Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	93978
Gene name	C-type lectin domain containing 6A
Gene symbol	CLEC6A
Synonyms (NCBI Gene)	CLEC4NCLECSF10dectin-2hDECTIN-2
Chromosome	12
Chromosome location	12p13.31
Summary	The protein encoded by this gene is a type II membrane receptor with an extracellular C-type lectin-like domain fold. The extracellular portion binds structures with a high mannose content and has been shown to recognize several pathogens, including C. el

miRTarBase ID	miRNA	Experiments	Reference
MIRT1965692	hsa-miR-1279	CLIP-seq
MIRT2201616	hsa-miR-3124-3p	CLIP-seq

41 Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001819	Process	Positive regulation of cytokine production	ISS
GO:0001878	Process	Response to yeast	IEA
GO:0001878	Process	Response to yeast	ISS
GO:0001879	Process	Detection of yeast	IEA
GO:0001879	Process	Detection of yeast	ISS
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	ISS
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005509	Function	Calcium ion binding	IDA	28652405
GO:0005515	Function	Protein binding	IPI	23911656
GO:0005537	Function	D-mannose binding	IDA	23911656, 28652405
GO:0005886	Component	Plasma membrane	IDA	23911656
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030246	Function	Carbohydrate binding	IBA
GO:0030246	Function	Carbohydrate binding	IDA	28652405
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030246	Function	Carbohydrate binding	ISS
GO:0038187	Function	Pattern recognition receptor activity	IBA
GO:0038187	Function	Pattern recognition receptor activity	IDA	23911656
GO:0038187	Function	Pattern recognition receptor activity	IEA
GO:0038187	Function	Pattern recognition receptor activity	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0043274	Function	Phospholipase binding	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0050832	Process	Defense response to fungus	IEA
GO:0050832	Process	Defense response to fungus	ISS
GO:0061760	Process	Antifungal innate immune response	IBA
GO:0061760	Process	Antifungal innate immune response	IEA
GO:0061760	Process	Antifungal innate immune response	ISS
GO:1902533	Process	Positive regulation of intracellular signal transduction	IEA
GO:1902533	Process	Positive regulation of intracellular signal transduction	ISS
GO:2000318	Process	Positive regulation of T-helper 17 type immune response	IEA
GO:2000318	Process	Positive regulation of T-helper 17 type immune response	ISS

MIM	HGNC	e!Ensembl
613579	14556	ENSG00000205846

Q6EIG7

Protein name

C-type lectin domain family 6 member A (C-type lectin superfamily member 10) (Dendritic cell-associated C-type lectin 2) (DC-associated C-type lectin 2) (Dectin-2)

Protein function

Calcium-dependent lectin that acts as a pattern recognition receptor (PRR) of the innate immune system: specifically recognizes and binds alpha-mannans on C.albicans hypheas (PubMed:23911656, PubMed:28652405). Binding of C.albicans alpha-mannans

PDB

5VYB , 8ROV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00059	Lectin_C	96 → 204	Lectin C-type domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in lung, spleen, lymph node, leukocytes, bone marrow, tonsils and dendritic cells. Strongly expressed in purified monocytes and weakly in B-cells. In peripheral blood cells, preferentially expressed in plasmacytoids rather th

Sequence

MMQEQQPQSTEKRGWLSLRLWSVAGISIALLSACFIVSCVVTYHFTYGETGKRLSELHSY
HSSLTCFSEGTKVPAWGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTE
AEQNFIVQQLNESFSYFLGLSDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIV
FWKPTGWGWNDVICETRRNSICEMNKIYL

Sequence length

209

Interactions

View interactions

KEGG Pathway	Reactome Pathway
C-type lectin receptor signaling pathway	Dectin-2 family

CLEC6A (C-type lectin domain containing 6A)

Bookmark This Gene