Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	1212
Gene name	Clathrin light chain B
Gene symbol	CLTB
Synonyms (NCBI Gene)	LCB
Chromosome	5
Chromosome location	5q35.2
Summary	Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytos

71 Show/Hide all (71)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025306	hsa-miR-34a-5p	Proteomics	21566225
MIRT495214	hsa-miR-330-3p	PAR-CLIP	23708386
MIRT495213	hsa-miR-329-3p	PAR-CLIP	23708386
MIRT495212	hsa-miR-362-3p	PAR-CLIP	23708386
MIRT495211	hsa-miR-4503	PAR-CLIP	23708386
MIRT495214	hsa-miR-330-3p	PAR-CLIP	23708386
MIRT495213	hsa-miR-329-3p	PAR-CLIP	23708386
MIRT495212	hsa-miR-362-3p	PAR-CLIP	23708386
MIRT495211	hsa-miR-4503	PAR-CLIP	23708386
MIRT898053	hsa-miR-1254	CLIP-seq
MIRT898054	hsa-miR-1270	CLIP-seq
MIRT898055	hsa-miR-1273f	CLIP-seq
MIRT898056	hsa-miR-296-5p	CLIP-seq
MIRT898057	hsa-miR-3116	CLIP-seq
MIRT898058	hsa-miR-3150a-3p	CLIP-seq
MIRT898059	hsa-miR-3175	CLIP-seq
MIRT898060	hsa-miR-342-5p	CLIP-seq
MIRT898061	hsa-miR-3616-3p	CLIP-seq
MIRT898062	hsa-miR-4254	CLIP-seq
MIRT898063	hsa-miR-4419a	CLIP-seq
MIRT898064	hsa-miR-4459	CLIP-seq
MIRT898065	hsa-miR-4510	CLIP-seq
MIRT898066	hsa-miR-4651	CLIP-seq
MIRT898067	hsa-miR-4664-5p	CLIP-seq
MIRT898068	hsa-miR-4683	CLIP-seq
MIRT898069	hsa-miR-4710	CLIP-seq
MIRT898070	hsa-miR-4721	CLIP-seq
MIRT898071	hsa-miR-4738-5p	CLIP-seq
MIRT898072	hsa-miR-4779	CLIP-seq
MIRT898073	hsa-miR-608	CLIP-seq
MIRT898074	hsa-miR-620	CLIP-seq
MIRT898075	hsa-miR-765	CLIP-seq
MIRT898076	hsa-miR-939	CLIP-seq
MIRT898064	hsa-miR-4459	CLIP-seq
MIRT898064	hsa-miR-4459	CLIP-seq
MIRT898053	hsa-miR-1254	CLIP-seq
MIRT898054	hsa-miR-1270	CLIP-seq
MIRT2505093	hsa-miR-151-3p	CLIP-seq
MIRT898056	hsa-miR-296-5p	CLIP-seq
MIRT898057	hsa-miR-3116	CLIP-seq
MIRT2505094	hsa-miR-3184	CLIP-seq
MIRT898060	hsa-miR-342-5p	CLIP-seq
MIRT898061	hsa-miR-3616-3p	CLIP-seq
MIRT2505095	hsa-miR-3619-3p	CLIP-seq
MIRT2505096	hsa-miR-3652	CLIP-seq
MIRT2505097	hsa-miR-411	CLIP-seq
MIRT2505098	hsa-miR-423-5p	CLIP-seq
MIRT898062	hsa-miR-4254	CLIP-seq
MIRT898063	hsa-miR-4419a	CLIP-seq
MIRT2505099	hsa-miR-4430	CLIP-seq
MIRT898064	hsa-miR-4459	CLIP-seq
MIRT2505100	hsa-miR-4463	CLIP-seq
MIRT2505101	hsa-miR-4492	CLIP-seq
MIRT2505102	hsa-miR-4498	CLIP-seq
MIRT2505103	hsa-miR-4499	CLIP-seq
MIRT898065	hsa-miR-4510	CLIP-seq
MIRT2505104	hsa-miR-4640-5p	CLIP-seq
MIRT898066	hsa-miR-4651	CLIP-seq
MIRT898067	hsa-miR-4664-5p	CLIP-seq
MIRT898068	hsa-miR-4683	CLIP-seq
MIRT2505105	hsa-miR-4695-5p	CLIP-seq
MIRT898069	hsa-miR-4710	CLIP-seq
MIRT898070	hsa-miR-4721	CLIP-seq
MIRT2505106	hsa-miR-4726-5p	CLIP-seq
MIRT898071	hsa-miR-4738-5p	CLIP-seq
MIRT2505107	hsa-miR-4776-5p	CLIP-seq
MIRT898072	hsa-miR-4779	CLIP-seq
MIRT898073	hsa-miR-608	CLIP-seq
MIRT898074	hsa-miR-620	CLIP-seq
MIRT2505108	hsa-miR-665	CLIP-seq
MIRT2505109	hsa-miR-762	CLIP-seq

29 Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005198	Function	Structural molecule activity	IEA
GO:0005515	Function	Protein binding	IPI	11889126
GO:0005802	Component	Trans-Golgi network	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0030118	Component	Clathrin coat	IEA
GO:0030118	Component	Clathrin coat	ISS
GO:0030118	Component	Clathrin coat	NAS	3267234
GO:0030125	Component	Clathrin vesicle coat	IBA
GO:0030130	Component	Clathrin coat of trans-Golgi network vesicle	IEA
GO:0030132	Component	Clathrin coat of coated pit	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	IBA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032050	Function	Clathrin heavy chain binding	IBA
GO:0042277	Function	Peptide binding	IEA
GO:0045334	Component	Clathrin-coated endocytic vesicle	NAS	25898166
GO:0048488	Process	Synaptic vesicle endocytosis	IEA
GO:0060170	Component	Ciliary membrane	IEA
GO:0072583	Process	Clathrin-dependent endocytosis	IBA
GO:0098835	Component	Presynaptic endocytic zone membrane	IEA

MIM	HGNC	e!Ensembl
118970	2091	ENSG00000175416

P09497

Protein name

Clathrin light chain B (Lcb)

Protein function

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01086	Clathrin_lg_ch	1 → 228	Clathrin light chain	Family

Sequence

MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPT
SGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFV
KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR

Sequence length

229

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Lysosome	Gap junction degradation
Endocytosis	Formation of annular gap junctions
Synaptic vesicle cycle	EPH-ephrin mediated repulsion of cells
Endocrine and other factor-regulated calcium reabsorption	Lysosome Vesicle Biogenesis
Huntington disease	WNT5A-dependent internalization of FZD4
Bacterial invasion of epithelial cells	WNT5A-dependent internalization of FZD2, FZD5 and ROR2
	Cargo recognition for clathrin-mediated endocytosis
	Clathrin-mediated endocytosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LUNG NEOPLASMS	—	CTD	27935865	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (9)
Alzheimer Disease	Alzheimer disease	Pubtator	40021385	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32322884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	27935865		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	27935865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29928144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19034380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29928144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	BEFREE	28456713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation, Paroxysmal Familial, 1	Ventricular Fibrillation	BEFREE	28456713		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
CLTCL1	[]	10	["Lysosome","Endocytosis","Synaptic vesicle cycle","Endocrine and other factor-regulated calcium reabsorption","Bacterial invasion of epithelial cells","Clathrin-mediated endocytosis","Cargo recognition for clathrin-mediated endocytosis","EPH-ephrin mediated repulsion of cells","Gap junction degradation","Formation of annular gap junctions"]	[]
CLTA	[]	13	["Lysosome","Endocytosis","Synaptic vesicle cycle","Endocrine and other factor-regulated calcium reabsorption","Bacterial invasion of epithelial cells","Lysosome Vesicle Biogenesis","Clathrin-mediated endocytosis","Cargo recognition for clathrin-mediated endocytosis","EPH-ephrin mediated repulsion of cells","Gap junction degradation","Formation of annular gap junctions","WNT5A-dependent internalization of FZD4"]	[]
CLTC	[]	13	["Lysosome","Endocytosis","Synaptic vesicle cycle","Endocrine and other factor-regulated calcium reabsorption","Bacterial invasion of epithelial cells","Lysosome Vesicle Biogenesis","Clathrin-mediated endocytosis","Cargo recognition for clathrin-mediated endocytosis","EPH-ephrin mediated repulsion of cells","Gap junction degradation","Formation of annular gap junctions","WNT5A-dependent internalization of FZD4"]	[]
DNM1	[]	8	["Endocytosis","Synaptic vesicle cycle","Endocrine and other factor-regulated calcium reabsorption","Bacterial invasion of epithelial cells","Clathrin-mediated endocytosis","EPH-ephrin mediated repulsion of cells","Gap junction degradation","Formation of annular gap junctions"]	[]
AP2M1	[]	10	["Endocytosis","Synaptic vesicle cycle","Endocrine and other factor-regulated calcium reabsorption","Clathrin-mediated endocytosis","Cargo recognition for clathrin-mediated endocytosis","EPH-ephrin mediated repulsion of cells","Gap junction degradation","Formation of annular gap junctions","WNT5A-dependent internalization of FZD4","WNT5A-dependent internalization of FZD2, FZD5 and ROR2"]	[]

CLTB (clathrin light chain B)

Bookmark This Gene