Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	222643
Gene name	Unc-5 family C-terminal like
Gene symbol	UNC5CL
Synonyms (NCBI Gene)	MUXAZUD
Chromosome	6
Chromosome location	6p21.1

46 Show/Hide all (46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018350	hsa-miR-335-5p	Microarray	18185580
MIRT1475571	hsa-miR-1291	CLIP-seq
MIRT1475572	hsa-miR-3131	CLIP-seq
MIRT1475573	hsa-miR-3647-3p	CLIP-seq
MIRT1475574	hsa-miR-4767	CLIP-seq
MIRT1475575	hsa-miR-494	CLIP-seq
MIRT1475576	hsa-miR-552	CLIP-seq
MIRT1475577	hsa-miR-611	CLIP-seq
MIRT1475578	hsa-miR-764	CLIP-seq
MIRT1921021	hsa-miR-376a	CLIP-seq
MIRT1921022	hsa-miR-376b	CLIP-seq
MIRT1921021	hsa-miR-376a	CLIP-seq
MIRT1921022	hsa-miR-376b	CLIP-seq
MIRT1921021	hsa-miR-376a	CLIP-seq
MIRT1921022	hsa-miR-376b	CLIP-seq
MIRT2143331	hsa-miR-140-3p	CLIP-seq
MIRT2143332	hsa-miR-3136-5p	CLIP-seq
MIRT2143333	hsa-miR-4427	CLIP-seq
MIRT2143334	hsa-miR-4439	CLIP-seq
MIRT2143335	hsa-miR-4513	CLIP-seq
MIRT2143336	hsa-miR-4686	CLIP-seq
MIRT2143337	hsa-miR-4789-3p	CLIP-seq
MIRT2143338	hsa-miR-628-5p	CLIP-seq
MIRT2363579	hsa-miR-302a	CLIP-seq
MIRT2363580	hsa-miR-302b	CLIP-seq
MIRT2363581	hsa-miR-302c	CLIP-seq
MIRT2363582	hsa-miR-302d	CLIP-seq
MIRT2363583	hsa-miR-302e	CLIP-seq
MIRT1475573	hsa-miR-3647-3p	CLIP-seq
MIRT2363584	hsa-miR-372	CLIP-seq
MIRT2363585	hsa-miR-373	CLIP-seq
MIRT2143333	hsa-miR-4427	CLIP-seq
MIRT2143337	hsa-miR-4789-3p	CLIP-seq
MIRT2363586	hsa-miR-520a-3p	CLIP-seq
MIRT2363587	hsa-miR-520b	CLIP-seq
MIRT2363588	hsa-miR-520c-3p	CLIP-seq
MIRT2363589	hsa-miR-520d-3p	CLIP-seq
MIRT2363590	hsa-miR-520e	CLIP-seq
MIRT1475572	hsa-miR-3131	CLIP-seq
MIRT1475574	hsa-miR-4767	CLIP-seq
MIRT2462932	hsa-miR-485-5p	CLIP-seq
MIRT1475577	hsa-miR-611	CLIP-seq
MIRT1475572	hsa-miR-3131	CLIP-seq
MIRT1475574	hsa-miR-4767	CLIP-seq
MIRT2462932	hsa-miR-485-5p	CLIP-seq
MIRT1475577	hsa-miR-611	CLIP-seq

15 Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005042	Function	Netrin receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IDA
GO:0007165	Process	Signal transduction	IEA
GO:0008233	Function	Peptidase activity	IDA	22158417
GO:0016020	Component	Membrane	IDA	22158417
GO:0016020	Component	Membrane	IEA
GO:0038007	Process	Netrin-activated signaling pathway	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	22158417
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IBA
GO:0046330	Process	Positive regulation of JNK cascade	IDA	22158417

MIM	HGNC	e!Ensembl
617464	21203	ENSG00000124602

Q8IV45

Protein name

UNC5C-like protein (Protein unc-5 homolog C-like) (ZU5 and death domain-containing protein)

Protein function

Inhibits NF-kappa-B-dependent transcription by impairing NF-kappa-B binding to its targets.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00531	Death	413 → 491	Death domain	Domain
PF00791	ZU5	103 → 197	ZU5 domain	Family
PF17217	UPA	243 → 372	UPA domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in pancreas, liver and kidney. {ECO:0000269|PubMed:14769797}.

Sequence

MCPQESSFQPSQFLLLVGVPVASVLLLAQCLRWHCPRRLLGACWTLNGQEEPVSQPTPQL
ENEVSRQHLPATLPEMVAFYQELHTPTQGQTMVRQLMHKLLVFSAREVDHRGGCLMLQDT
GISLLIPPGAVAVGRQERVSLILVWDLSDAPSLSQAQGLVSPVVACGPHGASFLKPCTLT
FKHCAEQPSHARTYSSNTTLLDAKVWRPLGRPGAHASRDECRIHLSHFSLYTCVLEAPVG
REARKWLQLAVFCSPLVPGQSHLQLRIYFLNNTPCALQWALTNEQPHGGRLRGPCQLFDF
NGARGDQCLKLTYISEGWENVDDSSCQLVPHLHIWHGKCPFRSFCFRRKAADENEDCSAL
TNEIIVTMHTFQDGLETKYMEILRFQASEEESWAAPPPVSQPPPCNRLPPELFEQLRMLL
EPNSITGNDWRRLASHLGLCGMKIRFLSCQRSPAAAILELFEEQNGSLQELHYLMTVMER
LDCASAIQNYLSGTHGGSPGPERGGARDNQGLELDEKL

Sequence length

518

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (12)
ALZHEIMER DISEASE	—	GWAS catalog	30617256, 33589840, 34493870, 35379992	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	34794066	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	21642993	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CARCINOMA	—	GWAS catalog	21642993	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	26129866, 33002439	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CARCINOMA	—	GWAS catalog	26129866, 33002439	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	31578528	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	34493870	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	26198764, 35396580	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	34737425	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (6)
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22865593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	22158417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26129866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22865593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	GWASCAT_DG	26129866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26129866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

UNC5CL (unc-5 family C-terminal like)

Bookmark This Gene