CLNK (cytokine dependent hematopoietic cell linker)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 116449
• Gene name: Cytokine dependent hematopoietic cell linker
• Gene symbol: CLNK
• Synonyms (NCBI Gene): MIST
• Chromosome: 4
• Chromosome location: 4p16.1
• Summary: MIST is a member of the SLP76 family of adaptors (see LCP2, MIM 601603; BLNK, MIM 604515). MIST plays a role in the regulation of immunoreceptor signaling, including PLC-gamma (PLCG1; MIM 172420)-mediated B cell antigen receptor (BCR) signaling and FC-eps

miRNA Show/Hide all (131)

miRTarBase ID	miRNA	Experiments	Reference
MIRT650701	hsa-miR-548ac	HITS-CLIP	23824327
MIRT650700	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT650699	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT650698	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT650697	hsa-miR-548z	HITS-CLIP	23824327
MIRT650696	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT650695	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT650694	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT650693	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT650692	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT650691	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT650690	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT650689	hsa-miR-8485	HITS-CLIP	23824327
MIRT650688	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT621391	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT621390	hsa-miR-4469	HITS-CLIP	23824327
MIRT621389	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621388	hsa-miR-4287	HITS-CLIP	23824327
MIRT621387	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT621386	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT621385	hsa-miR-3182	HITS-CLIP	23824327
MIRT621384	hsa-miR-3682-5p	HITS-CLIP	23824327
MIRT621383	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT621382	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT621381	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT621380	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT621379	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT621378	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT621377	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621376	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621375	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT650701	hsa-miR-548ac	HITS-CLIP	23824327
MIRT650700	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT650699	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT650698	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT650697	hsa-miR-548z	HITS-CLIP	23824327
MIRT650696	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT650695	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT650694	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT650693	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT650692	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT650691	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT650690	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT650689	hsa-miR-8485	HITS-CLIP	23824327
MIRT650688	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT621391	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT621390	hsa-miR-4469	HITS-CLIP	23824327
MIRT621389	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621388	hsa-miR-4287	HITS-CLIP	23824327
MIRT621387	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT621386	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT621385	hsa-miR-3182	HITS-CLIP	23824327
MIRT621384	hsa-miR-3682-5p	HITS-CLIP	23824327
MIRT621383	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT621382	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT621381	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT621380	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT621379	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT621378	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT621377	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621376	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621375	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT650701	hsa-miR-548ac	HITS-CLIP	23824327
MIRT650700	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT650699	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT650698	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT650697	hsa-miR-548z	HITS-CLIP	23824327
MIRT650696	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT650695	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT650694	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT650693	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT650692	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT650691	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT650690	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT650689	hsa-miR-8485	HITS-CLIP	23824327
MIRT650688	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT621391	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT621390	hsa-miR-4469	HITS-CLIP	23824327
MIRT621389	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621388	hsa-miR-4287	HITS-CLIP	23824327
MIRT621387	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT621386	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT621385	hsa-miR-3182	HITS-CLIP	23824327
MIRT621384	hsa-miR-3682-5p	HITS-CLIP	23824327
MIRT621383	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT621382	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT621381	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT621380	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT621379	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT621378	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT621377	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621376	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621375	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT650701	hsa-miR-548ac	HITS-CLIP	23824327
MIRT650700	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT650699	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT650698	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT650697	hsa-miR-548z	HITS-CLIP	23824327
MIRT650696	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT650695	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT650694	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT650693	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT650692	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT650691	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT650690	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT650689	hsa-miR-8485	HITS-CLIP	23824327
MIRT650688	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT621391	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT621390	hsa-miR-4469	HITS-CLIP	23824327
MIRT621389	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT621388	hsa-miR-4287	HITS-CLIP	23824327
MIRT621387	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT621386	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT621385	hsa-miR-3182	HITS-CLIP	23824327
MIRT621384	hsa-miR-3682-5p	HITS-CLIP	23824327
MIRT621383	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT621382	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT621381	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT621380	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT621379	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT621378	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT621377	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621376	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621375	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT897501	hsa-miR-124	CLIP-seq
MIRT897502	hsa-miR-4493	CLIP-seq
MIRT897503	hsa-miR-4635	CLIP-seq
MIRT897504	hsa-miR-506	CLIP-seq
MIRT2447208	hsa-miR-518e	CLIP-seq
MIRT2447209	hsa-miR-570	CLIP-seq
MIRT2447210	hsa-miR-671-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002729	Process	Positive regulation of natural killer cell cytokine production	IEA
GO:0005515	Function	Protein binding	IPI	16273093, 26009488
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	26009488
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0032815	Process	Negative regulation of natural killer cell activation	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042629	Component	Mast cell granule	IEA
GO:0043303	Process	Mast cell degranulation	IEA
GO:0044877	Function	Protein-containing complex binding	IEA

Other IDs

• MIM: 611434
• HGNC: 17438
• e!Ensembl: ENSG00000109684

Protein

• UniProt ID: Q7Z7G1
• Protein name: Cytokine-dependent hematopoietic cell linker (Mast cell immunoreceptor signal transducer)
• Protein function: An adapter protein which plays a role in the regulation of immunoreceptor signaling, including PLC-gamma-mediated B-cell antigen receptor (BCR) signaling and FC-epsilon R1-mediated mast cell degranulation (By similarity). Together with FGR, it a
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00017	SH2	309 → 392	SH2 domain	Domain

• Sequence:

  MNRQGNRKTTKEGSNDLKFQNFSLPKNRSWPRINSATGQYQRMNKPLLDWERNFAAVLDG
  AKGHSDDDYDDPELRMEETWQSIKILPARPIKESEYADTHYFKVAMDTPLPLDTRTSISI
  GQPTWNTQTRLERVDKPISKDVRSQNIKGDASVRKNKIPLPPPRPLITLPKKYQPLPPEP
  ESSRPPLSQRHTFPEVQRMPSQISLRDLSEVLEAEKVPHNQRKPESTHLLENQNTQEIPL
  AISSSSFTTSNHSVQNRDHRGGMQPCSPQRCQPPASCSPHENILPYKYTSWRPPFPKRSD
  RKDVQHNEWYIGEYSRQAVEEAFMKENKDGSFLVRDCSTKSKEEPYVLAVFYENKVYNVK
  IRFLERNQQFALGTGLRGDEKFDSVEDIIEHYKNFPIILIDGKDKTGVHRKQCHLTQPLP
  LTRHLLPL

• Sequence length: 428

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (15)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	32581359, 37002690	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLNK-related disorder	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ULCER	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	31578528, 33356394, 33462484, 33832965, 40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERURICEMIA	—	GWAS catalog	35758599, 40835619	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	30595370, 39024449, 39789286	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC OSTEONECROSIS OF THE FEMORAL HEAD	—	GWAS catalog	32701715	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	38469033	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	36333501	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	27992413	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	28714469	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	28222112	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	CTD, Disgenet CTD, Disgenet	22561518	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (8)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	20884846, 23263486		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	21756847		★☆☆☆☆ Found in Text Mining only
Foramen Ovale, Patent	Patent foramen ovale	BEFREE	28283958		★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	20884846, 23263486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	BEFREE	21756847		★☆☆☆☆ Found in Text Mining only
Ostium secundum atrial septal defect	Secundum atrial septal defect	BEFREE	28283958		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	24776764		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	CTD_human_DG	22561518		★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SAMD5 4 shared diseasesAutoimmune thyroid disease, Esophageal disease, Esophageal ulcer, Thyroid disease 4 shared evidence sourcesGWAS catalog (Autoimmune thyroid disease), GWAS catalog (Esophageal disease), GWAS catalog (Esophageal ulcer), GWAS catalog (Thyroid disease) Related via 4 shared diseases including Autoimmune thyroid disease, Esophageal disease — evidence mostly GWAS catalog. ASIC2 3 shared diseasesEsophageal disease, Esophageal ulcer, Psychiatric disorders 3 shared evidence sourcesGWAS catalog (Esophageal disease), GWAS catalog (Esophageal ulcer), GWAS catalog (Psychiatric disorders) Related via 3 shared diseases including Esophageal disease, Esophageal ulcer — evidence mostly GWAS catalog. C1QTNF6 3 shared diseasesAutoimmune thyroid disease, Thyroid disease, Vitiligo 2 shared evidence sourcesGWAS catalog (Autoimmune thyroid disease), GWAS catalog (Thyroid disease) Related via 3 shared diseases including Autoimmune thyroid disease, Thyroid disease — evidence mostly GWAS catalog. ANKRD45 2 shared diseasesOsteonecrosis of the femoral head, Psychiatric disorders 2 shared evidence sourcesGWAS catalog (Osteonecrosis of the femoral head), GWAS catalog (Psychiatric disorders) Related via 2 shared diseases including Osteonecrosis of the femoral head, Psychiatric disorders — evidence mostly GWAS catalog. ZNF518B 2 shared diseasesOsteonecrosis of the femoral head, Hyperuricemia 2 shared evidence sourcesGWAS catalog (Hyperuricemia), GWAS catalog (Osteonecrosis of the femoral head) Related via 2 shared diseases including Osteonecrosis of the femoral head, Hyperuricemia — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SAMD5	4	["Autoimmune thyroid disease","Esophageal disease","Esophageal ulcer","Thyroid disease"]	0	[]	4	["GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Esophageal disease)","GWAS catalog (Esophageal ulcer)","GWAS catalog (Thyroid disease)"]
ASIC2	3	["Esophageal disease","Esophageal ulcer","Psychiatric disorders"]	0	[]	3	["GWAS catalog (Esophageal disease)","GWAS catalog (Esophageal ulcer)","GWAS catalog (Psychiatric disorders)"]
C1QTNF6	3	["Autoimmune thyroid disease","Thyroid disease","Vitiligo"]	0	[]	2	["GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Thyroid disease)"]
ANKRD45	2	["Osteonecrosis of the femoral head","Psychiatric disorders"]	0	[]	2	["GWAS catalog (Osteonecrosis of the femoral head)","GWAS catalog (Psychiatric disorders)"]
ZNF518B	2	["Osteonecrosis of the femoral head","Hyperuricemia"]	0	[]	2	["GWAS catalog (Hyperuricemia)","GWAS catalog (Osteonecrosis of the femoral head)"]

Diseases Linked via Similar Genes

Autoimmune disease Linked via 2 of 5 related genesSAMD5, C1QTNF6 Lung cancer Linked via 2 of 5 related genesSAMD5, ASIC2 Major depressive disorder Linked via 2 of 5 related genesSAMD5, ASIC2 Obesity Linked via 2 of 5 related genesSAMD5, ASIC2 Osteoarthritis Linked via 2 of 5 related genesSAMD5, ASIC2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Autoimmune disease	2	["SAMD5","C1QTNF6"]
Lung cancer	2	["SAMD5","ASIC2"]
Major depressive disorder	2	["SAMD5","ASIC2"]
Obesity	2	["SAMD5","ASIC2"]
Osteoarthritis	2	["SAMD5","ASIC2"]