PLCG2 (phospholipase C gamma 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5336
• Gene name: Phospholipase C gamma 2
• Gene symbol: PLCG2
• Synonyms (NCBI Gene): APLAID, FCAS3, PLC-IV, PLC-gamma-2
• Chromosome: 16
• Chromosome location: 16q23.3
• Summary: The protein encoded by this gene is a transmembrane signaling enzyme that catalyzes the conversion of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate to 1D-myo-inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG) using calcium as a cofactor. IP3 an

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs189301790	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs397514562	C>A	Pathogenic	Missense variant, coding sequence variant
rs1057519831	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1057519832	A>C,G,T	Likely-pathogenic	Coding sequence variant, missense variant, synonymous variant

miRNA Show/Hide all (536)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019144	hsa-miR-335-5p	Microarray	18185580
MIRT654989	hsa-miR-4680-3p	HITS-CLIP	23824327
MIRT654988	hsa-miR-4703-3p	HITS-CLIP	23824327
MIRT654987	hsa-miR-181b-2-3p	HITS-CLIP	23824327
MIRT654986	hsa-miR-181b-3p	HITS-CLIP	23824327
MIRT654985	hsa-miR-4420	HITS-CLIP	23824327
MIRT654984	hsa-miR-4452	HITS-CLIP	23824327
MIRT654983	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT654981	hsa-miR-3674	HITS-CLIP	23824327
MIRT499428	hsa-miR-6732-3p	HITS-CLIP	24906430
MIRT499427	hsa-miR-5683	HITS-CLIP	24906430
MIRT499425	hsa-miR-504-5p	HITS-CLIP	24906430
MIRT499424	hsa-miR-383-5p	HITS-CLIP	24906430
MIRT499423	hsa-miR-6858-3p	HITS-CLIP	24906430
MIRT499422	hsa-miR-4676-5p	HITS-CLIP	24906430
MIRT499421	hsa-miR-575	HITS-CLIP	24906430
MIRT499418	hsa-miR-6890-5p	HITS-CLIP	24906430
MIRT499416	hsa-miR-1288-5p	HITS-CLIP	24906430
MIRT499415	hsa-miR-1224-3p	HITS-CLIP	24906430
MIRT499414	hsa-miR-1249-3p	HITS-CLIP	24906430
MIRT499396	hsa-miR-3194-5p	HITS-CLIP	24906430
MIRT499392	hsa-miR-6717-5p	HITS-CLIP	24906430
MIRT499391	hsa-miR-8053	HITS-CLIP	24906430
MIRT499386	hsa-miR-342-5p	HITS-CLIP	24906430
MIRT499385	hsa-miR-4664-5p	HITS-CLIP	24906430
MIRT499384	hsa-miR-4651	HITS-CLIP	24906430
MIRT499383	hsa-miR-608	HITS-CLIP	24906430
MIRT499382	hsa-miR-6747-5p	HITS-CLIP	24906430
MIRT499379	hsa-miR-542-3p	HITS-CLIP	24906430
MIRT499377	hsa-miR-6726-3p	HITS-CLIP	24906430
MIRT499374	hsa-miR-6737-5p	HITS-CLIP	24906430
MIRT499373	hsa-miR-6812-5p	HITS-CLIP	24906430
MIRT499372	hsa-miR-6819-5p	HITS-CLIP	24906430
MIRT499428	hsa-miR-6732-3p	HITS-CLIP	24906430
MIRT499427	hsa-miR-5683	HITS-CLIP	24906430
MIRT499425	hsa-miR-504-5p	HITS-CLIP	24906430
MIRT499424	hsa-miR-383-5p	HITS-CLIP	24906430
MIRT499423	hsa-miR-6858-3p	HITS-CLIP	24906430
MIRT499422	hsa-miR-4676-5p	HITS-CLIP	24906430
MIRT499421	hsa-miR-575	HITS-CLIP	24906430
MIRT499418	hsa-miR-6890-5p	HITS-CLIP	24906430
MIRT499416	hsa-miR-1288-5p	HITS-CLIP	24906430
MIRT499415	hsa-miR-1224-3p	HITS-CLIP	24906430
MIRT499414	hsa-miR-1249-3p	HITS-CLIP	24906430
MIRT499396	hsa-miR-3194-5p	HITS-CLIP	24906430
MIRT499392	hsa-miR-6717-5p	HITS-CLIP	24906430
MIRT499391	hsa-miR-8053	HITS-CLIP	24906430
MIRT499386	hsa-miR-342-5p	HITS-CLIP	24906430
MIRT499385	hsa-miR-4664-5p	HITS-CLIP	24906430
MIRT499384	hsa-miR-4651	HITS-CLIP	24906430
MIRT499383	hsa-miR-608	HITS-CLIP	24906430
MIRT499382	hsa-miR-6747-5p	HITS-CLIP	24906430
MIRT499379	hsa-miR-542-3p	HITS-CLIP	24906430
MIRT499377	hsa-miR-6726-3p	HITS-CLIP	24906430
MIRT499374	hsa-miR-6737-5p	HITS-CLIP	24906430
MIRT499373	hsa-miR-6812-5p	HITS-CLIP	24906430
MIRT499372	hsa-miR-6819-5p	HITS-CLIP	24906430
MIRT499428	hsa-miR-6732-3p	HITS-CLIP	24906430
MIRT499427	hsa-miR-5683	HITS-CLIP	24906430
MIRT499425	hsa-miR-504-5p	HITS-CLIP	24906430
MIRT499424	hsa-miR-383-5p	HITS-CLIP	24906430
MIRT499423	hsa-miR-6858-3p	HITS-CLIP	24906430
MIRT499422	hsa-miR-4676-5p	HITS-CLIP	24906430
MIRT499421	hsa-miR-575	HITS-CLIP	24906430
MIRT499418	hsa-miR-6890-5p	HITS-CLIP	24906430
MIRT499416	hsa-miR-1288-5p	HITS-CLIP	24906430
MIRT499415	hsa-miR-1224-3p	HITS-CLIP	24906430
MIRT499414	hsa-miR-1249-3p	HITS-CLIP	24906430
MIRT499396	hsa-miR-3194-5p	HITS-CLIP	24906430
MIRT499392	hsa-miR-6717-5p	HITS-CLIP	24906430
MIRT499391	hsa-miR-8053	HITS-CLIP	24906430
MIRT499386	hsa-miR-342-5p	HITS-CLIP	24906430
MIRT499385	hsa-miR-4664-5p	HITS-CLIP	24906430
MIRT499384	hsa-miR-4651	HITS-CLIP	24906430
MIRT499383	hsa-miR-608	HITS-CLIP	24906430
MIRT499382	hsa-miR-6747-5p	HITS-CLIP	24906430
MIRT499379	hsa-miR-542-3p	HITS-CLIP	24906430
MIRT499377	hsa-miR-6726-3p	HITS-CLIP	24906430
MIRT499374	hsa-miR-6737-5p	HITS-CLIP	24906430
MIRT499373	hsa-miR-6812-5p	HITS-CLIP	24906430
MIRT499372	hsa-miR-6819-5p	HITS-CLIP	24906430
MIRT499428	hsa-miR-6732-3p	HITS-CLIP	24906430
MIRT499427	hsa-miR-5683	HITS-CLIP	24906430
MIRT499425	hsa-miR-504-5p	HITS-CLIP	24906430
MIRT499424	hsa-miR-383-5p	HITS-CLIP	24906430
MIRT499423	hsa-miR-6858-3p	HITS-CLIP	24906430
MIRT499422	hsa-miR-4676-5p	HITS-CLIP	24906430
MIRT499421	hsa-miR-575	HITS-CLIP	24906430
MIRT499418	hsa-miR-6890-5p	HITS-CLIP	24906430
MIRT499416	hsa-miR-1288-5p	HITS-CLIP	24906430
MIRT499415	hsa-miR-1224-3p	HITS-CLIP	24906430
MIRT499414	hsa-miR-1249-3p	HITS-CLIP	24906430
MIRT499396	hsa-miR-3194-5p	HITS-CLIP	24906430
MIRT499392	hsa-miR-6717-5p	HITS-CLIP	24906430
MIRT499391	hsa-miR-8053	HITS-CLIP	24906430
MIRT499386	hsa-miR-342-5p	HITS-CLIP	24906430
MIRT499385	hsa-miR-4664-5p	HITS-CLIP	24906430
MIRT499384	hsa-miR-4651	HITS-CLIP	24906430
MIRT499383	hsa-miR-608	HITS-CLIP	24906430
MIRT499382	hsa-miR-6747-5p	HITS-CLIP	24906430
MIRT499379	hsa-miR-542-3p	HITS-CLIP	24906430
MIRT499377	hsa-miR-6726-3p	HITS-CLIP	24906430
MIRT499374	hsa-miR-6737-5p	HITS-CLIP	24906430
MIRT499373	hsa-miR-6812-5p	HITS-CLIP	24906430
MIRT499372	hsa-miR-6819-5p	HITS-CLIP	24906430
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	20371350
MIRT499427	hsa-miR-5683	PAR-CLIP	20371350
MIRT499425	hsa-miR-504-5p	PAR-CLIP	20371350
MIRT499424	hsa-miR-383-5p	PAR-CLIP	20371350
MIRT499423	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT499422	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT499421	hsa-miR-575	PAR-CLIP	20371350
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	20371350
MIRT499416	hsa-miR-1288-5p	PAR-CLIP	20371350
MIRT499415	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	20371350
MIRT499396	hsa-miR-3194-5p	PAR-CLIP	20371350
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	20371350
MIRT499391	hsa-miR-8053	PAR-CLIP	20371350
MIRT499386	hsa-miR-342-5p	PAR-CLIP	20371350
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	20371350
MIRT499384	hsa-miR-4651	PAR-CLIP	20371350
MIRT499383	hsa-miR-608	PAR-CLIP	20371350
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	20371350
MIRT499379	hsa-miR-542-3p	PAR-CLIP	20371350
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	20371350
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	20371350
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	20371350
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	20371350
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	22012620
MIRT499427	hsa-miR-5683	PAR-CLIP	22012620
MIRT499425	hsa-miR-504-5p	PAR-CLIP	22012620
MIRT499424	hsa-miR-383-5p	PAR-CLIP	22012620
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	22012620
MIRT499416	hsa-miR-1288-5p	PAR-CLIP	22012620
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	22012620
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	22012620
MIRT499391	hsa-miR-8053	PAR-CLIP	22012620
MIRT499386	hsa-miR-342-5p	PAR-CLIP	22012620
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	22012620
MIRT499384	hsa-miR-4651	PAR-CLIP	22012620
MIRT499383	hsa-miR-608	PAR-CLIP	22012620
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	22012620
MIRT499379	hsa-miR-542-3p	PAR-CLIP	22012620
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	22012620
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	22012620
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	22012620
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	22012620
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	23446348
MIRT499427	hsa-miR-5683	PAR-CLIP	23446348
MIRT499425	hsa-miR-504-5p	PAR-CLIP	23446348
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	23446348
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	23446348
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	23446348
MIRT499391	hsa-miR-8053	PAR-CLIP	23446348
MIRT499386	hsa-miR-342-5p	PAR-CLIP	23446348
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	23446348
MIRT499384	hsa-miR-4651	PAR-CLIP	23446348
MIRT499383	hsa-miR-608	PAR-CLIP	23446348
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	23446348
MIRT499379	hsa-miR-542-3p	PAR-CLIP	23446348
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	23446348
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	23446348
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	23446348
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	23446348
MIRT499426	hsa-miR-4802-3p	PAR-CLIP	23446348
MIRT499420	hsa-miR-4476	PAR-CLIP	23446348
MIRT499419	hsa-miR-6876-5p	PAR-CLIP	23446348
MIRT499417	hsa-miR-4717-3p	PAR-CLIP	23446348
MIRT499413	hsa-miR-6746-5p	PAR-CLIP	23446348
MIRT499412	hsa-miR-3179	PAR-CLIP	23446348
MIRT499411	hsa-miR-3126-5p	PAR-CLIP	23446348
MIRT499410	hsa-miR-6875-5p	PAR-CLIP	23446348
MIRT499409	hsa-let-7a-5p	PAR-CLIP	23446348
MIRT499408	hsa-let-7b-5p	PAR-CLIP	23446348
MIRT499407	hsa-let-7c-5p	PAR-CLIP	23446348
MIRT499406	hsa-let-7d-5p	PAR-CLIP	23446348
MIRT499405	hsa-let-7e-5p	PAR-CLIP	23446348
MIRT499404	hsa-let-7f-5p	PAR-CLIP	23446348
MIRT499403	hsa-let-7g-5p	PAR-CLIP	23446348
MIRT499402	hsa-let-7i-5p	PAR-CLIP	23446348
MIRT499401	hsa-miR-4458	PAR-CLIP	23446348
MIRT499400	hsa-miR-4500	PAR-CLIP	23446348
MIRT499399	hsa-miR-98-5p	PAR-CLIP	23446348
MIRT499398	hsa-miR-202-3p	PAR-CLIP	23446348
MIRT499397	hsa-miR-5589-3p	PAR-CLIP	23446348
MIRT499395	hsa-miR-3202	PAR-CLIP	23446348
MIRT499394	hsa-miR-1249-5p	PAR-CLIP	23446348
MIRT499393	hsa-miR-6797-5p	PAR-CLIP	23446348
MIRT499390	hsa-miR-149-3p	PAR-CLIP	23446348
MIRT499389	hsa-miR-4728-5p	PAR-CLIP	23446348
MIRT499388	hsa-miR-6785-5p	PAR-CLIP	23446348
MIRT499387	hsa-miR-6883-5p	PAR-CLIP	23446348
MIRT499381	hsa-miR-4710	PAR-CLIP	23446348
MIRT499380	hsa-miR-8065	PAR-CLIP	23446348
MIRT499378	hsa-miR-1294	PAR-CLIP	23446348
MIRT499376	hsa-miR-425-3p	PAR-CLIP	23446348
MIRT499375	hsa-miR-6771-5p	PAR-CLIP	23446348
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	24398324
MIRT499427	hsa-miR-5683	PAR-CLIP	24398324
MIRT499426	hsa-miR-4802-3p	PAR-CLIP	24398324
MIRT499425	hsa-miR-504-5p	PAR-CLIP	24398324
MIRT499424	hsa-miR-383-5p	PAR-CLIP	24398324
MIRT499423	hsa-miR-6858-3p	PAR-CLIP	24398324
MIRT499422	hsa-miR-4676-5p	PAR-CLIP	24398324
MIRT499421	hsa-miR-575	PAR-CLIP	24398324
MIRT499420	hsa-miR-4476	PAR-CLIP	24398324
MIRT499419	hsa-miR-6876-5p	PAR-CLIP	24398324
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	24398324
MIRT499417	hsa-miR-4717-3p	PAR-CLIP	24398324
MIRT499416	hsa-miR-1288-5p	PAR-CLIP	24398324
MIRT499415	hsa-miR-1224-3p	PAR-CLIP	24398324
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	24398324
MIRT499413	hsa-miR-6746-5p	PAR-CLIP	24398324
MIRT499412	hsa-miR-3179	PAR-CLIP	24398324
MIRT499411	hsa-miR-3126-5p	PAR-CLIP	24398324
MIRT499410	hsa-miR-6875-5p	PAR-CLIP	24398324
MIRT499409	hsa-let-7a-5p	PAR-CLIP	24398324
MIRT499408	hsa-let-7b-5p	PAR-CLIP	24398324
MIRT499407	hsa-let-7c-5p	PAR-CLIP	24398324
MIRT499406	hsa-let-7d-5p	PAR-CLIP	24398324
MIRT499405	hsa-let-7e-5p	PAR-CLIP	24398324
MIRT499404	hsa-let-7f-5p	PAR-CLIP	24398324
MIRT499403	hsa-let-7g-5p	PAR-CLIP	24398324
MIRT499402	hsa-let-7i-5p	PAR-CLIP	24398324
MIRT499401	hsa-miR-4458	PAR-CLIP	24398324
MIRT499400	hsa-miR-4500	PAR-CLIP	24398324
MIRT499399	hsa-miR-98-5p	PAR-CLIP	24398324
MIRT499398	hsa-miR-202-3p	PAR-CLIP	24398324
MIRT499397	hsa-miR-5589-3p	PAR-CLIP	24398324
MIRT499396	hsa-miR-3194-5p	PAR-CLIP	24398324
MIRT499395	hsa-miR-3202	PAR-CLIP	24398324
MIRT499394	hsa-miR-1249-5p	PAR-CLIP	24398324
MIRT499393	hsa-miR-6797-5p	PAR-CLIP	24398324
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	24398324
MIRT499391	hsa-miR-8053	PAR-CLIP	24398324
MIRT499390	hsa-miR-149-3p	PAR-CLIP	24398324
MIRT499389	hsa-miR-4728-5p	PAR-CLIP	24398324
MIRT499388	hsa-miR-6785-5p	PAR-CLIP	24398324
MIRT499387	hsa-miR-6883-5p	PAR-CLIP	24398324
MIRT499386	hsa-miR-342-5p	PAR-CLIP	24398324
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	24398324
MIRT499384	hsa-miR-4651	PAR-CLIP	24398324
MIRT499383	hsa-miR-608	PAR-CLIP	24398324
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	24398324
MIRT499381	hsa-miR-4710	PAR-CLIP	24398324
MIRT499380	hsa-miR-8065	PAR-CLIP	24398324
MIRT499379	hsa-miR-542-3p	PAR-CLIP	24398324
MIRT499378	hsa-miR-1294	PAR-CLIP	24398324
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	24398324
MIRT499376	hsa-miR-425-3p	PAR-CLIP	24398324
MIRT499375	hsa-miR-6771-5p	PAR-CLIP	24398324
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	24398324
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	24398324
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	24398324
MIRT499415	hsa-miR-1224-3p	PAR-CLIP	26701625
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	26701625
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	26701625
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	26701625
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	26701625
MIRT499416	hsa-miR-1288-5p	PAR-CLIP	26701625
MIRT499396	hsa-miR-3194-5p	PAR-CLIP	26701625
MIRT499386	hsa-miR-342-5p	PAR-CLIP	26701625
MIRT499386	hsa-miR-342-5p	PAR-CLIP	26701625
MIRT499386	hsa-miR-342-5p	PAR-CLIP	26701625
MIRT499386	hsa-miR-342-5p	PAR-CLIP	26701625
MIRT499424	hsa-miR-383-5p	PAR-CLIP	26701625
MIRT499384	hsa-miR-4651	PAR-CLIP	26701625
MIRT499384	hsa-miR-4651	PAR-CLIP	26701625
MIRT499384	hsa-miR-4651	PAR-CLIP	26701625
MIRT499384	hsa-miR-4651	PAR-CLIP	26701625
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	26701625
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	26701625
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	26701625
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	26701625
MIRT499422	hsa-miR-4676-5p	PAR-CLIP	26701625
MIRT499425	hsa-miR-504-5p	PAR-CLIP	26701625
MIRT499425	hsa-miR-504-5p	PAR-CLIP	26701625
MIRT499425	hsa-miR-504-5p	PAR-CLIP	26701625
MIRT499425	hsa-miR-504-5p	PAR-CLIP	26701625
MIRT499379	hsa-miR-542-3p	PAR-CLIP	26701625
MIRT499379	hsa-miR-542-3p	PAR-CLIP	26701625
MIRT499379	hsa-miR-542-3p	PAR-CLIP	26701625
MIRT499379	hsa-miR-542-3p	PAR-CLIP	26701625
MIRT499427	hsa-miR-5683	PAR-CLIP	26701625
MIRT499427	hsa-miR-5683	PAR-CLIP	26701625
MIRT499427	hsa-miR-5683	PAR-CLIP	26701625
MIRT499427	hsa-miR-5683	PAR-CLIP	26701625
MIRT499421	hsa-miR-575	PAR-CLIP	26701625
MIRT499383	hsa-miR-608	PAR-CLIP	26701625
MIRT499383	hsa-miR-608	PAR-CLIP	26701625
MIRT499383	hsa-miR-608	PAR-CLIP	26701625
MIRT499383	hsa-miR-608	PAR-CLIP	26701625
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	26701625
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	26701625
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	26701625
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	26701625
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	26701625
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	26701625
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	26701625
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	26701625
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	26701625
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	26701625
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	26701625
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	26701625
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	26701625
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	26701625
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	26701625
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	26701625
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	26701625
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	26701625
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	26701625
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	26701625
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	26701625
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	26701625
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	26701625
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	26701625
MIRT499423	hsa-miR-6858-3p	PAR-CLIP	26701625
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	26701625
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	26701625
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	26701625
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	26701625
MIRT499391	hsa-miR-8053	PAR-CLIP	26701625
MIRT499391	hsa-miR-8053	PAR-CLIP	26701625
MIRT499391	hsa-miR-8053	PAR-CLIP	26701625
MIRT499391	hsa-miR-8053	PAR-CLIP	26701625
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	27292025
MIRT499416	hsa-miR-1288-5p	PAR-CLIP	27292025
MIRT499396	hsa-miR-3194-5p	PAR-CLIP	27292025
MIRT499386	hsa-miR-342-5p	PAR-CLIP	27292025
MIRT499424	hsa-miR-383-5p	PAR-CLIP	27292025
MIRT499384	hsa-miR-4651	PAR-CLIP	27292025
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	27292025
MIRT499422	hsa-miR-4676-5p	PAR-CLIP	27292025
MIRT499425	hsa-miR-504-5p	PAR-CLIP	27292025
MIRT499379	hsa-miR-542-3p	PAR-CLIP	27292025
MIRT499427	hsa-miR-5683	PAR-CLIP	27292025
MIRT499421	hsa-miR-575	PAR-CLIP	27292025
MIRT499383	hsa-miR-608	PAR-CLIP	27292025
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	27292025
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	27292025
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	27292025
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	27292025
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	27292025
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	27292025
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	27292025
MIRT499423	hsa-miR-6858-3p	PAR-CLIP	27292025
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	27292025
MIRT499391	hsa-miR-8053	PAR-CLIP	27292025
MIRT499415	hsa-miR-1224-3p	HITS-CLIP	27418678
MIRT499414	hsa-miR-1249-3p	HITS-CLIP	27418678
MIRT499416	hsa-miR-1288-5p	HITS-CLIP	27418678
MIRT499396	hsa-miR-3194-5p	HITS-CLIP	27418678
MIRT499386	hsa-miR-342-5p	HITS-CLIP	27418678
MIRT499424	hsa-miR-383-5p	HITS-CLIP	27418678
MIRT499384	hsa-miR-4651	HITS-CLIP	27418678
MIRT499385	hsa-miR-4664-5p	HITS-CLIP	27418678
MIRT499422	hsa-miR-4676-5p	HITS-CLIP	27418678
MIRT499425	hsa-miR-504-5p	HITS-CLIP	27418678
MIRT499379	hsa-miR-542-3p	HITS-CLIP	27418678
MIRT499427	hsa-miR-5683	HITS-CLIP	27418678
MIRT499421	hsa-miR-575	HITS-CLIP	27418678
MIRT499383	hsa-miR-608	HITS-CLIP	27418678
MIRT499392	hsa-miR-6717-5p	HITS-CLIP	27418678
MIRT499377	hsa-miR-6726-3p	HITS-CLIP	27418678
MIRT499428	hsa-miR-6732-3p	HITS-CLIP	27418678
MIRT499374	hsa-miR-6737-5p	HITS-CLIP	27418678
MIRT499382	hsa-miR-6747-5p	HITS-CLIP	27418678
MIRT499373	hsa-miR-6812-5p	HITS-CLIP	27418678
MIRT499372	hsa-miR-6819-5p	HITS-CLIP	27418678
MIRT499423	hsa-miR-6858-3p	HITS-CLIP	27418678
MIRT499418	hsa-miR-6890-5p	HITS-CLIP	27418678
MIRT499391	hsa-miR-8053	HITS-CLIP	27418678
MIRT654989	hsa-miR-4680-3p	HITS-CLIP	23824327
MIRT654988	hsa-miR-4703-3p	HITS-CLIP	23824327
MIRT654987	hsa-miR-181b-2-3p	HITS-CLIP	23824327
MIRT654986	hsa-miR-181b-3p	HITS-CLIP	23824327
MIRT654985	hsa-miR-4420	HITS-CLIP	23824327
MIRT654984	hsa-miR-4452	HITS-CLIP	23824327
MIRT654983	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT654981	hsa-miR-3674	HITS-CLIP	23824327
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	20371350
MIRT499427	hsa-miR-5683	PAR-CLIP	20371350
MIRT499425	hsa-miR-504-5p	PAR-CLIP	20371350
MIRT499424	hsa-miR-383-5p	PAR-CLIP	20371350
MIRT499423	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT499422	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT499421	hsa-miR-575	PAR-CLIP	20371350
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	20371350
MIRT499416	hsa-miR-1288-5p	PAR-CLIP	20371350
MIRT499415	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	20371350
MIRT499396	hsa-miR-3194-5p	PAR-CLIP	20371350
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	20371350
MIRT499391	hsa-miR-8053	PAR-CLIP	20371350
MIRT499386	hsa-miR-342-5p	PAR-CLIP	20371350
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	20371350
MIRT499384	hsa-miR-4651	PAR-CLIP	20371350
MIRT499383	hsa-miR-608	PAR-CLIP	20371350
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	20371350
MIRT499379	hsa-miR-542-3p	PAR-CLIP	20371350
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	20371350
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	20371350
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	20371350
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	20371350
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	22012620
MIRT499427	hsa-miR-5683	PAR-CLIP	22012620
MIRT499425	hsa-miR-504-5p	PAR-CLIP	22012620
MIRT499424	hsa-miR-383-5p	PAR-CLIP	22012620
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	22012620
MIRT499416	hsa-miR-1288-5p	PAR-CLIP	22012620
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	22012620
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	22012620
MIRT499391	hsa-miR-8053	PAR-CLIP	22012620
MIRT499386	hsa-miR-342-5p	PAR-CLIP	22012620
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	22012620
MIRT499384	hsa-miR-4651	PAR-CLIP	22012620
MIRT499383	hsa-miR-608	PAR-CLIP	22012620
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	22012620
MIRT499379	hsa-miR-542-3p	PAR-CLIP	22012620
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	22012620
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	22012620
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	22012620
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	22012620
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	23446348
MIRT499427	hsa-miR-5683	PAR-CLIP	23446348
MIRT499425	hsa-miR-504-5p	PAR-CLIP	23446348
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	23446348
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	23446348
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	23446348
MIRT499391	hsa-miR-8053	PAR-CLIP	23446348
MIRT499386	hsa-miR-342-5p	PAR-CLIP	23446348
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	23446348
MIRT499384	hsa-miR-4651	PAR-CLIP	23446348
MIRT499383	hsa-miR-608	PAR-CLIP	23446348
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	23446348
MIRT499379	hsa-miR-542-3p	PAR-CLIP	23446348
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	23446348
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	23446348
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	23446348
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	23446348
MIRT499426	hsa-miR-4802-3p	PAR-CLIP	23446348
MIRT499420	hsa-miR-4476	PAR-CLIP	23446348
MIRT499419	hsa-miR-6876-5p	PAR-CLIP	23446348
MIRT499417	hsa-miR-4717-3p	PAR-CLIP	23446348
MIRT499413	hsa-miR-6746-5p	PAR-CLIP	23446348
MIRT499412	hsa-miR-3179	PAR-CLIP	23446348
MIRT499411	hsa-miR-3126-5p	PAR-CLIP	23446348
MIRT499410	hsa-miR-6875-5p	PAR-CLIP	23446348
MIRT499409	hsa-let-7a-5p	PAR-CLIP	23446348
MIRT499408	hsa-let-7b-5p	PAR-CLIP	23446348
MIRT499407	hsa-let-7c-5p	PAR-CLIP	23446348
MIRT499406	hsa-let-7d-5p	PAR-CLIP	23446348
MIRT499405	hsa-let-7e-5p	PAR-CLIP	23446348
MIRT499404	hsa-let-7f-5p	PAR-CLIP	23446348
MIRT499403	hsa-let-7g-5p	PAR-CLIP	23446348
MIRT499402	hsa-let-7i-5p	PAR-CLIP	23446348
MIRT499401	hsa-miR-4458	PAR-CLIP	23446348
MIRT499400	hsa-miR-4500	PAR-CLIP	23446348
MIRT499399	hsa-miR-98-5p	PAR-CLIP	23446348
MIRT499398	hsa-miR-202-3p	PAR-CLIP	23446348
MIRT499397	hsa-miR-5589-3p	PAR-CLIP	23446348
MIRT499395	hsa-miR-3202	PAR-CLIP	23446348
MIRT499394	hsa-miR-1249-5p	PAR-CLIP	23446348
MIRT499393	hsa-miR-6797-5p	PAR-CLIP	23446348
MIRT499390	hsa-miR-149-3p	PAR-CLIP	23446348
MIRT499389	hsa-miR-4728-5p	PAR-CLIP	23446348
MIRT499388	hsa-miR-6785-5p	PAR-CLIP	23446348
MIRT499387	hsa-miR-6883-5p	PAR-CLIP	23446348
MIRT499381	hsa-miR-4710	PAR-CLIP	23446348
MIRT499380	hsa-miR-8065	PAR-CLIP	23446348
MIRT499378	hsa-miR-1294	PAR-CLIP	23446348
MIRT499376	hsa-miR-425-3p	PAR-CLIP	23446348
MIRT499375	hsa-miR-6771-5p	PAR-CLIP	23446348
MIRT499428	hsa-miR-6732-3p	PAR-CLIP	24398324
MIRT499427	hsa-miR-5683	PAR-CLIP	24398324
MIRT499426	hsa-miR-4802-3p	PAR-CLIP	24398324
MIRT499425	hsa-miR-504-5p	PAR-CLIP	24398324
MIRT499424	hsa-miR-383-5p	PAR-CLIP	24398324
MIRT499423	hsa-miR-6858-3p	PAR-CLIP	24398324
MIRT499422	hsa-miR-4676-5p	PAR-CLIP	24398324
MIRT499421	hsa-miR-575	PAR-CLIP	24398324
MIRT499420	hsa-miR-4476	PAR-CLIP	24398324
MIRT499419	hsa-miR-6876-5p	PAR-CLIP	24398324
MIRT499418	hsa-miR-6890-5p	PAR-CLIP	24398324
MIRT499417	hsa-miR-4717-3p	PAR-CLIP	24398324
MIRT499416	hsa-miR-1288-5p	PAR-CLIP	24398324
MIRT499415	hsa-miR-1224-3p	PAR-CLIP	24398324
MIRT499414	hsa-miR-1249-3p	PAR-CLIP	24398324
MIRT499413	hsa-miR-6746-5p	PAR-CLIP	24398324
MIRT499412	hsa-miR-3179	PAR-CLIP	24398324
MIRT499411	hsa-miR-3126-5p	PAR-CLIP	24398324
MIRT499410	hsa-miR-6875-5p	PAR-CLIP	24398324
MIRT499409	hsa-let-7a-5p	PAR-CLIP	24398324
MIRT499408	hsa-let-7b-5p	PAR-CLIP	24398324
MIRT499407	hsa-let-7c-5p	PAR-CLIP	24398324
MIRT499406	hsa-let-7d-5p	PAR-CLIP	24398324
MIRT499405	hsa-let-7e-5p	PAR-CLIP	24398324
MIRT499404	hsa-let-7f-5p	PAR-CLIP	24398324
MIRT499403	hsa-let-7g-5p	PAR-CLIP	24398324
MIRT499402	hsa-let-7i-5p	PAR-CLIP	24398324
MIRT499401	hsa-miR-4458	PAR-CLIP	24398324
MIRT499400	hsa-miR-4500	PAR-CLIP	24398324
MIRT499399	hsa-miR-98-5p	PAR-CLIP	24398324
MIRT499398	hsa-miR-202-3p	PAR-CLIP	24398324
MIRT499397	hsa-miR-5589-3p	PAR-CLIP	24398324
MIRT499396	hsa-miR-3194-5p	PAR-CLIP	24398324
MIRT499395	hsa-miR-3202	PAR-CLIP	24398324
MIRT499394	hsa-miR-1249-5p	PAR-CLIP	24398324
MIRT499393	hsa-miR-6797-5p	PAR-CLIP	24398324
MIRT499392	hsa-miR-6717-5p	PAR-CLIP	24398324
MIRT499391	hsa-miR-8053	PAR-CLIP	24398324
MIRT499390	hsa-miR-149-3p	PAR-CLIP	24398324
MIRT499389	hsa-miR-4728-5p	PAR-CLIP	24398324
MIRT499388	hsa-miR-6785-5p	PAR-CLIP	24398324
MIRT499387	hsa-miR-6883-5p	PAR-CLIP	24398324
MIRT499386	hsa-miR-342-5p	PAR-CLIP	24398324
MIRT499385	hsa-miR-4664-5p	PAR-CLIP	24398324
MIRT499384	hsa-miR-4651	PAR-CLIP	24398324
MIRT499383	hsa-miR-608	PAR-CLIP	24398324
MIRT499382	hsa-miR-6747-5p	PAR-CLIP	24398324
MIRT499381	hsa-miR-4710	PAR-CLIP	24398324
MIRT499380	hsa-miR-8065	PAR-CLIP	24398324
MIRT499379	hsa-miR-542-3p	PAR-CLIP	24398324
MIRT499378	hsa-miR-1294	PAR-CLIP	24398324
MIRT499377	hsa-miR-6726-3p	PAR-CLIP	24398324
MIRT499376	hsa-miR-425-3p	PAR-CLIP	24398324
MIRT499375	hsa-miR-6771-5p	PAR-CLIP	24398324
MIRT499374	hsa-miR-6737-5p	PAR-CLIP	24398324
MIRT499373	hsa-miR-6812-5p	PAR-CLIP	24398324
MIRT499372	hsa-miR-6819-5p	PAR-CLIP	24398324
MIRT2297703	hsa-miR-4643	CLIP-seq

Gene ontology (GO) Show/Hide all (126)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001775	Process	Cell activation	IEA
GO:0001775	Process	Cell activation	ISS
GO:0001784	Function	Phosphotyrosine residue binding	IPI	20624904
GO:0001878	Process	Response to yeast	IEA
GO:0001878	Process	Response to yeast	ISS
GO:0002092	Process	Positive regulation of receptor internalization	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	ISS
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002224	Process	Toll-like receptor signaling pathway	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	ISS
GO:0002281	Process	Macrophage activation involved in immune response	IEA
GO:0002281	Process	Macrophage activation involved in immune response	ISS
GO:0002316	Process	Follicular B cell differentiation	IEA
GO:0002732	Process	Positive regulation of dendritic cell cytokine production	IEA
GO:0002732	Process	Positive regulation of dendritic cell cytokine production	ISS
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	IBA
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	IDA	11606584, 12181444
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	IEA
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	IMP	32514138
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	TAS
GO:0004629	Function	Phospholipase C activity	TAS
GO:0005515	Function	Protein binding	IPI	15644415, 16273093, 24642916, 24658140, 24728074, 25241761, 25814554, 31980649, 33961781, 35512704
GO:0005737	Component	Cytoplasm	IDA	11331309
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	11331309, 11606584
GO:0005886	Component	Plasma membrane	IDA	11606584
GO:0005886	Component	Plasma membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006661	Process	Phosphatidylinositol biosynthetic process	IDA	11606584, 12181444
GO:0007165	Process	Signal transduction	IEA
GO:0008081	Function	Phosphoric diester hydrolase activity	IEA
GO:0009395	Process	Phospholipid catabolic process	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	32514138
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010634	Process	Positive regulation of epithelial cell migration	IBA
GO:0012501	Process	Programmed cell death	IEA
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016055	Process	Wnt signaling pathway	TAS	18784435
GO:0016787	Function	Hydrolase activity	IEA
GO:0019216	Process	Regulation of lipid metabolic process	IMP	32514138
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0019722	Process	Calcium-mediated signaling	IMP	11606584
GO:0019722	Process	Calcium-mediated signaling	NAS	11043765
GO:0019901	Function	Protein kinase binding	IPI	11606584
GO:0030168	Process	Platelet activation	TAS
GO:0030183	Process	B cell differentiation	IEA
GO:0030183	Process	B cell differentiation	ISS
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IMP	32514138
GO:0032481	Process	Positive regulation of type I interferon production	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032587	Component	Ruffle membrane	IBA
GO:0032587	Component	Ruffle membrane	IDA	11331309
GO:0032587	Component	Ruffle membrane	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	ISS
GO:0032747	Process	Positive regulation of interleukin-23 production	IEA
GO:0032747	Process	Positive regulation of interleukin-23 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0032959	Process	Inositol trisphosphate biosynthetic process	IEA
GO:0035556	Process	Intracellular signal transduction	IDA	11606584, 14656219
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	IMP	32514138
GO:0035556	Process	Intracellular signal transduction	ISS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	IEA
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042113	Process	B cell activation	IDA	30107486
GO:0043069	Process	Negative regulation of programmed cell death	IEA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IEA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0046488	Process	Phosphatidylinositol metabolic process	IBA
GO:0048015	Process	Phosphatidylinositol-mediated signaling	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	23555801
GO:0048678	Process	Response to axon injury	IMP	32514138
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	ISS
GO:0050851	Process	Antigen receptor-mediated signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	ISS
GO:0050853	Process	B cell receptor signaling pathway	IDA	15509800
GO:0050853	Process	B cell receptor signaling pathway	IEA
GO:0050853	Process	B cell receptor signaling pathway	IMP	11606584
GO:0050853	Process	B cell receptor signaling pathway	ISS
GO:0050853	Process	B cell receptor signaling pathway	TAS	23555801
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IBA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IDA	11606584
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IEA
GO:0051282	Process	Regulation of sequestering of calcium ion	IEA
GO:0060100	Process	Positive regulation of phagocytosis, engulfment	IMP	32514138
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	ISS
GO:0061760	Process	Antifungal innate immune response	IEA
GO:0061760	Process	Antifungal innate immune response	ISS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070884	Process	Regulation of calcineurin-NFAT signaling cascade	IEA
GO:0070884	Process	Regulation of calcineurin-NFAT signaling cascade	ISS
GO:0071277	Process	Cellular response to calcium ion	IMP	11606584
GO:0071396	Process	Cellular response to lipid	IMP	32514138
GO:0097110	Function	Scaffold protein binding	IPI	11606584, 23555801
GO:0097708	Component	Intracellular vesicle	IDA	11331309
GO:0140031	Function	Phosphorylation-dependent protein binding	IEA
GO:0150078	Process	Positive regulation of neuroinflammatory response	IMP	32514138
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IMP	32514138
GO:1902533	Process	Positive regulation of intracellular signal transduction	ISS
GO:1902808	Process	Positive regulation of cell cycle G1/S phase transition	ISS
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	IEA
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	ISS
GO:1990782	Function	Protein tyrosine kinase binding	IPI	32514138
GO:1990858	Process	Cellular response to lectin	IEA
GO:1990858	Process	Cellular response to lectin	ISS

Other IDs

• MIM: 600220
• HGNC: 9066
• e!Ensembl: ENSG00000197943

Protein

• UniProt ID: P16885
• Protein name: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 (EC 3.1.4.11) (Phosphoinositide phospholipase C-gamma-2) (Phospholipase C-IV) (PLC-IV) (Phospholipase C-gamma-2) (PLC-gamma-2)
• Protein function: The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. It is a crucial enzyme in transmembrane signaling. {ECO:
• PDB: 2K2J , 2W2W , 2W2X , 8JQG , 8JQH , 8JQI , 8T7C
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00017	SH2	532 → 617	SH2 domain	Domain
  PF00017	SH2	646 → 720	SH2 domain	Domain
  PF00018	SH3_1	775 → 821	SH3 domain	Domain
  PF00168	C2	1061 → 1168	C2 domain	Domain
  PF00387	PI-PLC-Y	930 → 1042	Phosphatidylinositol-specific phospholipase C, Y domain	Family
  PF00388	PI-PLC-X	314 → 457	Phosphatidylinositol-specific phospholipase C, X domain	Family

• Sequence:

  MSTTVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
  IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAV
  NWLSGLKILHQEAMNASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSA
  KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
  VYLHDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
  IWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELDC
  WDGPDGKPVIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCSVEQQRHMAKA
  FKEVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
  LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKKVEKR
  TSAEKLLQEYCMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYY
  LTDNLTFSSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDML
  MRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
  EKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
  KAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADFEELEKQII
  EDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDRVEELFEWF
  QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
  TKADSIIRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKY
  MQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
  ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPIWAPTQEKVTFEIYDPNLAFLRFVVYEED
  MFSDPNFLAHATYPIKAVKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
  RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFSVNENQLQLYQEKCNKRLREKRVSN
  SKFYS

• Sequence length: 1265

Pathways

KEGG Pathway	Reactome Pathway
Inositol phosphate metabolism	GPVI-mediated activation cascade
Metabolic pathways	Toll Like Receptor 4 (TLR4) Cascade
EGFR tyrosine kinase inhibitor resistance	Synthesis of IP3 and IP4 in the cytosol
ErbB signaling pathway	Generation of second messenger molecules
Ras signaling pathway	Role of phospholipids in phagocytosis
Calcium signaling pathway	DAP12 signaling
Chemokine signaling pathway	FCERI mediated MAPK activation
NF-kappa B signaling pathway	FCERI mediated Ca+2 mobilization
HIF-1 signaling pathway	CLEC7A (Dectin-1) signaling
Phosphatidylinositol signaling system	Dectin-2 family
Phospholipase D signaling pathway	FCGR3A-mediated IL10 synthesis
Axon guidance	Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
VEGF signaling pathway
Osteoclast differentiation
Platelet activation
Neutrophil extracellular trap formation
C-type lectin receptor signaling pathway
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
Thyroid hormone signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Growth hormone synthesis, secretion and action
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Kaposi sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Hepatocellular carcinoma

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autoinflammation-PLCG2-associated antibody deficiency-immune dysregulation	Likely pathogenic; Pathogenic	rs2143682648, rs2143705605, rs397514562	RCV001650513 RCV002260534 RCV000032898	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial cold autoinflammatory syndrome 3	Likely pathogenic; Pathogenic	rs753618006, rs746749620, rs1381167403	RCV001824263 RCV002305070 RCV001227511	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (40)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Benign; Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	34099642, 35379992, 37198259, 37985413	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	40962958	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATION, ANTIBODY DEFICIENCY, AND IMMUNE DYSREGULATION	—	CTD, HPO CTD, HPO	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATION, ANTIBODY DEFICIENCY, AND IMMUNE DYSREGULATION, PLCG2-ASSOCIATED	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	24080446	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clonal Cytopenia of Undetermined Significance	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	38538606	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COR PULMONALE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	29212778, 33020668, 36474045	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	28067908, 37156999	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRYOPYRIN-ASSOCIATED PERIODIC SYNDROMES	—	CTD, Disgenet CTD, Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cold autoinflammatory syndrome	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance; Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	28067908, 37156999	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	28067908	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	28714976	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	27542411	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	33532862, 38072966	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	37033223	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLCG2-related disorder	Likely benign; Uncertain significance; Benign; Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Recurrent fever	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	38317187	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	38162683	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	37033223	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	28067908, 37156999	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	31420334, 31676865, 35285134, 36777996, 38561338	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (122)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	28714976		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27758892		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	18784435		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	25012946		★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	Pubtator	32671674	Associate	★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	31560769		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	28714976, 30258121, 30326945, 31131421, 32166339, 32894242, 33092647, 33239300, 34099642, 34615897, 35895133, 36530083, 36933698, 40528303	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	33092647	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	28714976		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	28714976		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	30711010		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	28714976		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	28714976		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	31131421	Associate	★☆☆☆☆ Found in Text Mining only
Anovulation	Anovulation	Pubtator	40287692	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	25993291	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	36113963	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	32186396	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	35773312	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22236196, 31633221		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	22236196, 36933698	Associate	★☆☆☆☆ Found in Text Mining only
AUTOINFLAMMATION, ANTIBODY DEFICIENCY, AND IMMUNE DYSREGULATION, PLCG2-ASSOCIATED	Autoinflammation, Antibody Deficiency, And Immune Dysregulation	GENOMICS_ENGLAND_DG	22236196, 23000145, 29538758		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATION, ANTIBODY DEFICIENCY, AND IMMUNE DYSREGULATION, PLCG2-ASSOCIATED	Autoinflammation, Antibody Deficiency, And Immune Dysregulation	ORPHANET_DG	23000145		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATION, ANTIBODY DEFICIENCY, AND IMMUNE DYSREGULATION, PLCG2-ASSOCIATED	Autoinflammation, Antibody Deficiency, And Immune Dysregulation	UNIPROT_DG	23000145		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATION, ANTIBODY DEFICIENCY, AND IMMUNE DYSREGULATION, PLCG2-ASSOCIATED	Autoinflammation, Antibody Deficiency, And Immune Dysregulation	BEFREE	30619256		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATION, ANTIBODY DEFICIENCY, AND IMMUNE DYSREGULATION, PLCG2-ASSOCIATED	Autoinflammation, Antibody Deficiency, And Immune Dysregulation	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATION, ANTIBODY DEFICIENCY, AND IMMUNE DYSREGULATION, PLCG2-ASSOCIATED	Autoinflammation, Antibody Deficiency, And Immune Dysregulation	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoinflammation-PLCG2-associated antibody deficiency-immune dysregulation	Autoinflammation, Antibody Deficiency, And Immune Dysregulation	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autoinflammatory disorder	Autoinflammatory Disease	GENOMICS_ENGLAND_DG	29538758		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	20525309, 29436605, 31163690, 31889510	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24080446, 26275715		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	24080446	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	28465297	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	29371955		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	36253891	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35276058, 36530957	Associate	★☆☆☆☆ Found in Text Mining only
Cherubism	Cherubism	BEFREE	24916406		★☆☆☆☆ Found in Text Mining only
Chronic Infantile Neurological, Cutaneous, and Articular Syndrome	Neurological, Cutaneous And Articular Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17804547, 24489640, 24869598, 25972157, 26182309, 27542411, 27903679, 28049639, 28212557, 29381098, 29484684, 31014395, 31180577, 31243043		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CLINVAR_DG	24869598		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CTD_human_DG	27542411		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	32166339, 36530083, 36933698	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	31853824, 32047491, 33859323	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	29538758		★☆☆☆☆ Found in Text Mining only
Cryopyrin-Associated Periodic Syndromes	Cryopyrin-Associated Periodic Syndromes	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cutis Laxa	Cutis Laxa	BEFREE	30619256		★☆☆☆☆ Found in Text Mining only
Cutis Laxa	Cutis laxa	Pubtator	30619256	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	31131421	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	30429375		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22344559	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25012946, 29496671		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	29733744		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	28714976		★☆☆☆☆ Found in Text Mining only
Familial Cold Autoinflammatory Syndrome 1	Cold Autoinflammatory Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
FAMILIAL COLD AUTOINFLAMMATORY SYNDROME 3	Cold Autoinflammatory Syndrome	ORPHANET_DG	22236196, 23000145		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
FAMILIAL COLD AUTOINFLAMMATORY SYNDROME 3	Cold Autoinflammatory Syndrome	GENOMICS_ENGLAND_DG	23000145, 29538758		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial cold urticaria	Cold urticaria	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	31131421	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	37616163	Associate	★☆☆☆☆ Found in Text Mining only
Genetic Predisposition to Disease	Genetic predisposition to disease	Pubtator	30508305	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	37989267	Stimulate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	36033826	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12881301, 28791394	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	30711010		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	28067908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	28067908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	36113963	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasm	Kidney Neoplasm	BEFREE	23155228		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	36033826	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27758892		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	30326945		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	30326945, 31131421, 33092647	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31310377		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37031207	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36180106	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	15744341		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	36994552	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	31560769, 32631374	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24080446, 26275715		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29972810		★☆☆☆☆ Found in Text Mining only
Muckle-Wells Syndrome	Muckle-Wells Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	30326945	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	30787430	Associate	★☆☆☆☆ Found in Text Mining only
Myoclonic dystonia	Myoclonic dystonia	Pubtator	35773312	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31549850		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	18784435		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	25349203	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30326945, 31131421, 38061598	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30326945, 31131421		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30658193	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	21749368, 28272351		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	21749368		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26096802		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35120576	Associate	★☆☆☆☆ Found in Text Mining only
PLCG2-associated antibody deficiency and immune dysregulation	Antibody Deficiency And Immune Dysregulation	ORPHANET_DG	22236196, 23000145		★☆☆☆☆ Found in Text Mining only
PLCG2-associated antibody deficiency and immune dysregulation	Antibody Deficiency And Immune Dysregulation	Orphanet			★☆☆☆☆ Found in Text Mining only
PLCG2-associated antibody deficiency and immune dysregulation	Antibody Deficiency And Immune Dysregulation	BEFREE	25760457, 31633221		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	33224973, 37226082, 40287692	Associate	★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	28714976		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	30326945		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28210261		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	33725976	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	34653364	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	38223749	Associate	★☆☆☆☆ Found in Text Mining only
Steroid-sensitive nephrotic syndrome	Steroid-Sensitive Nephrotic Syndrome	BEFREE	25349203, 30568185		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	14606067		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	14606067	Associate	★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	30326945, 33092647	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	22236196	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	28067908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urticaria	Urticaria	Pubtator	23000145	Associate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	31420334, 37537391	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	HPO_DG			★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	29496671		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	30402490	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

NLRC4 2 shared diseasesCryopyrin-associated periodic syndrome, Cold autoinflammatory syndrome 1 shared pathwayShigellosis 5 shared evidence sourcesCTD (Cryopyrin-associated periodic syndrome), Disgenet (Cryopyrin-associated periodic syndrome), Disgenet (Cold autoinflammatory syndrome), ClinVar (Cold autoinflammatory syndrome), HPO (Cold autoinflammatory syndrome) Related via 2 shared diseases including Cryopyrin-associated periodic syndrome, Cold autoinflammatory syndrome — evidence mostly Disgenet. TSPAN15 2 shared diseasesCor pulmonale, Heart disease 3 shared evidence sourcesGWAS catalog (Cor pulmonale), GWAS catalog (Heart disease), GWAS catalog (Stroke) Related via 2 shared diseases including Cor pulmonale, Heart disease — evidence mostly GWAS catalog. PROCR 2 shared diseasesCor pulmonale, Heart disease 3 shared evidence sourcesGWAS catalog (Cor pulmonale), GWAS catalog (Heart disease), GWAS catalog (Stroke) Related via 2 shared diseases including Cor pulmonale, Heart disease — evidence mostly GWAS catalog. SLC44A2 2 shared diseasesCor pulmonale, Heart disease 3 shared evidence sourcesGWAS catalog (Cor pulmonale), GWAS catalog (Heart disease), GWAS catalog (Stroke) Related via 2 shared diseases including Cor pulmonale, Heart disease — evidence mostly GWAS catalog. MYO7B 2 shared diseasesCor pulmonale, Heart disease 2 shared evidence sourcesGWAS catalog (Cor pulmonale), GWAS catalog (Heart disease) Related via 2 shared diseases including Cor pulmonale, Heart disease — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
NLRC4	2	["Cryopyrin-associated periodic syndrome","Cold autoinflammatory syndrome"]	1	["Shigellosis"]	5	["CTD (Cryopyrin-associated periodic syndrome)","Disgenet (Cryopyrin-associated periodic syndrome)","Disgenet (Cold autoinflammatory syndrome)","ClinVar (Cold autoinflammatory syndrome)","HPO (Cold autoinflammatory syndrome)"]
TSPAN15	2	["Cor pulmonale","Heart disease"]	0	[]	3	["GWAS catalog (Cor pulmonale)","GWAS catalog (Heart disease)","GWAS catalog (Stroke)"]
PROCR	2	["Cor pulmonale","Heart disease"]	0	[]	3	["GWAS catalog (Cor pulmonale)","GWAS catalog (Heart disease)","GWAS catalog (Stroke)"]
SLC44A2	2	["Cor pulmonale","Heart disease"]	0	[]	3	["GWAS catalog (Cor pulmonale)","GWAS catalog (Heart disease)","GWAS catalog (Stroke)"]
MYO7B	2	["Cor pulmonale","Heart disease"]	0	[]	2	["GWAS catalog (Cor pulmonale)","GWAS catalog (Heart disease)"]

Diseases Linked via Similar Genes

Thromboembolic pulmonary hypertension Linked via 2 of 5 related genesTSPAN15, SLC44A2 Autoinflammation with infantile enterocolitis Linked via 1 of 5 related genesNLRC4 Autoinflammatory syndrome Linked via 1 of 5 related genesNLRC4 Insomnia Linked via 1 of 5 related genesTSPAN15 Basal cell carcinoma Linked via 1 of 5 related genesPROCR

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Thromboembolic pulmonary hypertension	2	["TSPAN15","SLC44A2"]
Autoinflammation with infantile enterocolitis	1	["NLRC4"]
Autoinflammatory syndrome	1	["NLRC4"]
Insomnia	1	["TSPAN15"]
Basal cell carcinoma	1	["PROCR"]