SAMD5 (sterile alpha motif domain containing 5)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 389432
• Gene name: Sterile alpha motif domain containing 5
• Gene symbol: SAMD5
• Synonyms (NCBI Gene): dJ875H10.1
• Chromosome: 6
• Chromosome location: 6q24.3

miRNA Show/Hide all (338)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030748	hsa-miR-21-5p	Microarray	18591254
MIRT437613	hsa-miR-145-5p	Microarray, qRT-PCR	22815788
MIRT654029	hsa-miR-3654	HITS-CLIP	19536157
MIRT654028	hsa-miR-1243	HITS-CLIP	19536157
MIRT654027	hsa-miR-4738-5p	HITS-CLIP	19536157
MIRT654022	hsa-miR-7977	HITS-CLIP	19536157
MIRT720106	hsa-miR-3121-5p	HITS-CLIP	19536157
MIRT720105	hsa-miR-4693-3p	HITS-CLIP	19536157
MIRT720104	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT720103	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT654029	hsa-miR-3654	HITS-CLIP	23824327
MIRT654028	hsa-miR-1243	HITS-CLIP	23824327
MIRT654027	hsa-miR-4738-5p	HITS-CLIP	23824327
MIRT654024	hsa-miR-4284	HITS-CLIP	23824327
MIRT654023	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT654022	hsa-miR-7977	HITS-CLIP	23824327
MIRT654029	hsa-miR-3654	HITS-CLIP	23824327
MIRT654028	hsa-miR-1243	HITS-CLIP	23824327
MIRT654027	hsa-miR-4738-5p	HITS-CLIP	23824327
MIRT654026	hsa-miR-3612	HITS-CLIP	23824327
MIRT654025	hsa-miR-650	HITS-CLIP	23824327
MIRT654024	hsa-miR-4284	HITS-CLIP	23824327
MIRT654023	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT654022	hsa-miR-7977	HITS-CLIP	23824327
MIRT654021	hsa-miR-4443	HITS-CLIP	23824327
MIRT622354	hsa-miR-7109-3p	HITS-CLIP	23824327
MIRT622353	hsa-miR-6512-5p	HITS-CLIP	23824327
MIRT622352	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT622351	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT622350	hsa-miR-4503	HITS-CLIP	23824327
MIRT622354	hsa-miR-7109-3p	HITS-CLIP	23824327
MIRT622353	hsa-miR-6512-5p	HITS-CLIP	23824327
MIRT636258	hsa-miR-3688-3p	HITS-CLIP	23824327
MIRT622352	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT622351	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT622350	hsa-miR-4503	HITS-CLIP	23824327
MIRT622356	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT622355	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT622354	hsa-miR-7109-3p	HITS-CLIP	23824327
MIRT622353	hsa-miR-6512-5p	HITS-CLIP	23824327
MIRT622352	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT622351	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT622350	hsa-miR-4503	HITS-CLIP	23824327
MIRT540235	hsa-miR-1306-5p	PAR-CLIP	21572407
MIRT540234	hsa-miR-6890-3p	PAR-CLIP	21572407
MIRT540233	hsa-miR-6736-3p	PAR-CLIP	21572407
MIRT540232	hsa-miR-660-3p	PAR-CLIP	21572407
MIRT540231	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT540230	hsa-miR-6852-5p	PAR-CLIP	21572407
MIRT540229	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT540228	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT540227	hsa-miR-6787-3p	PAR-CLIP	21572407
MIRT540226	hsa-miR-4695-3p	PAR-CLIP	21572407
MIRT540225	hsa-miR-23a-5p	PAR-CLIP	21572407
MIRT540224	hsa-miR-23b-5p	PAR-CLIP	21572407
MIRT540223	hsa-miR-1343-3p	PAR-CLIP	21572407
MIRT540222	hsa-miR-6783-3p	PAR-CLIP	21572407
MIRT540220	hsa-miR-498	PAR-CLIP	21572407
MIRT540235	hsa-miR-1306-5p	PAR-CLIP	21572407
MIRT540234	hsa-miR-6890-3p	PAR-CLIP	21572407
MIRT540233	hsa-miR-6736-3p	PAR-CLIP	21572407
MIRT540232	hsa-miR-660-3p	PAR-CLIP	21572407
MIRT540231	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT540230	hsa-miR-6852-5p	PAR-CLIP	21572407
MIRT540229	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT540228	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT540227	hsa-miR-6787-3p	PAR-CLIP	21572407
MIRT540226	hsa-miR-4695-3p	PAR-CLIP	21572407
MIRT540225	hsa-miR-23a-5p	PAR-CLIP	21572407
MIRT540224	hsa-miR-23b-5p	PAR-CLIP	21572407
MIRT540223	hsa-miR-1343-3p	PAR-CLIP	21572407
MIRT540222	hsa-miR-6783-3p	PAR-CLIP	21572407
MIRT540220	hsa-miR-498	PAR-CLIP	21572407
MIRT654029	hsa-miR-3654	HITS-CLIP	19536157
MIRT654028	hsa-miR-1243	HITS-CLIP	19536157
MIRT654027	hsa-miR-4738-5p	HITS-CLIP	19536157
MIRT654022	hsa-miR-7977	HITS-CLIP	19536157
MIRT720106	hsa-miR-3121-5p	HITS-CLIP	19536157
MIRT720105	hsa-miR-4693-3p	HITS-CLIP	19536157
MIRT720104	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT720103	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT654029	hsa-miR-3654	HITS-CLIP	23824327
MIRT654028	hsa-miR-1243	HITS-CLIP	23824327
MIRT654027	hsa-miR-4738-5p	HITS-CLIP	23824327
MIRT654024	hsa-miR-4284	HITS-CLIP	23824327
MIRT654023	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT654022	hsa-miR-7977	HITS-CLIP	23824327
MIRT654029	hsa-miR-3654	HITS-CLIP	23824327
MIRT654028	hsa-miR-1243	HITS-CLIP	23824327
MIRT654027	hsa-miR-4738-5p	HITS-CLIP	23824327
MIRT654026	hsa-miR-3612	HITS-CLIP	23824327
MIRT654025	hsa-miR-650	HITS-CLIP	23824327
MIRT654024	hsa-miR-4284	HITS-CLIP	23824327
MIRT654023	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT654022	hsa-miR-7977	HITS-CLIP	23824327
MIRT654021	hsa-miR-4443	HITS-CLIP	23824327
MIRT622354	hsa-miR-7109-3p	HITS-CLIP	23824327
MIRT622353	hsa-miR-6512-5p	HITS-CLIP	23824327
MIRT622352	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT622351	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT622350	hsa-miR-4503	HITS-CLIP	23824327
MIRT622354	hsa-miR-7109-3p	HITS-CLIP	23824327
MIRT622353	hsa-miR-6512-5p	HITS-CLIP	23824327
MIRT636258	hsa-miR-3688-3p	HITS-CLIP	23824327
MIRT622352	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT622351	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT622350	hsa-miR-4503	HITS-CLIP	23824327
MIRT622356	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT622355	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT622354	hsa-miR-7109-3p	HITS-CLIP	23824327
MIRT622353	hsa-miR-6512-5p	HITS-CLIP	23824327
MIRT622352	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT622351	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT622350	hsa-miR-4503	HITS-CLIP	23824327
MIRT540235	hsa-miR-1306-5p	PAR-CLIP	21572407
MIRT540234	hsa-miR-6890-3p	PAR-CLIP	21572407
MIRT540233	hsa-miR-6736-3p	PAR-CLIP	21572407
MIRT540232	hsa-miR-660-3p	PAR-CLIP	21572407
MIRT540231	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT540230	hsa-miR-6852-5p	PAR-CLIP	21572407
MIRT540229	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT540228	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT540227	hsa-miR-6787-3p	PAR-CLIP	21572407
MIRT540226	hsa-miR-4695-3p	PAR-CLIP	21572407
MIRT540225	hsa-miR-23a-5p	PAR-CLIP	21572407
MIRT540224	hsa-miR-23b-5p	PAR-CLIP	21572407
MIRT540223	hsa-miR-1343-3p	PAR-CLIP	21572407
MIRT540222	hsa-miR-6783-3p	PAR-CLIP	21572407
MIRT540220	hsa-miR-498	PAR-CLIP	21572407
MIRT540235	hsa-miR-1306-5p	PAR-CLIP	21572407
MIRT540234	hsa-miR-6890-3p	PAR-CLIP	21572407
MIRT540233	hsa-miR-6736-3p	PAR-CLIP	21572407
MIRT540232	hsa-miR-660-3p	PAR-CLIP	21572407
MIRT540231	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT540230	hsa-miR-6852-5p	PAR-CLIP	21572407
MIRT540229	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT540228	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT540227	hsa-miR-6787-3p	PAR-CLIP	21572407
MIRT540226	hsa-miR-4695-3p	PAR-CLIP	21572407
MIRT540225	hsa-miR-23a-5p	PAR-CLIP	21572407
MIRT540224	hsa-miR-23b-5p	PAR-CLIP	21572407
MIRT540223	hsa-miR-1343-3p	PAR-CLIP	21572407
MIRT540222	hsa-miR-6783-3p	PAR-CLIP	21572407
MIRT540220	hsa-miR-498	PAR-CLIP	21572407
MIRT1325433	hsa-miR-122	CLIP-seq
MIRT1325434	hsa-miR-1227	CLIP-seq
MIRT1325435	hsa-miR-1262	CLIP-seq
MIRT1325436	hsa-miR-1267	CLIP-seq
MIRT1325437	hsa-miR-1298	CLIP-seq
MIRT1325438	hsa-miR-1343	CLIP-seq
MIRT1325439	hsa-miR-139-3p	CLIP-seq
MIRT1325440	hsa-miR-186	CLIP-seq
MIRT1325441	hsa-miR-205	CLIP-seq
MIRT1325442	hsa-miR-2052	CLIP-seq
MIRT1325443	hsa-miR-2355-5p	CLIP-seq
MIRT1325444	hsa-miR-2392	CLIP-seq
MIRT1325445	hsa-miR-24	CLIP-seq
MIRT1325446	hsa-miR-3120-5p	CLIP-seq
MIRT1325447	hsa-miR-3128	CLIP-seq
MIRT1325448	hsa-miR-3143	CLIP-seq
MIRT1325449	hsa-miR-3161	CLIP-seq
MIRT1325450	hsa-miR-3171	CLIP-seq
MIRT1325451	hsa-miR-3194-3p	CLIP-seq
MIRT1325452	hsa-miR-3200-5p	CLIP-seq
MIRT1325453	hsa-miR-3664-5p	CLIP-seq
MIRT1325454	hsa-miR-3672	CLIP-seq
MIRT1325455	hsa-miR-3677-3p	CLIP-seq
MIRT1325456	hsa-miR-3679-3p	CLIP-seq
MIRT1325457	hsa-miR-3682-5p	CLIP-seq
MIRT1325458	hsa-miR-3942-3p	CLIP-seq
MIRT1325459	hsa-miR-3945	CLIP-seq
MIRT1325460	hsa-miR-4252	CLIP-seq
MIRT1325461	hsa-miR-4253	CLIP-seq
MIRT1325462	hsa-miR-4275	CLIP-seq
MIRT1325463	hsa-miR-4286	CLIP-seq
MIRT1325464	hsa-miR-4328	CLIP-seq
MIRT1325465	hsa-miR-4422	CLIP-seq
MIRT1325466	hsa-miR-4423-5p	CLIP-seq
MIRT1325467	hsa-miR-4446-5p	CLIP-seq
MIRT1325468	hsa-miR-4470	CLIP-seq
MIRT1325469	hsa-miR-4502	CLIP-seq
MIRT1325470	hsa-miR-4522	CLIP-seq
MIRT1325471	hsa-miR-4534	CLIP-seq
MIRT1325472	hsa-miR-4701-3p	CLIP-seq
MIRT1325473	hsa-miR-4705	CLIP-seq
MIRT1325474	hsa-miR-4802-3p	CLIP-seq
MIRT1325475	hsa-miR-483-5p	CLIP-seq
MIRT1325476	hsa-miR-490-3p	CLIP-seq
MIRT1325477	hsa-miR-508-5p	CLIP-seq
MIRT1325478	hsa-miR-542-3p	CLIP-seq
MIRT1325479	hsa-miR-654-3p	CLIP-seq
MIRT1325480	hsa-miR-661	CLIP-seq
MIRT1325481	hsa-miR-766	CLIP-seq
MIRT1325438	hsa-miR-1343	CLIP-seq
MIRT2096523	hsa-miR-140-3p	CLIP-seq
MIRT2096524	hsa-miR-155	CLIP-seq
MIRT1325445	hsa-miR-24	CLIP-seq
MIRT2096525	hsa-miR-3187-3p	CLIP-seq
MIRT2096526	hsa-miR-371-5p	CLIP-seq
MIRT2096527	hsa-miR-371b-5p	CLIP-seq
MIRT2096528	hsa-miR-4263	CLIP-seq
MIRT2096529	hsa-miR-4279	CLIP-seq
MIRT2096530	hsa-miR-4435	CLIP-seq
MIRT1325467	hsa-miR-4446-5p	CLIP-seq
MIRT2096531	hsa-miR-4455	CLIP-seq
MIRT2096532	hsa-miR-4645-5p	CLIP-seq
MIRT2096533	hsa-miR-4673	CLIP-seq
MIRT2096534	hsa-miR-4701-5p	CLIP-seq
MIRT2096535	hsa-miR-4755-5p	CLIP-seq
MIRT2096536	hsa-miR-4781-3p	CLIP-seq
MIRT2096537	hsa-miR-518a-5p	CLIP-seq
MIRT2096538	hsa-miR-527	CLIP-seq
MIRT2096539	hsa-miR-548s	CLIP-seq
MIRT2096540	hsa-miR-588	CLIP-seq
MIRT1325434	hsa-miR-1227	CLIP-seq
MIRT2320965	hsa-miR-1238	CLIP-seq
MIRT1325435	hsa-miR-1262	CLIP-seq
MIRT2320966	hsa-miR-1304	CLIP-seq
MIRT2320967	hsa-miR-145	CLIP-seq
MIRT2320968	hsa-miR-181a	CLIP-seq
MIRT2320969	hsa-miR-181b	CLIP-seq
MIRT2320970	hsa-miR-181c	CLIP-seq
MIRT2320971	hsa-miR-181d	CLIP-seq
MIRT2320972	hsa-miR-197	CLIP-seq
MIRT2320973	hsa-miR-2110	CLIP-seq
MIRT1325445	hsa-miR-24	CLIP-seq
MIRT2320974	hsa-miR-3150a-3p	CLIP-seq
MIRT2320975	hsa-miR-3180-5p	CLIP-seq
MIRT2320976	hsa-miR-3681	CLIP-seq
MIRT1325458	hsa-miR-3942-3p	CLIP-seq
MIRT2320977	hsa-miR-411	CLIP-seq
MIRT1325460	hsa-miR-4252	CLIP-seq
MIRT2320978	hsa-miR-4262	CLIP-seq
MIRT2096528	hsa-miR-4263	CLIP-seq
MIRT2320979	hsa-miR-4269	CLIP-seq
MIRT2320980	hsa-miR-4433	CLIP-seq
MIRT2320981	hsa-miR-4453	CLIP-seq
MIRT2096531	hsa-miR-4455	CLIP-seq
MIRT2320982	hsa-miR-4514	CLIP-seq
MIRT2320983	hsa-miR-4538	CLIP-seq
MIRT2096532	hsa-miR-4645-5p	CLIP-seq
MIRT2320984	hsa-miR-4668-5p	CLIP-seq
MIRT2096533	hsa-miR-4673	CLIP-seq
MIRT2320985	hsa-miR-4677-3p	CLIP-seq
MIRT2320986	hsa-miR-4679	CLIP-seq
MIRT2320987	hsa-miR-4691-5p	CLIP-seq
MIRT2320988	hsa-miR-4692	CLIP-seq
MIRT1325472	hsa-miR-4701-3p	CLIP-seq
MIRT2320989	hsa-miR-4716-5p	CLIP-seq
MIRT2320990	hsa-miR-4735-5p	CLIP-seq
MIRT2320991	hsa-miR-4742-5p	CLIP-seq
MIRT2096536	hsa-miR-4781-3p	CLIP-seq
MIRT2320992	hsa-miR-4797-5p	CLIP-seq
MIRT1325477	hsa-miR-508-5p	CLIP-seq
MIRT2320993	hsa-miR-5096	CLIP-seq
MIRT1325478	hsa-miR-542-3p	CLIP-seq
MIRT2096539	hsa-miR-548s	CLIP-seq
MIRT2320994	hsa-miR-562	CLIP-seq
MIRT2320995	hsa-miR-579	CLIP-seq
MIRT2320996	hsa-miR-643	CLIP-seq
MIRT1325480	hsa-miR-661	CLIP-seq
MIRT2320997	hsa-miR-665	CLIP-seq
MIRT1325481	hsa-miR-766	CLIP-seq
MIRT1325434	hsa-miR-1227	CLIP-seq
MIRT1325435	hsa-miR-1262	CLIP-seq
MIRT1325436	hsa-miR-1267	CLIP-seq
MIRT2394010	hsa-miR-3135b	CLIP-seq
MIRT2394011	hsa-miR-3652	CLIP-seq
MIRT1325460	hsa-miR-4252	CLIP-seq
MIRT1325466	hsa-miR-4423-5p	CLIP-seq
MIRT2394012	hsa-miR-4430	CLIP-seq
MIRT2096531	hsa-miR-4455	CLIP-seq
MIRT2394013	hsa-miR-4634	CLIP-seq
MIRT1325472	hsa-miR-4701-3p	CLIP-seq
MIRT1325477	hsa-miR-508-5p	CLIP-seq
MIRT1325480	hsa-miR-661	CLIP-seq
MIRT1325481	hsa-miR-766	CLIP-seq
MIRT2458770	hsa-miR-185	CLIP-seq
MIRT1325440	hsa-miR-186	CLIP-seq
MIRT1325443	hsa-miR-2355-5p	CLIP-seq
MIRT2458771	hsa-miR-3133	CLIP-seq
MIRT2458772	hsa-miR-3154	CLIP-seq
MIRT2458773	hsa-miR-3202	CLIP-seq
MIRT2458774	hsa-miR-3613-3p	CLIP-seq
MIRT1325456	hsa-miR-3679-3p	CLIP-seq
MIRT2458775	hsa-miR-4306	CLIP-seq
MIRT2096531	hsa-miR-4455	CLIP-seq
MIRT2458776	hsa-miR-4644	CLIP-seq
MIRT2458777	hsa-miR-4747-5p	CLIP-seq
MIRT2458778	hsa-miR-499a-5p	CLIP-seq
MIRT2458779	hsa-miR-548c-3p	CLIP-seq
MIRT2458780	hsa-miR-570	CLIP-seq
MIRT2458781	hsa-miR-609	CLIP-seq
MIRT2458774	hsa-miR-3613-3p	CLIP-seq
MIRT2096531	hsa-miR-4455	CLIP-seq
MIRT2458779	hsa-miR-548c-3p	CLIP-seq
MIRT2458781	hsa-miR-609	CLIP-seq
MIRT1325434	hsa-miR-1227	CLIP-seq
MIRT1325438	hsa-miR-1343	CLIP-seq
MIRT2616731	hsa-miR-1976	CLIP-seq
MIRT1325446	hsa-miR-3120-5p	CLIP-seq
MIRT2458774	hsa-miR-3613-3p	CLIP-seq
MIRT1325453	hsa-miR-3664-5p	CLIP-seq
MIRT1325460	hsa-miR-4252	CLIP-seq
MIRT2096529	hsa-miR-4279	CLIP-seq
MIRT2616732	hsa-miR-4438	CLIP-seq
MIRT2096531	hsa-miR-4455	CLIP-seq
MIRT1325470	hsa-miR-4522	CLIP-seq
MIRT2616733	hsa-miR-4722-3p	CLIP-seq
MIRT2320990	hsa-miR-4735-5p	CLIP-seq
MIRT2616734	hsa-miR-4773	CLIP-seq
MIRT2616735	hsa-miR-4775	CLIP-seq
MIRT1325477	hsa-miR-508-5p	CLIP-seq
MIRT2616736	hsa-miR-5095	CLIP-seq
MIRT2616737	hsa-miR-512-5p	CLIP-seq
MIRT2458779	hsa-miR-548c-3p	CLIP-seq
MIRT2096539	hsa-miR-548s	CLIP-seq
MIRT2616738	hsa-miR-590-3p	CLIP-seq
MIRT2458781	hsa-miR-609	CLIP-seq
MIRT1325480	hsa-miR-661	CLIP-seq
MIRT1325481	hsa-miR-766	CLIP-seq
MIRT1325434	hsa-miR-1227	CLIP-seq
MIRT2458774	hsa-miR-3613-3p	CLIP-seq
MIRT1325460	hsa-miR-4252	CLIP-seq
MIRT2616732	hsa-miR-4438	CLIP-seq
MIRT2096531	hsa-miR-4455	CLIP-seq
MIRT2320990	hsa-miR-4735-5p	CLIP-seq
MIRT2616734	hsa-miR-4773	CLIP-seq
MIRT2616735	hsa-miR-4775	CLIP-seq
MIRT1325477	hsa-miR-508-5p	CLIP-seq
MIRT2616736	hsa-miR-5095	CLIP-seq
MIRT2616737	hsa-miR-512-5p	CLIP-seq
MIRT2458779	hsa-miR-548c-3p	CLIP-seq
MIRT2096539	hsa-miR-548s	CLIP-seq
MIRT2616738	hsa-miR-590-3p	CLIP-seq
MIRT2458781	hsa-miR-609	CLIP-seq
MIRT1325480	hsa-miR-661	CLIP-seq
MIRT1325481	hsa-miR-766	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IDA	28388653
GO:0005737	Component	Cytoplasm	IEA
GO:1902531	Process	Regulation of intracellular signal transduction	IBA

Other IDs

• MIM: 620517
• HGNC: 21180
• e!Ensembl: ENSG00000203727

Protein

• UniProt ID: Q5TGI4
• Protein name: Sterile alpha motif domain-containing protein 5 (SAM domain-containing protein 5)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00536	SAM_1	3 → 63	SAM domain (Sterile alpha motif)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in biliary epithelial cells on bile ducts at the hepatic hilum (at protein level). {ECO:0000269|PubMed:28388653}.
• Sequence:

  MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVR
  RLREQDANAAGLYFTLEPQPAPPGPPADAVPTGRRGEPCGGPAQGTRGDSRGHTTAPRSR
  ELVSYPKLKLKIMIRDKLVRDGIHLSKPPYSRKVPMAGILEYLMNWPKSSQSR

• Sequence length: 173

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (22)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	20061627	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	27611488	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	30595370	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	32581359	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	35512400	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DILATED CARDIOMYOPATHY	—	GWAS catalog	29495422	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ULCER	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	27182965, 30595370, 34594039, 36093044, 39024449, 39067062, 39789286, 41238958	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC DILATED CARDIOMYOPATHY	—	GWAS catalog	29495422	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	30804565, 35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	29924316	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	30718901, 34924174, 37985818, 38177345	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	38839884	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	38162683	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (7)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Chordoma	Chordoma	Pubtator	27901492	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	30718901		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30739268		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28388653, 30739268		★☆☆☆☆ Found in Text Mining only
Myopia, Degenerative	Myopia	GWASCAT_DG	23049088		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	33172452	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30739268		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SASH1 8 shared diseasesDilated cardiomyopathy, Autoimmune disease, Autoimmune thyroid disease, Esophageal cancer, Esophageal disease, Esophageal ulcer, Gastric cancer, Thyroid disease 8 shared evidence sourcesGWAS catalog (Autoimmune disease), GWAS catalog (Autoimmune thyroid disease), GWAS catalog (Dilated cardiomyopathy), GWAS catalog (Esophageal cancer), GWAS catalog (Esophageal disease), GWAS catalog (Esophageal ulcer), GWAS catalog (Gastric cancer), GWAS catalog (Thyroid disease) Related via 8 shared diseases including Dilated cardiomyopathy, Autoimmune disease — evidence mostly GWAS catalog. CLNK 4 shared diseasesAutoimmune thyroid disease, Esophageal disease, Esophageal ulcer, Thyroid disease 4 shared evidence sourcesGWAS catalog (Autoimmune thyroid disease), GWAS catalog (Esophageal disease), GWAS catalog (Esophageal ulcer), GWAS catalog (Thyroid disease) Related via 4 shared diseases including Autoimmune thyroid disease, Esophageal disease — evidence mostly GWAS catalog. C1QTNF6 3 shared diseasesAutoimmune disease, Autoimmune thyroid disease, Thyroid disease 3 shared evidence sourcesGWAS catalog (Autoimmune disease), GWAS catalog (Autoimmune thyroid disease), GWAS catalog (Thyroid disease) Related via 3 shared diseases including Autoimmune disease, Autoimmune thyroid disease — evidence mostly GWAS catalog. ACAP1 2 shared diseasesAutoimmune thyroid disease, Thyroid disease 2 shared evidence sourcesGWAS catalog (Autoimmune thyroid disease), GWAS catalog (Thyroid disease) Related via 2 shared diseases including Autoimmune thyroid disease, Thyroid disease — evidence mostly GWAS catalog. UNC5CL 2 shared diseasesEsophageal cancer, Gastric cancer 2 shared evidence sourcesGWAS catalog (Esophageal cancer), GWAS catalog (Gastric cancer) Related via 2 shared diseases including Esophageal cancer, Gastric cancer — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SASH1	8	["Dilated cardiomyopathy","Autoimmune disease","Autoimmune thyroid disease","Esophageal cancer","Esophageal disease","Esophageal ulcer","Gastric cancer","Thyroid disease"]	0	[]	8	["GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Dilated cardiomyopathy)","GWAS catalog (Esophageal cancer)","GWAS catalog (Esophageal disease)","GWAS catalog (Esophageal ulcer)","GWAS catalog (Gastric cancer)","GWAS catalog (Thyroid disease)"]
CLNK	4	["Autoimmune thyroid disease","Esophageal disease","Esophageal ulcer","Thyroid disease"]	0	[]	4	["GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Esophageal disease)","GWAS catalog (Esophageal ulcer)","GWAS catalog (Thyroid disease)"]
C1QTNF6	3	["Autoimmune disease","Autoimmune thyroid disease","Thyroid disease"]	0	[]	3	["GWAS catalog (Autoimmune disease)","GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Thyroid disease)"]
ACAP1	2	["Autoimmune thyroid disease","Thyroid disease"]	0	[]	2	["GWAS catalog (Autoimmune thyroid disease)","GWAS catalog (Thyroid disease)"]
UNC5CL	2	["Esophageal cancer","Gastric cancer"]	0	[]	2	["GWAS catalog (Esophageal cancer)","GWAS catalog (Gastric cancer)"]

Diseases Linked via Similar Genes

Diabetes mellitus type 2 Linked via 4 of 5 related genesSASH1, C1QTNF6, ACAP1, UNC5CL Systemic lupus erythematosus Linked via 3 of 5 related genesCLNK, C1QTNF6, ACAP1 Gout Linked via 2 of 5 related genesCLNK, UNC5CL Vitiligo Linked via 2 of 5 related genesCLNK, C1QTNF6 Diabetes mellitus type 1 Linked via 2 of 5 related genesC1QTNF6, ACAP1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Diabetes mellitus type 2	4	["SASH1","C1QTNF6","ACAP1","UNC5CL"]
Systemic lupus erythematosus	3	["CLNK","C1QTNF6","ACAP1"]
Gout	2	["CLNK","UNC5CL"]
Vitiligo	2	["CLNK","C1QTNF6"]
Diabetes mellitus type 1	2	["C1QTNF6","ACAP1"]