PLCG2 (phospholipase C gamma 2)

Gene

• Entrez ID: 5336
• Gene name: Phospholipase C gamma 2
• Gene symbol: PLCG2
• Synonyms (NCBI Gene): APLAID, FCAS3, PLC-IV, PLC-gamma-2
• Chromosome: 16
• Chromosome location: 16q23.3
• Summary: The protein encoded by this gene is a transmembrane signaling enzyme that catalyzes the conversion of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate to 1D-myo-inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG) using calcium as a cofactor. IP3 an

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs189301790	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs397514562	C>A	Pathogenic	Missense variant, coding sequence variant
rs1057519831	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1057519832	A>C,G,T	Likely-pathogenic	Coding sequence variant, missense variant, synonymous variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019144	hsa-miR-335-5p	Microarray	18185580
MIRT654989	hsa-miR-4680-3p	HITS-CLIP	23824327
MIRT654988	hsa-miR-4703-3p	HITS-CLIP	23824327
MIRT654987	hsa-miR-181b-2-3p	HITS-CLIP	23824327
MIRT654986	hsa-miR-181b-3p	HITS-CLIP	23824327
MIRT654985	hsa-miR-4420	HITS-CLIP	23824327
MIRT654984	hsa-miR-4452	HITS-CLIP	23824327
MIRT654983	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT654981	hsa-miR-3674	HITS-CLIP	23824327
MIRT499428	hsa-miR-6732-3p	HITS-CLIP	24906430
MIRT499427	hsa-miR-5683	HITS-CLIP	24906430
MIRT499425	hsa-miR-504-5p	HITS-CLIP	24906430
MIRT499424	hsa-miR-383-5p	HITS-CLIP	24906430
MIRT499423	hsa-miR-6858-3p	HITS-CLIP	24906430
MIRT499422	hsa-miR-4676-5p	HITS-CLIP	24906430
MIRT499421	hsa-miR-575	HITS-CLIP	24906430
MIRT499418	hsa-miR-6890-5p	HITS-CLIP	24906430
MIRT499416	hsa-miR-1288-5p	HITS-CLIP	24906430
MIRT499415	hsa-miR-1224-3p	HITS-CLIP	24906430
MIRT499414	hsa-miR-1249-3p	HITS-CLIP	24906430
MIRT499396	hsa-miR-3194-5p	HITS-CLIP	24906430
MIRT499392	hsa-miR-6717-5p	HITS-CLIP	24906430
MIRT499391	hsa-miR-8053	HITS-CLIP	24906430
MIRT499386	hsa-miR-342-5p	HITS-CLIP	24906430
MIRT499385	hsa-miR-4664-5p	HITS-CLIP	24906430
MIRT499384	hsa-miR-4651	HITS-CLIP	24906430
MIRT499383	hsa-miR-608	HITS-CLIP	24906430
MIRT499382	hsa-miR-6747-5p	HITS-CLIP	24906430
MIRT499379	hsa-miR-542-3p	HITS-CLIP	24906430
MIRT499377	hsa-miR-6726-3p	HITS-CLIP	24906430
MIRT499374	hsa-miR-6737-5p	HITS-CLIP	24906430
MIRT499373	hsa-miR-6812-5p	HITS-CLIP	24906430
MIRT499372	hsa-miR-6819-5p	HITS-CLIP	24906430
MIRT499428	hsa-miR-6732-3p	HITS-CLIP	24906430
MIRT499427	hsa-miR-5683	HITS-CLIP	24906430
MIRT499425	hsa-miR-504-5p	HITS-CLIP	24906430
MIRT499424	hsa-miR-383-5p	HITS-CLIP	24906430
MIRT499423	hsa-miR-6858-3p	HITS-CLIP	24906430
MIRT499422	hsa-miR-4676-5p	HITS-CLIP	24906430
MIRT499421	hsa-miR-575	HITS-CLIP	24906430
MIRT499418	hsa-miR-6890-5p	HITS-CLIP	24906430
MIRT499416	hsa-miR-1288-5p	HITS-CLIP	24906430
MIRT499415	hsa-miR-1224-3p	HITS-CLIP	24906430
MIRT499414	hsa-miR-1249-3p	HITS-CLIP	24906430
MIRT499396	hsa-miR-3194-5p	HITS-CLIP	24906430
MIRT499392	hsa-miR-6717-5p	HITS-CLIP	24906430
MIRT499391	hsa-miR-8053	HITS-CLIP	24906430
MIRT499386	hsa-miR-342-5p	HITS-CLIP	24906430
MIRT499385	hsa-miR-4664-5p	HITS-CLIP	24906430
MIRT499384	hsa-miR-4651	HITS-CLIP	24906430
MIRT499383	hsa-miR-608	HITS-CLIP	24906430
MIRT499382	hsa-miR-6747-5p	HITS-CLIP	24906430
MIRT499379	hsa-miR-542-3p	HITS-CLIP	24906430
MIRT499377	hsa-miR-6726-3p	HITS-CLIP	24906430
MIRT499374	hsa-miR-6737-5p	HITS-CLIP	24906430
MIRT499373	hsa-miR-6812-5p	HITS-CLIP	24906430
MIRT499372	hsa-miR-6819-5p	HITS-CLIP	24906430
MIRT499428	hsa-miR-6732-3p	HITS-CLIP	24906430
MIRT499427	hsa-miR-5683	HITS-CLIP	24906430
MIRT499425	hsa-miR-504-5p	HITS-CLIP	24906430
MIRT499424	hsa-miR-383-5p	HITS-CLIP	24906430
MIRT499423	hsa-miR-6858-3p	HITS-CLIP	24906430
MIRT499422	hsa-miR-4676-5p	HITS-CLIP	24906430
MIRT499421	hsa-miR-575	HITS-CLIP	24906430
MIRT499418	hsa-miR-6890-5p	HITS-CLIP	24906430
MIRT499416	hsa-miR-1288-5p	HITS-CLIP	24906430
MIRT499415	hsa-miR-1224-3p	HITS-CLIP	24906430
MIRT499414	hsa-miR-1249-3p	HITS-CLIP	24906430
MIRT499396	hsa-miR-3194-5p	HITS-CLIP	24906430
MIRT499392	hsa-miR-6717-5p	HITS-CLIP	24906430
MIRT499391	hsa-miR-8053	HITS-CLIP	24906430
MIRT499386	hsa-miR-342-5p	HITS-CLIP	24906430
MIRT499385	hsa-miR-4664-5p	HITS-CLIP	24906430
MIRT499384	hsa-miR-4651	HITS-CLIP	24906430
MIRT499383	hsa-miR-608	HITS-CLIP	24906430
MIRT499382	hsa-miR-6747-5p	HITS-CLIP	24906430
MIRT499379	hsa-miR-542-3p	HITS-CLIP	24906430
MIRT499377	hsa-miR-6726-3p	HITS-CLIP	24906430
MIRT499374	hsa-miR-6737-5p	HITS-CLIP	24906430
MIRT499373	hsa-miR-6812-5p	HITS-CLIP	24906430
MIRT499372	hsa-miR-6819-5p	HITS-CLIP	24906430
MIRT499428	hsa-miR-6732-3p	HITS-CLIP	24906430
MIRT499427	hsa-miR-5683	HITS-CLIP	24906430
MIRT499425	hsa-miR-504-5p	HITS-CLIP	24906430
MIRT499424	hsa-miR-383-5p	HITS-CLIP	24906430
MIRT499423	hsa-miR-6858-3p	HITS-CLIP	24906430
MIRT499422	hsa-miR-4676-5p	HITS-CLIP	24906430
MIRT499421	hsa-miR-575	HITS-CLIP	24906430
MIRT499418	hsa-miR-6890-5p	HITS-CLIP	24906430
MIRT499416	hsa-miR-1288-5p	HITS-CLIP	24906430
MIRT499415	hsa-miR-1224-3p	HITS-CLIP	24906430
MIRT499414	hsa-miR-1249-3p	HITS-CLIP	24906430
MIRT499396	hsa-miR-3194-5p	HITS-CLIP	24906430
MIRT499392	hsa-miR-6717-5p	HITS-CLIP	24906430
MIRT499391	hsa-miR-8053	HITS-CLIP	24906430
MIRT499386	hsa-miR-342-5p	HITS-CLIP	24906430
MIRT499385	hsa-miR-4664-5p	HITS-CLIP	24906430
MIRT499384	hsa-miR-4651	HITS-CLIP	24906430
MIRT499383	hsa-miR-608	HITS-CLIP	24906430
MIRT499382	hsa-miR-6747-5p	HITS-CLIP	24906430
MIRT499379	hsa-miR-542-3p	HITS-CLIP	24906430
MIRT499377	hsa-miR-6726-3p	HITS-CLIP	24906430
MIRT499374	hsa-miR-6737-5p	HITS-CLIP	24906430
MIRT499373	hsa-miR-6812-5p	HITS-CLIP	24906430
MIRT499372	hsa-miR-6819-5p	HITS-CLIP	24906430
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	20371350
MIRT499427	hsa-miR-5683	PAR-CLIP	20371350
MIRT499425	hsa-miR-504-5p	PAR-CLIP	20371350
MIRT499424	hsa-miR-383-5p	PAR-CLIP	20371350
MIRT499423	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT499422	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT499421	hsa-miR-575	PAR-CLIP	20371350
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	20371350
MIRT499416	hsa-miR-1288-5p	PAR-CLIP	20371350
MIRT499415	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	20371350
MIRT499396	hsa-miR-3194-5p	PAR-CLIP	20371350
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	20371350
MIRT499391	hsa-miR-8053	PAR-CLIP	20371350
MIRT499386	hsa-miR-342-5p	PAR-CLIP	20371350
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	20371350
MIRT499384	hsa-miR-4651	PAR-CLIP	20371350
MIRT499383	hsa-miR-608	PAR-CLIP	20371350
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	20371350
MIRT499379	hsa-miR-542-3p	PAR-CLIP	20371350
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	20371350
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	20371350
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	20371350
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	20371350
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	22012620
MIRT499427	hsa-miR-5683	PAR-CLIP	22012620
MIRT499425	hsa-miR-504-5p	PAR-CLIP	22012620
MIRT499424	hsa-miR-383-5p	PAR-CLIP	22012620
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	22012620
MIRT499416	hsa-miR-1288-5p	PAR-CLIP	22012620
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	22012620
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	22012620
MIRT499391	hsa-miR-8053	PAR-CLIP	22012620
MIRT499386	hsa-miR-342-5p	PAR-CLIP	22012620
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	22012620
MIRT499384	hsa-miR-4651	PAR-CLIP	22012620
MIRT499383	hsa-miR-608	PAR-CLIP	22012620
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	22012620
MIRT499379	hsa-miR-542-3p	PAR-CLIP	22012620
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	22012620
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	22012620
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	22012620
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	22012620
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	23446348
MIRT499427	hsa-miR-5683	PAR-CLIP	23446348
MIRT499425	hsa-miR-504-5p	PAR-CLIP	23446348
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	23446348
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	23446348
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	23446348
MIRT499391	hsa-miR-8053	PAR-CLIP	23446348
MIRT499386	hsa-miR-342-5p	PAR-CLIP	23446348
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	23446348
MIRT499384	hsa-miR-4651	PAR-CLIP	23446348
MIRT499383	hsa-miR-608	PAR-CLIP	23446348
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	23446348
MIRT499379	hsa-miR-542-3p	PAR-CLIP	23446348
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	23446348
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	23446348
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	23446348
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	23446348
MIRT499426	hsa-miR-4802-3p	PAR-CLIP	23446348
MIRT499420	hsa-miR-4476	PAR-CLIP	23446348
MIRT499419	hsa-miR-6876-5p	PAR-CLIP	23446348
MIRT499417	hsa-miR-4717-3p	PAR-CLIP	23446348
MIRT499413	hsa-miR-6746-5p	PAR-CLIP	23446348
MIRT499412	hsa-miR-3179	PAR-CLIP	23446348
MIRT499411	hsa-miR-3126-5p	PAR-CLIP	23446348
MIRT499410	hsa-miR-6875-5p	PAR-CLIP	23446348
MIRT499409	hsa-let-7a-5p	PAR-CLIP	23446348
MIRT499408	hsa-let-7b-5p	PAR-CLIP	23446348
MIRT499407	hsa-let-7c-5p	PAR-CLIP	23446348
MIRT499406	hsa-let-7d-5p	PAR-CLIP	23446348
MIRT499405	hsa-let-7e-5p	PAR-CLIP	23446348
MIRT499404	hsa-let-7f-5p	PAR-CLIP	23446348
MIRT499403	hsa-let-7g-5p	PAR-CLIP	23446348
MIRT499402	hsa-let-7i-5p	PAR-CLIP	23446348
MIRT499401	hsa-miR-4458	PAR-CLIP	23446348
MIRT499400	hsa-miR-4500	PAR-CLIP	23446348
MIRT499399	hsa-miR-98-5p	PAR-CLIP	23446348
MIRT499398	hsa-miR-202-3p	PAR-CLIP	23446348
MIRT499397	hsa-miR-5589-3p	PAR-CLIP	23446348
MIRT499395	hsa-miR-3202	PAR-CLIP	23446348
MIRT499394	hsa-miR-1249-5p	PAR-CLIP	23446348
MIRT499393	hsa-miR-6797-5p	PAR-CLIP	23446348
MIRT499390	hsa-miR-149-3p	PAR-CLIP	23446348
MIRT499389	hsa-miR-4728-5p	PAR-CLIP	23446348
MIRT499388	hsa-miR-6785-5p	PAR-CLIP	23446348
MIRT499387	hsa-miR-6883-5p	PAR-CLIP	23446348
MIRT499381	hsa-miR-4710	PAR-CLIP	23446348
MIRT499380	hsa-miR-8065	PAR-CLIP	23446348
MIRT499378	hsa-miR-1294	PAR-CLIP	23446348
MIRT499376	hsa-miR-425-3p	PAR-CLIP	23446348
MIRT499375	hsa-miR-6771-5p	PAR-CLIP	23446348
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	24398324
MIRT499427	hsa-miR-5683	PAR-CLIP	24398324
MIRT499426	hsa-miR-4802-3p	PAR-CLIP	24398324
MIRT499425	hsa-miR-504-5p	PAR-CLIP	24398324
MIRT499424	hsa-miR-383-5p	PAR-CLIP	24398324
MIRT499423	hsa-miR-6858-3p	PAR-CLIP	24398324
MIRT499422	hsa-miR-4676-5p	PAR-CLIP	24398324
MIRT499421	hsa-miR-575	PAR-CLIP	24398324
MIRT499420	hsa-miR-4476	PAR-CLIP	24398324
MIRT499419	hsa-miR-6876-5p	PAR-CLIP	24398324
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	24398324
MIRT499417	hsa-miR-4717-3p	PAR-CLIP	24398324
MIRT499416	hsa-miR-1288-5p	PAR-CLIP	24398324
MIRT499415	hsa-miR-1224-3p	PAR-CLIP	24398324
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	24398324
MIRT499413	hsa-miR-6746-5p	PAR-CLIP	24398324
MIRT499412	hsa-miR-3179	PAR-CLIP	24398324
MIRT499411	hsa-miR-3126-5p	PAR-CLIP	24398324
MIRT499410	hsa-miR-6875-5p	PAR-CLIP	24398324
MIRT499409	hsa-let-7a-5p	PAR-CLIP	24398324
MIRT499408	hsa-let-7b-5p	PAR-CLIP	24398324
MIRT499407	hsa-let-7c-5p	PAR-CLIP	24398324
MIRT499406	hsa-let-7d-5p	PAR-CLIP	24398324
MIRT499405	hsa-let-7e-5p	PAR-CLIP	24398324
MIRT499404	hsa-let-7f-5p	PAR-CLIP	24398324
MIRT499403	hsa-let-7g-5p	PAR-CLIP	24398324
MIRT499402	hsa-let-7i-5p	PAR-CLIP	24398324
MIRT499401	hsa-miR-4458	PAR-CLIP	24398324
MIRT499400	hsa-miR-4500	PAR-CLIP	24398324
MIRT499399	hsa-miR-98-5p	PAR-CLIP	24398324
MIRT499398	hsa-miR-202-3p	PAR-CLIP	24398324
MIRT499397	hsa-miR-5589-3p	PAR-CLIP	24398324
MIRT499396	hsa-miR-3194-5p	PAR-CLIP	24398324
MIRT499395	hsa-miR-3202	PAR-CLIP	24398324
MIRT499394	hsa-miR-1249-5p	PAR-CLIP	24398324
MIRT499393	hsa-miR-6797-5p	PAR-CLIP	24398324
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	24398324
MIRT499391	hsa-miR-8053	PAR-CLIP	24398324
MIRT499390	hsa-miR-149-3p	PAR-CLIP	24398324
MIRT499389	hsa-miR-4728-5p	PAR-CLIP	24398324
MIRT499388	hsa-miR-6785-5p	PAR-CLIP	24398324
MIRT499387	hsa-miR-6883-5p	PAR-CLIP	24398324
MIRT499386	hsa-miR-342-5p	PAR-CLIP	24398324
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	24398324
MIRT499384	hsa-miR-4651	PAR-CLIP	24398324
MIRT499383	hsa-miR-608	PAR-CLIP	24398324
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	24398324
MIRT499381	hsa-miR-4710	PAR-CLIP	24398324
MIRT499380	hsa-miR-8065	PAR-CLIP	24398324
MIRT499379	hsa-miR-542-3p	PAR-CLIP	24398324
MIRT499378	hsa-miR-1294	PAR-CLIP	24398324
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	24398324
MIRT499376	hsa-miR-425-3p	PAR-CLIP	24398324
MIRT499375	hsa-miR-6771-5p	PAR-CLIP	24398324
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	24398324
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	24398324
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	24398324
MIRT499415	hsa-miR-1224-3p	PAR-CLIP	26701625
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	26701625
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	26701625
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	26701625
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	26701625
MIRT499416	hsa-miR-1288-5p	PAR-CLIP	26701625
MIRT499396	hsa-miR-3194-5p	PAR-CLIP	26701625
MIRT499386	hsa-miR-342-5p	PAR-CLIP	26701625
MIRT499386	hsa-miR-342-5p	PAR-CLIP	26701625
MIRT499386	hsa-miR-342-5p	PAR-CLIP	26701625
MIRT499386	hsa-miR-342-5p	PAR-CLIP	26701625
MIRT499424	hsa-miR-383-5p	PAR-CLIP	26701625
MIRT499384	hsa-miR-4651	PAR-CLIP	26701625
MIRT499384	hsa-miR-4651	PAR-CLIP	26701625
MIRT499384	hsa-miR-4651	PAR-CLIP	26701625
MIRT499384	hsa-miR-4651	PAR-CLIP	26701625
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	26701625
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	26701625
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	26701625
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	26701625
MIRT499422	hsa-miR-4676-5p	PAR-CLIP	26701625
MIRT499425	hsa-miR-504-5p	PAR-CLIP	26701625
MIRT499425	hsa-miR-504-5p	PAR-CLIP	26701625
MIRT499425	hsa-miR-504-5p	PAR-CLIP	26701625
MIRT499425	hsa-miR-504-5p	PAR-CLIP	26701625
MIRT499379	hsa-miR-542-3p	PAR-CLIP	26701625
MIRT499379	hsa-miR-542-3p	PAR-CLIP	26701625
MIRT499379	hsa-miR-542-3p	PAR-CLIP	26701625
MIRT499379	hsa-miR-542-3p	PAR-CLIP	26701625
MIRT499427	hsa-miR-5683	PAR-CLIP	26701625
MIRT499427	hsa-miR-5683	PAR-CLIP	26701625
MIRT499427	hsa-miR-5683	PAR-CLIP	26701625
MIRT499427	hsa-miR-5683	PAR-CLIP	26701625
MIRT499421	hsa-miR-575	PAR-CLIP	26701625
MIRT499383	hsa-miR-608	PAR-CLIP	26701625
MIRT499383	hsa-miR-608	PAR-CLIP	26701625
MIRT499383	hsa-miR-608	PAR-CLIP	26701625
MIRT499383	hsa-miR-608	PAR-CLIP	26701625
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	26701625
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	26701625
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	26701625
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	26701625
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	26701625
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	26701625
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	26701625
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	26701625
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	26701625
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	26701625
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	26701625
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	26701625
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	26701625
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	26701625
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	26701625
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	26701625
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	26701625
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	26701625
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	26701625
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	26701625
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	26701625
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	26701625
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	26701625
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	26701625
MIRT499423	hsa-miR-6858-3p	PAR-CLIP	26701625
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	26701625
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	26701625
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	26701625
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	26701625
MIRT499391	hsa-miR-8053	PAR-CLIP	26701625
MIRT499391	hsa-miR-8053	PAR-CLIP	26701625
MIRT499391	hsa-miR-8053	PAR-CLIP	26701625
MIRT499391	hsa-miR-8053	PAR-CLIP	26701625
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	27292025
MIRT499416	hsa-miR-1288-5p	PAR-CLIP	27292025
MIRT499396	hsa-miR-3194-5p	PAR-CLIP	27292025
MIRT499386	hsa-miR-342-5p	PAR-CLIP	27292025
MIRT499424	hsa-miR-383-5p	PAR-CLIP	27292025
MIRT499384	hsa-miR-4651	PAR-CLIP	27292025
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	27292025
MIRT499422	hsa-miR-4676-5p	PAR-CLIP	27292025
MIRT499425	hsa-miR-504-5p	PAR-CLIP	27292025
MIRT499379	hsa-miR-542-3p	PAR-CLIP	27292025
MIRT499427	hsa-miR-5683	PAR-CLIP	27292025
MIRT499421	hsa-miR-575	PAR-CLIP	27292025
MIRT499383	hsa-miR-608	PAR-CLIP	27292025
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	27292025
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	27292025
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	27292025
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	27292025
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	27292025
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	27292025
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	27292025
MIRT499423	hsa-miR-6858-3p	PAR-CLIP	27292025
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	27292025
MIRT499391	hsa-miR-8053	PAR-CLIP	27292025
MIRT499415	hsa-miR-1224-3p	HITS-CLIP	27418678
MIRT499414	hsa-miR-1249-3p	HITS-CLIP	27418678
MIRT499416	hsa-miR-1288-5p	HITS-CLIP	27418678
MIRT499396	hsa-miR-3194-5p	HITS-CLIP	27418678
MIRT499386	hsa-miR-342-5p	HITS-CLIP	27418678
MIRT499424	hsa-miR-383-5p	HITS-CLIP	27418678
MIRT499384	hsa-miR-4651	HITS-CLIP	27418678
MIRT499385	hsa-miR-4664-5p	HITS-CLIP	27418678
MIRT499422	hsa-miR-4676-5p	HITS-CLIP	27418678
MIRT499425	hsa-miR-504-5p	HITS-CLIP	27418678
MIRT499379	hsa-miR-542-3p	HITS-CLIP	27418678
MIRT499427	hsa-miR-5683	HITS-CLIP	27418678
MIRT499421	hsa-miR-575	HITS-CLIP	27418678
MIRT499383	hsa-miR-608	HITS-CLIP	27418678
MIRT499392	hsa-miR-6717-5p	HITS-CLIP	27418678
MIRT499377	hsa-miR-6726-3p	HITS-CLIP	27418678
MIRT499428	hsa-miR-6732-3p	HITS-CLIP	27418678
MIRT499374	hsa-miR-6737-5p	HITS-CLIP	27418678
MIRT499382	hsa-miR-6747-5p	HITS-CLIP	27418678
MIRT499373	hsa-miR-6812-5p	HITS-CLIP	27418678
MIRT499372	hsa-miR-6819-5p	HITS-CLIP	27418678
MIRT499423	hsa-miR-6858-3p	HITS-CLIP	27418678
MIRT499418	hsa-miR-6890-5p	HITS-CLIP	27418678
MIRT499391	hsa-miR-8053	HITS-CLIP	27418678
MIRT654989	hsa-miR-4680-3p	HITS-CLIP	23824327
MIRT654988	hsa-miR-4703-3p	HITS-CLIP	23824327
MIRT654987	hsa-miR-181b-2-3p	HITS-CLIP	23824327
MIRT654986	hsa-miR-181b-3p	HITS-CLIP	23824327
MIRT654985	hsa-miR-4420	HITS-CLIP	23824327
MIRT654984	hsa-miR-4452	HITS-CLIP	23824327
MIRT654983	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT654981	hsa-miR-3674	HITS-CLIP	23824327
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	20371350
MIRT499427	hsa-miR-5683	PAR-CLIP	20371350
MIRT499425	hsa-miR-504-5p	PAR-CLIP	20371350
MIRT499424	hsa-miR-383-5p	PAR-CLIP	20371350
MIRT499423	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT499422	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT499421	hsa-miR-575	PAR-CLIP	20371350
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	20371350
MIRT499416	hsa-miR-1288-5p	PAR-CLIP	20371350
MIRT499415	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	20371350
MIRT499396	hsa-miR-3194-5p	PAR-CLIP	20371350
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	20371350
MIRT499391	hsa-miR-8053	PAR-CLIP	20371350
MIRT499386	hsa-miR-342-5p	PAR-CLIP	20371350
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	20371350
MIRT499384	hsa-miR-4651	PAR-CLIP	20371350
MIRT499383	hsa-miR-608	PAR-CLIP	20371350
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	20371350
MIRT499379	hsa-miR-542-3p	PAR-CLIP	20371350
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	20371350
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	20371350
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	20371350
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	20371350
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	22012620
MIRT499427	hsa-miR-5683	PAR-CLIP	22012620
MIRT499425	hsa-miR-504-5p	PAR-CLIP	22012620
MIRT499424	hsa-miR-383-5p	PAR-CLIP	22012620
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	22012620
MIRT499416	hsa-miR-1288-5p	PAR-CLIP	22012620
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	22012620
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	22012620
MIRT499391	hsa-miR-8053	PAR-CLIP	22012620
MIRT499386	hsa-miR-342-5p	PAR-CLIP	22012620
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	22012620
MIRT499384	hsa-miR-4651	PAR-CLIP	22012620
MIRT499383	hsa-miR-608	PAR-CLIP	22012620
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	22012620
MIRT499379	hsa-miR-542-3p	PAR-CLIP	22012620
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	22012620
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	22012620
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	22012620
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	22012620
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	23446348
MIRT499427	hsa-miR-5683	PAR-CLIP	23446348
MIRT499425	hsa-miR-504-5p	PAR-CLIP	23446348
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	23446348
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	23446348
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	23446348
MIRT499391	hsa-miR-8053	PAR-CLIP	23446348
MIRT499386	hsa-miR-342-5p	PAR-CLIP	23446348
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	23446348
MIRT499384	hsa-miR-4651	PAR-CLIP	23446348
MIRT499383	hsa-miR-608	PAR-CLIP	23446348
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	23446348
MIRT499379	hsa-miR-542-3p	PAR-CLIP	23446348
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	23446348
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	23446348
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	23446348
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	23446348
MIRT499426	hsa-miR-4802-3p	PAR-CLIP	23446348
MIRT499420	hsa-miR-4476	PAR-CLIP	23446348
MIRT499419	hsa-miR-6876-5p	PAR-CLIP	23446348
MIRT499417	hsa-miR-4717-3p	PAR-CLIP	23446348
MIRT499413	hsa-miR-6746-5p	PAR-CLIP	23446348
MIRT499412	hsa-miR-3179	PAR-CLIP	23446348
MIRT499411	hsa-miR-3126-5p	PAR-CLIP	23446348
MIRT499410	hsa-miR-6875-5p	PAR-CLIP	23446348
MIRT499409	hsa-let-7a-5p	PAR-CLIP	23446348
MIRT499408	hsa-let-7b-5p	PAR-CLIP	23446348
MIRT499407	hsa-let-7c-5p	PAR-CLIP	23446348
MIRT499406	hsa-let-7d-5p	PAR-CLIP	23446348
MIRT499405	hsa-let-7e-5p	PAR-CLIP	23446348
MIRT499404	hsa-let-7f-5p	PAR-CLIP	23446348
MIRT499403	hsa-let-7g-5p	PAR-CLIP	23446348
MIRT499402	hsa-let-7i-5p	PAR-CLIP	23446348
MIRT499401	hsa-miR-4458	PAR-CLIP	23446348
MIRT499400	hsa-miR-4500	PAR-CLIP	23446348
MIRT499399	hsa-miR-98-5p	PAR-CLIP	23446348
MIRT499398	hsa-miR-202-3p	PAR-CLIP	23446348
MIRT499397	hsa-miR-5589-3p	PAR-CLIP	23446348
MIRT499395	hsa-miR-3202	PAR-CLIP	23446348
MIRT499394	hsa-miR-1249-5p	PAR-CLIP	23446348
MIRT499393	hsa-miR-6797-5p	PAR-CLIP	23446348
MIRT499390	hsa-miR-149-3p	PAR-CLIP	23446348
MIRT499389	hsa-miR-4728-5p	PAR-CLIP	23446348
MIRT499388	hsa-miR-6785-5p	PAR-CLIP	23446348
MIRT499387	hsa-miR-6883-5p	PAR-CLIP	23446348
MIRT499381	hsa-miR-4710	PAR-CLIP	23446348
MIRT499380	hsa-miR-8065	PAR-CLIP	23446348
MIRT499378	hsa-miR-1294	PAR-CLIP	23446348
MIRT499376	hsa-miR-425-3p	PAR-CLIP	23446348
MIRT499375	hsa-miR-6771-5p	PAR-CLIP	23446348
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	24398324
MIRT499427	hsa-miR-5683	PAR-CLIP	24398324
MIRT499426	hsa-miR-4802-3p	PAR-CLIP	24398324
MIRT499425	hsa-miR-504-5p	PAR-CLIP	24398324
MIRT499424	hsa-miR-383-5p	PAR-CLIP	24398324
MIRT499423	hsa-miR-6858-3p	PAR-CLIP	24398324
MIRT499422	hsa-miR-4676-5p	PAR-CLIP	24398324
MIRT499421	hsa-miR-575	PAR-CLIP	24398324
MIRT499420	hsa-miR-4476	PAR-CLIP	24398324
MIRT499419	hsa-miR-6876-5p	PAR-CLIP	24398324
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	24398324
MIRT499417	hsa-miR-4717-3p	PAR-CLIP	24398324
MIRT499416	hsa-miR-1288-5p	PAR-CLIP	24398324
MIRT499415	hsa-miR-1224-3p	PAR-CLIP	24398324
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	24398324
MIRT499413	hsa-miR-6746-5p	PAR-CLIP	24398324
MIRT499412	hsa-miR-3179	PAR-CLIP	24398324
MIRT499411	hsa-miR-3126-5p	PAR-CLIP	24398324
MIRT499410	hsa-miR-6875-5p	PAR-CLIP	24398324
MIRT499409	hsa-let-7a-5p	PAR-CLIP	24398324
MIRT499408	hsa-let-7b-5p	PAR-CLIP	24398324
MIRT499407	hsa-let-7c-5p	PAR-CLIP	24398324
MIRT499406	hsa-let-7d-5p	PAR-CLIP	24398324
MIRT499405	hsa-let-7e-5p	PAR-CLIP	24398324
MIRT499404	hsa-let-7f-5p	PAR-CLIP	24398324
MIRT499403	hsa-let-7g-5p	PAR-CLIP	24398324
MIRT499402	hsa-let-7i-5p	PAR-CLIP	24398324
MIRT499401	hsa-miR-4458	PAR-CLIP	24398324
MIRT499400	hsa-miR-4500	PAR-CLIP	24398324
MIRT499399	hsa-miR-98-5p	PAR-CLIP	24398324
MIRT499398	hsa-miR-202-3p	PAR-CLIP	24398324
MIRT499397	hsa-miR-5589-3p	PAR-CLIP	24398324
MIRT499396	hsa-miR-3194-5p	PAR-CLIP	24398324
MIRT499395	hsa-miR-3202	PAR-CLIP	24398324
MIRT499394	hsa-miR-1249-5p	PAR-CLIP	24398324
MIRT499393	hsa-miR-6797-5p	PAR-CLIP	24398324
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	24398324
MIRT499391	hsa-miR-8053	PAR-CLIP	24398324
MIRT499390	hsa-miR-149-3p	PAR-CLIP	24398324
MIRT499389	hsa-miR-4728-5p	PAR-CLIP	24398324
MIRT499388	hsa-miR-6785-5p	PAR-CLIP	24398324
MIRT499387	hsa-miR-6883-5p	PAR-CLIP	24398324
MIRT499386	hsa-miR-342-5p	PAR-CLIP	24398324
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	24398324
MIRT499384	hsa-miR-4651	PAR-CLIP	24398324
MIRT499383	hsa-miR-608	PAR-CLIP	24398324
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	24398324
MIRT499381	hsa-miR-4710	PAR-CLIP	24398324
MIRT499380	hsa-miR-8065	PAR-CLIP	24398324
MIRT499379	hsa-miR-542-3p	PAR-CLIP	24398324
MIRT499378	hsa-miR-1294	PAR-CLIP	24398324
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	24398324
MIRT499376	hsa-miR-425-3p	PAR-CLIP	24398324
MIRT499375	hsa-miR-6771-5p	PAR-CLIP	24398324
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	24398324
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	24398324
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	24398324
MIRT2297703	hsa-miR-4643	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001775	Process	Cell activation	IEA
GO:0001775	Process	Cell activation	ISS
GO:0001784	Function	Phosphotyrosine residue binding	IPI	20624904
GO:0001878	Process	Response to yeast	IEA
GO:0001878	Process	Response to yeast	ISS
GO:0002092	Process	Positive regulation of receptor internalization	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	ISS
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002224	Process	Toll-like receptor signaling pathway	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	ISS
GO:0002281	Process	Macrophage activation involved in immune response	IEA
GO:0002281	Process	Macrophage activation involved in immune response	ISS
GO:0002316	Process	Follicular B cell differentiation	IEA
GO:0002732	Process	Positive regulation of dendritic cell cytokine production	IEA
GO:0002732	Process	Positive regulation of dendritic cell cytokine production	ISS
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	IBA
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	IDA	11606584, 12181444
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	IEA
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	IMP	32514138
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	TAS
GO:0004629	Function	Phospholipase C activity	TAS
GO:0005515	Function	Protein binding	IPI	15644415, 16273093, 24642916, 24658140, 24728074, 25241761, 25814554, 31980649, 33961781, 35512704
GO:0005737	Component	Cytoplasm	IDA	11331309
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	11331309, 11606584
GO:0005886	Component	Plasma membrane	IDA	11606584
GO:0005886	Component	Plasma membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006661	Process	Phosphatidylinositol biosynthetic process	IDA	11606584, 12181444
GO:0007165	Process	Signal transduction	IEA
GO:0008081	Function	Phosphoric diester hydrolase activity	IEA
GO:0009395	Process	Phospholipid catabolic process	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	32514138
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010634	Process	Positive regulation of epithelial cell migration	IBA
GO:0012501	Process	Programmed cell death	IEA
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016055	Process	Wnt signaling pathway	TAS	18784435
GO:0016787	Function	Hydrolase activity	IEA
GO:0019216	Process	Regulation of lipid metabolic process	IMP	32514138
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0019722	Process	Calcium-mediated signaling	IMP	11606584
GO:0019722	Process	Calcium-mediated signaling	NAS	11043765
GO:0019901	Function	Protein kinase binding	IPI	11606584
GO:0030168	Process	Platelet activation	TAS
GO:0030183	Process	B cell differentiation	IEA
GO:0030183	Process	B cell differentiation	ISS
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IMP	32514138
GO:0032481	Process	Positive regulation of type I interferon production	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032587	Component	Ruffle membrane	IBA
GO:0032587	Component	Ruffle membrane	IDA	11331309
GO:0032587	Component	Ruffle membrane	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	ISS
GO:0032747	Process	Positive regulation of interleukin-23 production	IEA
GO:0032747	Process	Positive regulation of interleukin-23 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0032959	Process	Inositol trisphosphate biosynthetic process	IEA
GO:0035556	Process	Intracellular signal transduction	IDA	11606584, 14656219
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	IMP	32514138
GO:0035556	Process	Intracellular signal transduction	ISS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	IEA
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042113	Process	B cell activation	IDA	30107486
GO:0043069	Process	Negative regulation of programmed cell death	IEA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IEA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0046488	Process	Phosphatidylinositol metabolic process	IBA
GO:0048015	Process	Phosphatidylinositol-mediated signaling	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	23555801
GO:0048678	Process	Response to axon injury	IMP	32514138
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	ISS
GO:0050851	Process	Antigen receptor-mediated signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	ISS
GO:0050853	Process	B cell receptor signaling pathway	IDA	15509800
GO:0050853	Process	B cell receptor signaling pathway	IEA
GO:0050853	Process	B cell receptor signaling pathway	IMP	11606584
GO:0050853	Process	B cell receptor signaling pathway	ISS
GO:0050853	Process	B cell receptor signaling pathway	TAS	23555801
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IBA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IDA	11606584
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IEA
GO:0051282	Process	Regulation of sequestering of calcium ion	IEA
GO:0060100	Process	Positive regulation of phagocytosis, engulfment	IMP	32514138
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	ISS
GO:0061760	Process	Antifungal innate immune response	IEA
GO:0061760	Process	Antifungal innate immune response	ISS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070884	Process	Regulation of calcineurin-NFAT signaling cascade	IEA
GO:0070884	Process	Regulation of calcineurin-NFAT signaling cascade	ISS
GO:0071277	Process	Cellular response to calcium ion	IMP	11606584
GO:0071396	Process	Cellular response to lipid	IMP	32514138
GO:0097110	Function	Scaffold protein binding	IPI	11606584, 23555801
GO:0097708	Component	Intracellular vesicle	IDA	11331309
GO:0140031	Function	Phosphorylation-dependent protein binding	IEA
GO:0150078	Process	Positive regulation of neuroinflammatory response	IMP	32514138
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IMP	32514138
GO:1902533	Process	Positive regulation of intracellular signal transduction	ISS
GO:1902808	Process	Positive regulation of cell cycle G1/S phase transition	ISS
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	IEA
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	ISS
GO:1990782	Function	Protein tyrosine kinase binding	IPI	32514138
GO:1990858	Process	Cellular response to lectin	IEA
GO:1990858	Process	Cellular response to lectin	ISS

Other IDs

• MIM: 600220
• HGNC: 9066
• e!Ensembl: ENSG00000197943

Protein

• UniProt ID: P16885
• Protein name: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 (EC 3.1.4.11) (Phosphoinositide phospholipase C-gamma-2) (Phospholipase C-IV) (PLC-IV) (Phospholipase C-gamma-2) (PLC-gamma-2)
• Protein function: The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. It is a crucial enzyme in transmembrane signaling. {ECO:
• PDB: 2K2J, 2W2W, 2W2X, 8JQG, 8JQH, 8JQI, 8T7C
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00388	PI-PLC-X	314 → 457	Phosphatidylinositol-specific phospholipase C, X domain	Family
  PF00017	SH2	532 → 617	SH2 domain	Domain
  PF00017	SH2	646 → 720	SH2 domain	Domain
  PF00018	SH3_1	775 → 821	SH3 domain	Domain
  PF00387	PI-PLC-Y	930 → 1042	Phosphatidylinositol-specific phospholipase C, Y domain	Family
  PF00168	C2	1061 → 1168	C2 domain	Domain

• Sequence:

  MSTTVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
  IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAV
  NWLSGLKILHQEAMNASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSA
  KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
  VYLHDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
  IWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELDC
  WDGPDGKPVIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCSVEQQRHMAKA
  FKEVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
  LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKKVEKR
  TSAEKLLQEYCMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYY
  LTDNLTFSSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDML
  MRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
  EKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
  KAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADFEELEKQII
  EDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDRVEELFEWF
  QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
  TKADSIIRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKY
  MQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
  ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPIWAPTQEKVTFEIYDPNLAFLRFVVYEED
  MFSDPNFLAHATYPIKAVKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
  RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFSVNENQLQLYQEKCNKRLREKRVSN
  SKFYS

• Sequence length: 1265

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autoinflammation-PLCG2-associated antibody deficiency-immune dysregulation	Likely pathogenic; Pathogenic	rs2143682648, rs2143705605, rs397514562	RCV001650513 RCV002260534 RCV000032898	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial cold autoinflammatory syndrome 3	Likely pathogenic; Pathogenic	rs753618006, rs746749620, rs1381167403	RCV001824263 RCV002305070 RCV001227511	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATION, ANTIBODY DEFICIENCY, AND IMMUNE DYSREGULATION	—	CTD, HPO CTD, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATION, ANTIBODY DEFICIENCY, AND IMMUNE DYSREGULATION, PLCG2-ASSOCIATED	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clonal Cytopenia of Undetermined Significance	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COR PULMONALE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRYOPYRIN-ASSOCIATED PERIODIC SYNDROMES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cold autoinflammatory syndrome	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLCG2-related disorder	Likely benign; Uncertain significance; Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Recurrent fever	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	28714976		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27758892		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	18784435		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	25012946		★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	Pubtator	32671674	Associate	★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	31560769		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	28714976, 30258121, 30326945, 31131421, 32166339, 32894242, 33092647, 33239300, 34099642, 34615897, 35895133, 36530083, 36933698, 40528303	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	33092647	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	28714976		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	28714976		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	30711010		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	28714976		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	28714976		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	31131421	Associate	★☆☆☆☆ Found in Text Mining only
Anovulation	Anovulation	Pubtator	40287692	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	25993291	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	36113963	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	32186396	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	35773312	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22236196, 31633221		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	22236196, 36933698	Associate	★☆☆☆☆ Found in Text Mining only
AUTOINFLAMMATION, ANTIBODY DEFICIENCY, AND IMMUNE DYSREGULATION, PLCG2-ASSOCIATED	Autoinflammation, Antibody Deficiency, And Immune Dysregulation	GENOMICS_ENGLAND_DG	22236196, 23000145, 29538758		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATION, ANTIBODY DEFICIENCY, AND IMMUNE DYSREGULATION, PLCG2-ASSOCIATED	Autoinflammation, Antibody Deficiency, And Immune Dysregulation	ORPHANET_DG	23000145		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATION, ANTIBODY DEFICIENCY, AND IMMUNE DYSREGULATION, PLCG2-ASSOCIATED	Autoinflammation, Antibody Deficiency, And Immune Dysregulation	UNIPROT_DG	23000145		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATION, ANTIBODY DEFICIENCY, AND IMMUNE DYSREGULATION, PLCG2-ASSOCIATED	Autoinflammation, Antibody Deficiency, And Immune Dysregulation	BEFREE	30619256		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATION, ANTIBODY DEFICIENCY, AND IMMUNE DYSREGULATION, PLCG2-ASSOCIATED	Autoinflammation, Antibody Deficiency, And Immune Dysregulation	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATION, ANTIBODY DEFICIENCY, AND IMMUNE DYSREGULATION, PLCG2-ASSOCIATED	Autoinflammation, Antibody Deficiency, And Immune Dysregulation	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoinflammation-PLCG2-associated antibody deficiency-immune dysregulation	Autoinflammation, Antibody Deficiency, And Immune Dysregulation	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autoinflammatory disorder	Autoinflammatory Disease	GENOMICS_ENGLAND_DG	29538758		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	20525309, 29436605, 31163690, 31889510	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24080446, 26275715		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	24080446	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	28465297	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	29371955		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	36253891	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35276058, 36530957	Associate	★☆☆☆☆ Found in Text Mining only
Cherubism	Cherubism	BEFREE	24916406		★☆☆☆☆ Found in Text Mining only
Chronic Infantile Neurological, Cutaneous, and Articular Syndrome	Neurological, Cutaneous And Articular Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17804547, 24489640, 24869598, 25972157, 26182309, 27542411, 27903679, 28049639, 28212557, 29381098, 29484684, 31014395, 31180577, 31243043		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CLINVAR_DG	24869598		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CTD_human_DG	27542411		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	32166339, 36530083, 36933698	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	31853824, 32047491, 33859323	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	29538758		★☆☆☆☆ Found in Text Mining only
Cryopyrin-Associated Periodic Syndromes	Cryopyrin-Associated Periodic Syndromes	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cutis Laxa	Cutis Laxa	BEFREE	30619256		★☆☆☆☆ Found in Text Mining only
Cutis Laxa	Cutis laxa	Pubtator	30619256	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	31131421	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	30429375		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22344559	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25012946, 29496671		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	29733744		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	28714976		★☆☆☆☆ Found in Text Mining only
Familial Cold Autoinflammatory Syndrome 1	Cold Autoinflammatory Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
FAMILIAL COLD AUTOINFLAMMATORY SYNDROME 3	Cold Autoinflammatory Syndrome	ORPHANET_DG	22236196, 23000145		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
FAMILIAL COLD AUTOINFLAMMATORY SYNDROME 3	Cold Autoinflammatory Syndrome	GENOMICS_ENGLAND_DG	23000145, 29538758		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial cold urticaria	Cold urticaria	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	31131421	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	37616163	Associate	★☆☆☆☆ Found in Text Mining only
Genetic Predisposition to Disease	Genetic predisposition to disease	Pubtator	30508305	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	37989267	Stimulate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	36033826	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12881301, 28791394	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	30711010		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	28067908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	28067908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	36113963	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasm	Kidney Neoplasm	BEFREE	23155228		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	36033826	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27758892		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	30326945		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	30326945, 31131421, 33092647	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31310377		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37031207	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36180106	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	15744341		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	36994552	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	31560769, 32631374	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24080446, 26275715		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29972810		★☆☆☆☆ Found in Text Mining only
Muckle-Wells Syndrome	Muckle-Wells Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	30326945	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	30787430	Associate	★☆☆☆☆ Found in Text Mining only
Myoclonic dystonia	Myoclonic dystonia	Pubtator	35773312	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31549850		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	18784435		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	25349203	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30326945, 31131421, 38061598	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30326945, 31131421		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30658193	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	21749368, 28272351		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	21749368		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26096802		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35120576	Associate	★☆☆☆☆ Found in Text Mining only
PLCG2-associated antibody deficiency and immune dysregulation	Antibody Deficiency And Immune Dysregulation	ORPHANET_DG	22236196, 23000145		★☆☆☆☆ Found in Text Mining only
PLCG2-associated antibody deficiency and immune dysregulation	Antibody Deficiency And Immune Dysregulation	Orphanet			★☆☆☆☆ Found in Text Mining only
PLCG2-associated antibody deficiency and immune dysregulation	Antibody Deficiency And Immune Dysregulation	BEFREE	25760457, 31633221		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	33224973, 37226082, 40287692	Associate	★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	28714976		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	30326945		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28210261		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	33725976	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	34653364	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	38223749	Associate	★☆☆☆☆ Found in Text Mining only
Steroid-sensitive nephrotic syndrome	Steroid-Sensitive Nephrotic Syndrome	BEFREE	25349203, 30568185		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	14606067		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	14606067	Associate	★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	30326945, 33092647	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	22236196	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	28067908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urticaria	Urticaria	Pubtator	23000145	Associate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	31420334, 37537391	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	HPO_DG			★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	29496671		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	30402490	Associate	★☆☆☆☆ Found in Text Mining only