, 30510205, 30590569, 30845245, 30848861, 30856467, 30922122, 31151053, 31507457, 31574193, 31598849, 31726089		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	17381056, 19564704, 20846165, 20930711, 21125016, 21461352, 21952248, 23188427, 24929539, 26113297, 27481183, 29410345, 29802748, 31825075, 32615574, 32708841, 32954825, 34657898, 37403139, 37571378, 37964189, 39464190	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	18633101, 27535280, 28320058, 30287405	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	31936430	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	37571378	Associate	★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	28346614, 31737079		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	30246618	Associate	★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic neuritis	Pubtator	36969199	Associate	★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	26709642		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	18584044, 23776688, 23776697, 28093922, 32095874, 32410875, 33174011, 34643941, 35993243, 36108390	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Knee	Osteoarthritis	Pubtator	28093922, 36216277	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	27614315, 30663793, 30912672, 30953645, 31345099		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	16487238		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	16487238, 37459905	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	17381056, 33867845, 38367924	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30989725		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	25931355		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30240881, 31587886		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34588497	Associate	★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	LHGDN	17908769		★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	19586996, 22494793, 26177520		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	19452306		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	33370338, 40462131	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	29314441		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19826413		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	21616060		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19826413, 22528050, 27059733, 27118139, 29502561, 30610800, 31655274, 32878513, 33370338, 36231099, 38103365	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20556833, 22487528, 24532253, 25290620, 27426724, 30246618, 30317640, 30457560, 30664982, 31521276		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	20556833, 28088520, 30664982		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27941651, 30246618, 30457560, 33939664, 34502140, 36232715	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	17124436, 22908323, 29157809, 30272284		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	17414051, 18288881		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	39221252	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	30115563, 30979838		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29523762, 30089122		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	32066304	Associate	★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	17652449, 22322306, 23455702		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	25522431, 25908385, 26440368, 28108849, 29077524, 29589201, 29670828, 30225556, 30328509, 30550933, 30554160, 30594449, 30804245, 31388087		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	29670828, 32006615	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	33272323, 37408202	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35026420	Inhibit	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	26490558		★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	21412229		★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	31465768		★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	22238472	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	17309748, 26161647, 26853914, 27993530, 29135054, 29755012		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	26161647, 34420402	Associate	★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	24461398, 30806798		★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	14738464, 19118102, 20546116	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	17309585, 19118102, 19426173, 23879541, 26386242, 27224005, 28630066		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	14738464, 18328075, 19118102, 22661708, 23981212, 26581717, 27411657, 31196168, 31281226, 34174589, 38270303, 39266981	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	15341923, 16246938, 17309585, 17956467, 18454672, 18618036, 19046305, 19811440, 20528699, 22355820, 22661708, 23653009, 23879541, 23981212, 24620831, 26174031, 26771980, 27107801, 27308827, 27492306, 27603404, 29274168, 30192824, 30351354, 30417696, 30517775, 30571680, 31196168, 31361069, 31452696, 31769563, 31772831, 31831723		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	LHGDN	17956467		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	38007427	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	16890863, 24472415	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	16890863, 24472415		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	27981790	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	31191027		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	16890863		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	27432741		★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	30610800	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	15796767		★☆☆☆☆ Found in Text Mining only
Platelet Glycoprotein IV Deficiency	Platelet Glycoprotein IV Deficiency	BEFREE	30738832		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	26498675, 30590569		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34279173, 36221354	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	29946821		★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	17261530, 21901230, 22964479, 24180619, 25047402, 31654747		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	19953283, 25365350, 28446897		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	19953283	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	25365350	Stimulate	★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	28089357		★☆☆☆☆ Found in Text Mining only
Porphyria Variegate	Variegate porphyria	Pubtator	33255933	Stimulate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28159589		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	27277333		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30071285		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	16006099, 16629651, 17448566, 20940109, 23142582, 31115023		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	28341816	Stimulate	★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	30733282		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	17100974, 17408653		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15087412, 15812078, 16357190, 17301271, 19267370, 19380025, 19496069, 19643479, 20200442, 21553150, 21563195, 22648782, 23179660, 23185615, 25360682, 25833062, 26782430, 29928275, 30098292, 31152147		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	27243216		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	27243216	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16357190, 18649875		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17301271		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19267370, 20978888, 21563195, 23179660, 30098292, 36165000, 36257875, 38583012	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	38376283	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
prostatitis	Prostatitis	BEFREE	31376214, 31385476		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	19891659, 31489594	Associate	★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	37681909	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	16006099, 23874444		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	20631729, 22555189, 23457721, 26830904, 28713916		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	26830904, 33416099	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	27155792		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	28359064, 32712618	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16004610, 18034897	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16219455, 21439805, 21483784, 22070100, 22952638, 23170858, 26498252, 27442627, 28025440, 28260877, 28536249, 28537664, 29535517, 31640653, 33244226	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22438960, 23374856, 23514217, 30133616, 33590951	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	22983353, 24205107, 30790400		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26782380, 27694932, 27815256, 29025711, 29997297, 30160595, 30847938, 31600583		★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	BEFREE	21442393, 22308961, 30519266		★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	20714796		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	21792899, 24446182		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	25482673		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Recurrent cystitis	Cystitis	BEFREE	19543401		★☆☆☆☆ Found in Text Mining only
Recurrent otitis media	Otitis media	BEFREE	23929584		★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	17914947		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29637002		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	24523386, 27585667, 30958891, 30959575, 31696221		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	CTD_human_DG	27585667		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	27602552, 30099700		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	29025711		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	25085625, 28154251, 29337590, 29545858, 31219247, 31261506		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	30511622		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	27615723		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	29486764	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	30475644		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	40495488	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	40084286	Associate	★☆☆☆☆ Found in Text Mining only
RETINOSCHISIS 1, X-LINKED, JUVENILE	Retinoschisis, X-Linked	BEFREE	28827130		★☆☆☆☆ Found in Text Mining only
Retrobulbar Neuritis	Retrobulbar Neuritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	17096074		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12846053, 14651524, 16319097, 16606645, 16709864, 17289161, 17599732, 17927684, 18060042, 18180278, 18381796, 18452992, 18584044, 19134200, 19342676, 19734236, 20112284, 20306049, 21474483, 21654189, 21798884, 22011399, 22037282, 22360682, 22523426, 22717291, 22749779, 23072581, 23129427, 23325096, 23420357, 23861949, 23982886, 24286242, 24553677, 24708416, 25499175, 25515751, 25573402, 26082436, 26996117, 27108590, 27271273, 27574922, 27797749, 27988432, 28424490, 29096690, 29315763, 29442025, 30132861, 30254017, 30412715, 30417696, 30767875, 31283217, 31521702, 31620132, 31785408		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12846053, 15022344, 19035519		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	27287257		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	16146574	Associate	★☆☆☆☆ Found in Text Mining only
Richieri Costa Pereira syndrome	Richieri Costa Pereira Syndrome	BEFREE	30954593		★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	24637196		★☆☆☆☆ Found in Text Mining only
Rigid spine syndrome	Rigid spine muscular dystrophy	Pubtator	24997224	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	16487240, 16879239, 16933467, 18422738, 19839752, 20011079		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	16487240, 16879239, 18422738, 20851927	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	LHGDN	16933467		★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	24846769, 32226296	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	23587629, 27070349, 28646138, 28803924, 29137928, 30429077, 30682559, 31837816		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	23587629		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	30630651	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	35027554, 37511534, 38102721	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	23141927, 27815256, 29997297		★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	33809015	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	27815256, 31545397, 33168071	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	24114613		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	23706953, 27124018	Associate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	22118570		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	12796470, 17210974, 19131814, 21466684, 23825193, 24950711, 25412934, 27615723, 27861595, 32513051, 32989935, 33247673, 34689707, 34733114, 35345353, 36135817, 36344490	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	11805536, 12404174, 12411588, 12807489, 15086396, 15489631, 15520404, 16528020, 17989521, 18034244, 19131814, 19181857, 20026833, 20228685, 20375592, 20451670, 20525286, 21245135, 21358639, 21968286, 22427642, 22537674, 23871732, 24084649, 24747744, 24878008, 24950711, 25394369, 25404738, 25412934, 25427560, 25454804, 25497086, 25515751, 26052716, 26312770, 27569563, 27697835, 27899278, 27958344, 27974412, 27986454, 28000867, 28056977, 28145460, 28189063, 28248925, 28248930, 28407632, 28796387, 28800541, 28858767, 28957360, 28976923, 29061850, 29149705, 29176403, 29285127, 29343440, 29506272, 29545858, 29653689, 29736208, 29741098, 29749463, 29780528, 29997623, 30276970, 30365067, 30445996, 30506107, 30512209, 30645013, 30671932, 30691865, 30885307, 30910647, 30915370, 30940475, 30957795, 31210339, 31314904, 31351116, 31412243, 31430762, 31520992, 31545263, 31646090, 31704704, 31794773		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	CTD_human_DG	20624996		★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	17956467		★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	29864926		★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	30337931		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	34149728	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	29437671, 29661854, 31020719		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	28530841, 28713916	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	17229603, 28530841, 29728859		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	39684439	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	32028672, 36479843	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	32076951	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	23239459, 29215742, 30293084, 31678553		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	25373853	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	26979829	Associate	★☆☆☆☆ Found in Text Mining only
Spastic cerebral palsy	Spastic Cerebral Palsy	BEFREE	27079612		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	16277694, 25506924, 38019769	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	17459079, 20952467	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20177675, 21854645, 22123294, 22583829, 26709642, 28484456, 28982115		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21990957, 27061118		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19318560, 21854645, 22583829, 24518707, 26709642, 27191981, 34158059	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35310196	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35327577	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	31081044		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19318560, 22123294, 24737049		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	15883205, 17045300, 18373609, 19556696, 25179298, 28344199, 28407320		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	CTD_human_DG	20981132		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	23523633		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	18641190, 27022031		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	18713975, 19165171, 23075869, 23816536, 24349054, 28351520, 28632732, 29884546, 30034633, 30174308, 31264285, 31788011		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17324405, 17462092, 18755634, 18826495, 19191896, 19847953, 20721625, 21864388, 22468087, 22611320, 23565226, 23592020, 23776537, 23824692, 24007538, 24030146, 24295404, 24365597, 24929142, 25084512, 25092897, 25290654, 26675260, 28347236, 29762851, 30242897, 30636642, 30863783, 31733580		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	21455638, 22354030, 25873761, 26161647, 30301709, 32719215	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	23455381, 24508388		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17462092, 18826495, 19189651, 22468087, 22611320, 23776537, 24030146, 24446182, 24929539, 26675260, 28275299, 28347236, 29670922, 29762851, 30292233, 30301709, 34376808, 34773930, 36008864, 36632455, 39384957	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	39343890	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	21206505, 21236709, 30760287	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	27738873, 28400792, 29546590, 29554978, 29855971, 29981464, 30048156, 30572907, 30980845, 31468571, 31801411, 31803007		★☆☆☆☆ Found in Text Mining only
Subcutaneous hemorrhage	Subcutaneous hemorrhage	BEFREE	28536433		★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	20011698		★☆☆☆☆ Found in Text Mining only
Symmetric Diabetic Proximal Motor Neuropathy	Symmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	14693986		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	17289161		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	33377396	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	19035500, 19255934, 23141927, 27256716, 27815256, 28964818, 29997297, 30234721, 31465768, 31545397		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	19035500		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	30594066		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	27605009		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	23300844	Associate	★☆☆☆☆ Found in Text Mining only
THANATOPHORIC DYSPLASIA, TYPE I (disorder)	Thanatophoric Dysplasia	BEFREE	30134638		★☆☆☆☆ Found in Text Mining only
Thin basement membrane disease	Thin Basement Membrane Disease	BEFREE	27818460		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	32425934	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	28415571		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	29383704	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	21050493		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	37990304	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	29656212		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29523762		★☆☆☆☆ Found in Text Mining only
Tonsillitis	Tonsillitis	Pubtator	21159925	Associate	★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	29113143		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	29113143		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	39819723	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	35789992	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	15194649, 15207785, 15655821, 16010583, 16085746, 16840031, 17538633, 17850411, 17927684, 18174680, 18680223, 18972554, 19275920, 20093834, 21221801, 21674704, 22185629, 22192785, 22918682, 23239925, 23470644, 23971939, 24776844, 24971461, 25492126, 26023918, 26316104, 26462859, 27079612, 27107867, 27895399, 27995407, 28408791, 29055077, 29404307, 30477744, 30517639, 30915760, 31173225, 31378906, 31452237		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	LHGDN	15655821, 15905704		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	22180778		★☆☆☆☆ Found in Text Mining only
Ureteral Obstruction	Urethral obstruction	Pubtator	23690937	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18825409, 23065466, 25472584, 26634514, 38554019	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24606459	Inhibit	★☆☆☆☆ Found in Text Mining only
Urinary Tract Infections	Urinary tract infection	Pubtator	27252945	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	20177675	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	21527067	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	20177675, 26548749, 28402258, 28626766, 28653898, 29207048, 31278284, 37400149, 39208235	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31278284	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervicitis	Uterine Cervicitis	BEFREE	31365550		★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine Diseases	LHGDN	18775079		★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	18775079	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	20011079, 26195555, 30510488		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	26238371		★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	15194649, 30365067, 30791839, 31162673, 31620122		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	30474123		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	21325271	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	29227975	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	15746698		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	31782253, 32954825	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	25120286, 30133616	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	28858846, 36717098	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	LHGDN	19150884		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	21915309, 24773611, 29923769	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	23065292, 29923769		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	26437797	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	23690937	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	30978539, 31353205		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	26030867, 33046755	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	37964189	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	22429552		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	22429552		★☆☆☆☆ Found in Text Mining only
von Willebrand Disease Type 2	Von willebrand disorder	Pubtator	25365350	Stimulate	★☆☆☆☆ Found in Text Mining only
X-linked agammaglobulinemia	Agammaglobulinemia, X-Linked	BEFREE	20634142, 30698158		★☆☆☆☆ Found in Text Mining only