Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	6850
Gene name	Spleen associated tyrosine kinase
Gene symbol	SYK
Synonyms (NCBI Gene)	IMD82p72-Syk
Chromosome	9
Chromosome location	9q22.2
Summary	This gene encodes a member of the family of non-receptor type Tyr protein kinases. This protein is widely expressed in hematopoietic cells and is involved in coupling activated immunoreceptors to downstream signaling events that mediate diverse cellular r

357 Show/Hide all (357)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043443	hsa-miR-331-3p	CLASH	23622248
MIRT040474	hsa-miR-615-3p	CLASH	23622248
MIRT038521	hsa-miR-99b-3p	CLASH	23622248
MIRT709777	hsa-miR-4766-5p	HITS-CLIP	19536157
MIRT709775	hsa-miR-3182	HITS-CLIP	19536157
MIRT709776	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT717204	hsa-miR-5190	HITS-CLIP	19536157
MIRT709777	hsa-miR-4766-5p	HITS-CLIP	19536157
MIRT709775	hsa-miR-3182	HITS-CLIP	19536157
MIRT709776	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT709777	hsa-miR-4766-5p	HITS-CLIP	19536157
MIRT709775	hsa-miR-3182	HITS-CLIP	19536157
MIRT709776	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT709777	hsa-miR-4766-5p	HITS-CLIP	19536157
MIRT709775	hsa-miR-3182	HITS-CLIP	19536157
MIRT709776	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT608324	hsa-miR-4740-3p	HITS-CLIP	23824327
MIRT608322	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT608321	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT608319	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT679140	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT679139	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT679138	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT608320	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT608318	hsa-miR-1976	HITS-CLIP	23824327
MIRT608314	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT679137	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT679136	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT679135	hsa-miR-1468-5p	HITS-CLIP	23824327
MIRT679134	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT679133	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT608310	hsa-miR-4279	HITS-CLIP	23824327
MIRT679132	hsa-miR-498	HITS-CLIP	23824327
MIRT679131	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT679130	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT608324	hsa-miR-4740-3p	HITS-CLIP	24906430
MIRT608322	hsa-miR-4722-3p	HITS-CLIP	24906430
MIRT608321	hsa-miR-6727-3p	HITS-CLIP	24906430
MIRT608319	hsa-miR-6747-3p	HITS-CLIP	24906430
MIRT608320	hsa-miR-3653-5p	HITS-CLIP	24906430
MIRT608318	hsa-miR-1976	HITS-CLIP	24906430
MIRT608314	hsa-miR-6778-3p	HITS-CLIP	24906430
MIRT608315	hsa-miR-3199	HITS-CLIP	24906430
MIRT608313	hsa-miR-8052	HITS-CLIP	24906430
MIRT608312	hsa-miR-365a-5p	HITS-CLIP	24906430
MIRT608311	hsa-miR-365b-5p	HITS-CLIP	24906430
MIRT608310	hsa-miR-4279	HITS-CLIP	24906430
MIRT608323	hsa-miR-4643	HITS-CLIP	24906430
MIRT608324	hsa-miR-4740-3p	HITS-CLIP	24906430
MIRT608322	hsa-miR-4722-3p	HITS-CLIP	24906430
MIRT608321	hsa-miR-6727-3p	HITS-CLIP	24906430
MIRT608319	hsa-miR-6747-3p	HITS-CLIP	24906430
MIRT608320	hsa-miR-3653-5p	HITS-CLIP	24906430
MIRT608318	hsa-miR-1976	HITS-CLIP	24906430
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	24906430
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	24906430
MIRT608314	hsa-miR-6778-3p	HITS-CLIP	24906430
MIRT608315	hsa-miR-3199	HITS-CLIP	24906430
MIRT608313	hsa-miR-8052	HITS-CLIP	24906430
MIRT608312	hsa-miR-365a-5p	HITS-CLIP	24906430
MIRT608311	hsa-miR-365b-5p	HITS-CLIP	24906430
MIRT608310	hsa-miR-4279	HITS-CLIP	24906430
MIRT732575	hsa-miR-1269a	MicroarrayqRT-PCR	34258170
MIRT733940	hsa-miR-27a-3p	Luciferase reporter assayqRT-PCR	33402173
MIRT709777	hsa-miR-4766-5p	HITS-CLIP	19536157
MIRT709775	hsa-miR-3182	HITS-CLIP	19536157
MIRT709776	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT717204	hsa-miR-5190	HITS-CLIP	19536157
MIRT709777	hsa-miR-4766-5p	HITS-CLIP	19536157
MIRT709775	hsa-miR-3182	HITS-CLIP	19536157
MIRT709776	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT709777	hsa-miR-4766-5p	HITS-CLIP	19536157
MIRT709775	hsa-miR-3182	HITS-CLIP	19536157
MIRT709776	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT709777	hsa-miR-4766-5p	HITS-CLIP	19536157
MIRT709775	hsa-miR-3182	HITS-CLIP	19536157
MIRT709776	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT608317	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT608316	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT608324	hsa-miR-4740-3p	HITS-CLIP	23824327
MIRT608322	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT608321	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT608319	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT679140	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT679139	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT679138	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT608320	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT608318	hsa-miR-1976	HITS-CLIP	23824327
MIRT608314	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT679137	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT679136	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT679135	hsa-miR-1468-5p	HITS-CLIP	23824327
MIRT679134	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT679133	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT608310	hsa-miR-4279	HITS-CLIP	23824327
MIRT679132	hsa-miR-498	HITS-CLIP	23824327
MIRT679131	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT679130	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT1405255	hsa-miR-1225-5p	CLIP-seq
MIRT1405256	hsa-miR-1238	CLIP-seq
MIRT1405257	hsa-miR-1299	CLIP-seq
MIRT1405258	hsa-miR-136	CLIP-seq
MIRT1405259	hsa-miR-219-5p	CLIP-seq
MIRT1405260	hsa-miR-23a	CLIP-seq
MIRT1405261	hsa-miR-23b	CLIP-seq
MIRT1405262	hsa-miR-23c	CLIP-seq
MIRT1405263	hsa-miR-2861	CLIP-seq
MIRT1405264	hsa-miR-3125	CLIP-seq
MIRT1405265	hsa-miR-324-5p	CLIP-seq
MIRT1405266	hsa-miR-370	CLIP-seq
MIRT1405267	hsa-miR-3916	CLIP-seq
MIRT1405268	hsa-miR-4312	CLIP-seq
MIRT1405269	hsa-miR-4445	CLIP-seq
MIRT1405270	hsa-miR-4453	CLIP-seq
MIRT1405271	hsa-miR-4512	CLIP-seq
MIRT1405272	hsa-miR-4538	CLIP-seq
MIRT1405273	hsa-miR-4646-3p	CLIP-seq
MIRT1405274	hsa-miR-4687-3p	CLIP-seq
MIRT1405275	hsa-miR-4764-5p	CLIP-seq
MIRT1405276	hsa-miR-4779	CLIP-seq
MIRT1405277	hsa-miR-4782-3p	CLIP-seq
MIRT1405278	hsa-miR-4782-5p	CLIP-seq
MIRT1405279	hsa-miR-508-3p	CLIP-seq
MIRT1405280	hsa-miR-5096	CLIP-seq
MIRT1405281	hsa-miR-511	CLIP-seq
MIRT1405282	hsa-miR-515-5p	CLIP-seq
MIRT1405283	hsa-miR-516b	CLIP-seq
MIRT1405284	hsa-miR-548u	CLIP-seq
MIRT1405285	hsa-miR-617	CLIP-seq
MIRT1405286	hsa-miR-626	CLIP-seq
MIRT1405287	hsa-miR-877	CLIP-seq
MIRT1405288	hsa-miR-106a	CLIP-seq
MIRT1405289	hsa-miR-106b	CLIP-seq
MIRT1405290	hsa-miR-1185	CLIP-seq
MIRT1405291	hsa-miR-1234	CLIP-seq
MIRT1405292	hsa-miR-1252	CLIP-seq
MIRT1405293	hsa-miR-1262	CLIP-seq
MIRT1405294	hsa-miR-1266	CLIP-seq
MIRT1405295	hsa-miR-1273f	CLIP-seq
MIRT1405296	hsa-miR-129-5p	CLIP-seq
MIRT1405257	hsa-miR-1299	CLIP-seq
MIRT1405297	hsa-miR-1321	CLIP-seq
MIRT1405298	hsa-miR-1323	CLIP-seq
MIRT1405299	hsa-miR-143	CLIP-seq
MIRT1405300	hsa-miR-17	CLIP-seq
MIRT1405301	hsa-miR-186	CLIP-seq
MIRT1405302	hsa-miR-2052	CLIP-seq
MIRT1405303	hsa-miR-20a	CLIP-seq
MIRT1405304	hsa-miR-20b	CLIP-seq
MIRT1405259	hsa-miR-219-5p	CLIP-seq
MIRT1405305	hsa-miR-24	CLIP-seq
MIRT1405306	hsa-miR-2467-3p	CLIP-seq
MIRT1405307	hsa-miR-2467-5p	CLIP-seq
MIRT1405308	hsa-miR-302a	CLIP-seq
MIRT1405309	hsa-miR-302b	CLIP-seq
MIRT1405310	hsa-miR-302c	CLIP-seq
MIRT1405311	hsa-miR-302d	CLIP-seq
MIRT1405312	hsa-miR-302e	CLIP-seq
MIRT1405313	hsa-miR-3120-3p	CLIP-seq
MIRT1405314	hsa-miR-3120-5p	CLIP-seq
MIRT1405315	hsa-miR-3121-5p	CLIP-seq
MIRT1405316	hsa-miR-3133	CLIP-seq
MIRT1405317	hsa-miR-3159	CLIP-seq
MIRT1405318	hsa-miR-320e	CLIP-seq
MIRT1405319	hsa-miR-335	CLIP-seq
MIRT1405320	hsa-miR-3605-5p	CLIP-seq
MIRT1405321	hsa-miR-3609	CLIP-seq
MIRT1405322	hsa-miR-3664-3p	CLIP-seq
MIRT1405323	hsa-miR-3677-5p	CLIP-seq
MIRT1405324	hsa-miR-3679-5p	CLIP-seq
MIRT1405325	hsa-miR-3689d	CLIP-seq
MIRT1405326	hsa-miR-372	CLIP-seq
MIRT1405327	hsa-miR-373	CLIP-seq
MIRT1405328	hsa-miR-4268	CLIP-seq
MIRT1405329	hsa-miR-4270	CLIP-seq
MIRT1405330	hsa-miR-4276	CLIP-seq
MIRT1405331	hsa-miR-4320	CLIP-seq
MIRT1405332	hsa-miR-4419a	CLIP-seq
MIRT1405333	hsa-miR-4433	CLIP-seq
MIRT1405334	hsa-miR-4435	CLIP-seq
MIRT1405335	hsa-miR-4441	CLIP-seq
MIRT1405336	hsa-miR-4448	CLIP-seq
MIRT1405337	hsa-miR-4459	CLIP-seq
MIRT1405338	hsa-miR-4469	CLIP-seq
MIRT1405339	hsa-miR-4506	CLIP-seq
MIRT1405340	hsa-miR-4510	CLIP-seq
MIRT1405341	hsa-miR-4518	CLIP-seq
MIRT1405342	hsa-miR-4663	CLIP-seq
MIRT1405343	hsa-miR-4670-3p	CLIP-seq
MIRT1405344	hsa-miR-4679	CLIP-seq
MIRT1405345	hsa-miR-4699-5p	CLIP-seq
MIRT1405346	hsa-miR-4701-3p	CLIP-seq
MIRT1405347	hsa-miR-4708-5p	CLIP-seq
MIRT1405348	hsa-miR-4739	CLIP-seq
MIRT1405349	hsa-miR-4744	CLIP-seq
MIRT1405350	hsa-miR-4753-3p	CLIP-seq
MIRT1405351	hsa-miR-4756-5p	CLIP-seq
MIRT1405352	hsa-miR-4763-5p	CLIP-seq
MIRT1405353	hsa-miR-4768-3p	CLIP-seq
MIRT1405354	hsa-miR-4770	CLIP-seq
MIRT1405355	hsa-miR-4778-5p	CLIP-seq
MIRT1405277	hsa-miR-4782-3p	CLIP-seq
MIRT1405356	hsa-miR-4796-3p	CLIP-seq
MIRT1405357	hsa-miR-4797-5p	CLIP-seq
MIRT1405358	hsa-miR-510	CLIP-seq
MIRT1405281	hsa-miR-511	CLIP-seq
MIRT1405359	hsa-miR-512-3p	CLIP-seq
MIRT1405360	hsa-miR-514	CLIP-seq
MIRT1405361	hsa-miR-514b-3p	CLIP-seq
MIRT1405362	hsa-miR-519d	CLIP-seq
MIRT1405363	hsa-miR-520a-3p	CLIP-seq
MIRT1405364	hsa-miR-520b	CLIP-seq
MIRT1405365	hsa-miR-520c-3p	CLIP-seq
MIRT1405366	hsa-miR-520d-3p	CLIP-seq
MIRT1405367	hsa-miR-520e	CLIP-seq
MIRT1405368	hsa-miR-545	CLIP-seq
MIRT1405369	hsa-miR-548a-3p	CLIP-seq
MIRT1405370	hsa-miR-548ah	CLIP-seq
MIRT1405371	hsa-miR-548c-3p	CLIP-seq
MIRT1405372	hsa-miR-548e	CLIP-seq
MIRT1405373	hsa-miR-548f	CLIP-seq
MIRT1405374	hsa-miR-548o	CLIP-seq
MIRT1405375	hsa-miR-548p	CLIP-seq
MIRT1405376	hsa-miR-550a	CLIP-seq
MIRT1405377	hsa-miR-552	CLIP-seq
MIRT1405378	hsa-miR-593	CLIP-seq
MIRT1405285	hsa-miR-617	CLIP-seq
MIRT1405379	hsa-miR-622	CLIP-seq
MIRT1405380	hsa-miR-642a	CLIP-seq
MIRT1405381	hsa-miR-720	CLIP-seq
MIRT1405382	hsa-miR-764	CLIP-seq
MIRT1405383	hsa-miR-875-3p	CLIP-seq
MIRT1405384	hsa-miR-93	CLIP-seq
MIRT1405292	hsa-miR-1252	CLIP-seq
MIRT1554358	hsa-miR-1912	CLIP-seq
MIRT1554359	hsa-miR-3919	CLIP-seq
MIRT1554360	hsa-miR-4786-3p	CLIP-seq
MIRT1554361	hsa-miR-4795-5p	CLIP-seq
MIRT1554362	hsa-miR-501-3p	CLIP-seq
MIRT1554363	hsa-miR-502-3p	CLIP-seq
MIRT1554364	hsa-miR-671-5p	CLIP-seq
MIRT1554365	hsa-miR-711	CLIP-seq
MIRT2121574	hsa-miR-1275	CLIP-seq
MIRT2121575	hsa-miR-1468	CLIP-seq
MIRT2121576	hsa-miR-1909	CLIP-seq
MIRT2121577	hsa-miR-1913	CLIP-seq
MIRT2121578	hsa-miR-198	CLIP-seq
MIRT1405259	hsa-miR-219-5p	CLIP-seq
MIRT1405263	hsa-miR-2861	CLIP-seq
MIRT2121579	hsa-miR-3158-3p	CLIP-seq
MIRT2121580	hsa-miR-3183	CLIP-seq
MIRT2121581	hsa-miR-324-3p	CLIP-seq
MIRT2121582	hsa-miR-3661	CLIP-seq
MIRT1405266	hsa-miR-370	CLIP-seq
MIRT2121583	hsa-miR-3944-5p	CLIP-seq
MIRT2121584	hsa-miR-4428	CLIP-seq
MIRT2121585	hsa-miR-4525	CLIP-seq
MIRT2121586	hsa-miR-4665-5p	CLIP-seq
MIRT2121587	hsa-miR-4685-5p	CLIP-seq
MIRT2121588	hsa-miR-4699-3p	CLIP-seq
MIRT2121589	hsa-miR-4723-3p	CLIP-seq
MIRT2121590	hsa-miR-4723-5p	CLIP-seq
MIRT2121591	hsa-miR-4731-5p	CLIP-seq
MIRT2121592	hsa-miR-4749-3p	CLIP-seq
MIRT2121593	hsa-miR-4757-5p	CLIP-seq
MIRT1405277	hsa-miR-4782-3p	CLIP-seq
MIRT2121594	hsa-miR-625	CLIP-seq
MIRT2121595	hsa-miR-631	CLIP-seq
MIRT2121596	hsa-miR-637	CLIP-seq
MIRT2121597	hsa-miR-640	CLIP-seq
MIRT2121598	hsa-miR-769-5p	CLIP-seq
MIRT2343629	hsa-miR-642b	CLIP-seq
MIRT2121575	hsa-miR-1468	CLIP-seq
MIRT1405295	hsa-miR-1273f	CLIP-seq
MIRT1405264	hsa-miR-3125	CLIP-seq
MIRT2460875	hsa-miR-3149	CLIP-seq
MIRT2460876	hsa-miR-3150b-3p	CLIP-seq
MIRT2460877	hsa-miR-3170	CLIP-seq
MIRT2121580	hsa-miR-3183	CLIP-seq
MIRT1405267	hsa-miR-3916	CLIP-seq
MIRT2460878	hsa-miR-411	CLIP-seq
MIRT2460879	hsa-miR-4476	CLIP-seq
MIRT2460880	hsa-miR-4715-3p	CLIP-seq
MIRT2121589	hsa-miR-4723-3p	CLIP-seq
MIRT2460881	hsa-miR-4735-5p	CLIP-seq
MIRT2460882	hsa-miR-4775	CLIP-seq
MIRT2460883	hsa-miR-4784	CLIP-seq
MIRT2460884	hsa-miR-590-3p	CLIP-seq
MIRT2343629	hsa-miR-642b	CLIP-seq
MIRT2460885	hsa-miR-765	CLIP-seq
MIRT1405295	hsa-miR-1273f	CLIP-seq
MIRT2460875	hsa-miR-3149	CLIP-seq
MIRT2460877	hsa-miR-3170	CLIP-seq
MIRT2460878	hsa-miR-411	CLIP-seq
MIRT2460880	hsa-miR-4715-3p	CLIP-seq
MIRT2460881	hsa-miR-4735-5p	CLIP-seq
MIRT2460882	hsa-miR-4775	CLIP-seq
MIRT2460884	hsa-miR-590-3p	CLIP-seq
MIRT2637265	hsa-miR-122	CLIP-seq
MIRT1405295	hsa-miR-1273f	CLIP-seq
MIRT2637266	hsa-miR-149	CLIP-seq
MIRT1405305	hsa-miR-24	CLIP-seq
MIRT1405264	hsa-miR-3125	CLIP-seq
MIRT2637267	hsa-miR-3135b	CLIP-seq
MIRT2460875	hsa-miR-3149	CLIP-seq
MIRT2460877	hsa-miR-3170	CLIP-seq
MIRT1405318	hsa-miR-320e	CLIP-seq
MIRT2637268	hsa-miR-3622b-5p	CLIP-seq
MIRT2637269	hsa-miR-3647-3p	CLIP-seq
MIRT1405267	hsa-miR-3916	CLIP-seq
MIRT2460878	hsa-miR-411	CLIP-seq
MIRT2637270	hsa-miR-4284	CLIP-seq
MIRT2460879	hsa-miR-4476	CLIP-seq
MIRT2637271	hsa-miR-4645-5p	CLIP-seq
MIRT2637272	hsa-miR-4668-3p	CLIP-seq
MIRT2637273	hsa-miR-4673	CLIP-seq
MIRT2460880	hsa-miR-4715-3p	CLIP-seq
MIRT2460881	hsa-miR-4735-5p	CLIP-seq
MIRT2460882	hsa-miR-4775	CLIP-seq
MIRT2460884	hsa-miR-590-3p	CLIP-seq
MIRT2343629	hsa-miR-642b	CLIP-seq
MIRT2637274	hsa-miR-760	CLIP-seq
MIRT2637265	hsa-miR-122	CLIP-seq
MIRT1405295	hsa-miR-1273f	CLIP-seq
MIRT2637266	hsa-miR-149	CLIP-seq
MIRT1405305	hsa-miR-24	CLIP-seq
MIRT2637267	hsa-miR-3135b	CLIP-seq
MIRT2460875	hsa-miR-3149	CLIP-seq
MIRT2460877	hsa-miR-3170	CLIP-seq
MIRT1405318	hsa-miR-320e	CLIP-seq
MIRT2637268	hsa-miR-3622b-5p	CLIP-seq
MIRT2637269	hsa-miR-3647-3p	CLIP-seq
MIRT2460878	hsa-miR-411	CLIP-seq
MIRT2637270	hsa-miR-4284	CLIP-seq
MIRT2637271	hsa-miR-4645-5p	CLIP-seq
MIRT2637272	hsa-miR-4668-3p	CLIP-seq
MIRT2637273	hsa-miR-4673	CLIP-seq
MIRT2460880	hsa-miR-4715-3p	CLIP-seq
MIRT2460881	hsa-miR-4735-5p	CLIP-seq
MIRT2460882	hsa-miR-4775	CLIP-seq
MIRT2460884	hsa-miR-590-3p	CLIP-seq
MIRT2343629	hsa-miR-642b	CLIP-seq
MIRT2637274	hsa-miR-760	CLIP-seq

Transcription factor	Regulation	Reference
JUN	Unknown	22354960

186 Show/Hide all (186)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IDA	28890335
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001775	Process	Cell activation	IEA
GO:0001775	Process	Cell activation	ISS
GO:0001784	Function	Phosphotyrosine residue binding	IPI	20624904
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001820	Process	Serotonin secretion	IEA
GO:0001945	Process	Lymph vessel development	IEA
GO:0001945	Process	Lymph vessel development	ISS
GO:0002092	Process	Positive regulation of receptor internalization	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	ISS
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002250	Process	Adaptive immune response	IBA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	ISS
GO:0002281	Process	Macrophage activation involved in immune response	IBA
GO:0002281	Process	Macrophage activation involved in immune response	IEA
GO:0002281	Process	Macrophage activation involved in immune response	ISS
GO:0002283	Process	Neutrophil activation involved in immune response	IBA
GO:0002283	Process	Neutrophil activation involved in immune response	IEA
GO:0002283	Process	Neutrophil activation involved in immune response	ISS
GO:0002366	Process	Leukocyte activation involved in immune response	IEA
GO:0002366	Process	Leukocyte activation involved in immune response	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002554	Process	Serotonin secretion by platelet	IEA
GO:0002554	Process	Serotonin secretion by platelet	ISS
GO:0002752	Process	Cell surface pattern recognition receptor signaling pathway	IMP	19358895
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	TAS
GO:0004672	Function	Protein kinase activity	IDA	18818202
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	NAS	12885943
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	23071339
GO:0004713	Function	Protein tyrosine kinase activity	EXP	8629002, 8657103, 10648173, 17993265, 18818202, 22041900
GO:0004713	Function	Protein tyrosine kinase activity	IBA
GO:0004713	Function	Protein tyrosine kinase activity	IDA	34634301
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IMP	33782605
GO:0004713	Function	Protein tyrosine kinase activity	ISS
GO:0004713	Function	Protein tyrosine kinase activity	NAS	28386764
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	8163536, 11606584
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IGI	14656219
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IMP	15509800
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS
GO:0005102	Function	Signaling receptor binding	IPI	31145836
GO:0005178	Function	Integrin binding	IPI	12885943
GO:0005515	Function	Protein binding	IPI	7761456, 8627166, 8647200, 8657103, 8798676, 8810294, 9280292, 9698567, 11940607, 12051764, 15536084, 16273093, 18273061, 19843936, 20133729, 20585042, 20713593, 21044950, 21516116, 22019427, 22624718, 23001182, 23299888, 24525236, 24728074, 25416956, 25605870, 25814554, 28086240, 31
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	23071339
GO:0005737	Component	Cytoplasm	IDA	23071339
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IC	8163536
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006468	Process	Protein phosphorylation	IDA	17681949
GO:0006606	Process	Protein import into nucleus	IMP	23071339
GO:0007159	Process	Leukocyte cell-cell adhesion	IDA	12885943
GO:0007159	Process	Leukocyte cell-cell adhesion	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007167	Process	Enzyme-linked receptor protein signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	ISS
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	12885943
GO:0009887	Process	Animal organ morphogenesis	TAS	7477352
GO:0010507	Process	Negative regulation of autophagy	IDA	32561715
GO:0010508	Process	Positive regulation of autophagy	IDA	22017875, 22017876
GO:0010543	Process	Regulation of platelet activation	IEA
GO:0010543	Process	Regulation of platelet activation	ISS
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	IMP	19151749
GO:0016020	Component	Membrane	IEA
GO:0016170	Function	Interleukin-15 receptor binding	IPI	15123770
GO:0016301	Function	Kinase activity	IDA	9490415
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	ISS
GO:0019370	Process	Leukotriene biosynthetic process	IEA
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0019815	Component	B cell receptor complex	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019902	Function	Phosphatase binding	IEA
GO:0030168	Process	Platelet activation	TAS
GO:0030183	Process	B cell differentiation	IEA
GO:0030593	Process	Neutrophil chemotaxis	IDA	12885943
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IMP	22267217
GO:0031623	Process	Receptor internalization	IEA
GO:0031623	Process	Receptor internalization	ISS
GO:0031669	Process	Cellular response to nutrient levels	IDA	32561715
GO:0032009	Component	Early phagosome	IEA
GO:0032009	Component	Early phagosome	ISS
GO:0032481	Process	Positive regulation of type I interferon production	IEA
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	IMP	19358895
GO:0032735	Process	Positive regulation of interleukin-12 production	IMP	19358895
GO:0032752	Process	Positive regulation of interleukin-3 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	19358895
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	25251945
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	19358895
GO:0032765	Process	Positive regulation of mast cell cytokine production	IEA
GO:0032928	Process	Regulation of superoxide anion generation	IEA
GO:0032928	Process	Regulation of superoxide anion generation	ISS
GO:0032930	Process	Positive regulation of superoxide anion generation	IMP	19358895
GO:0032991	Component	Protein-containing complex	IDA	23071339
GO:0032991	Component	Protein-containing complex	IEA
GO:0033630	Process	Positive regulation of cell adhesion mediated by integrin	IBA
GO:0033630	Process	Positive regulation of cell adhesion mediated by integrin	IEA
GO:0033630	Process	Positive regulation of cell adhesion mediated by integrin	ISS
GO:0035325	Function	Toll-like receptor binding	IEA
GO:0035556	Process	Intracellular signal transduction	IDA	11606584, 15509800
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	IGI	14656219
GO:0035556	Process	Intracellular signal transduction	IMP	11606584, 32514138
GO:0035556	Process	Intracellular signal transduction	ISS
GO:0038063	Process	Collagen-activated tyrosine kinase receptor signaling pathway	IEA
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0038156	Process	Interleukin-3-mediated signaling pathway	IEA
GO:0038156	Process	Interleukin-3-mediated signaling pathway	ISS
GO:0038202	Process	TORC1 signaling	IDA	12087098
GO:0042101	Component	T cell receptor complex	IDA	8176201
GO:0042101	Component	T cell receptor complex	IEA
GO:0042169	Function	SH2 domain binding	IEA
GO:0042492	Process	Gamma-delta T cell differentiation	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042742	Process	Defense response to bacterium	ISS
GO:0043274	Function	Phospholipase binding	IPI	14656219, 32514138
GO:0043303	Process	Mast cell degranulation	IEA
GO:0043306	Process	Positive regulation of mast cell degranulation	IEA
GO:0043313	Process	Regulation of neutrophil degranulation	IEA
GO:0043313	Process	Regulation of neutrophil degranulation	ISS
GO:0043366	Process	Beta selection	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	ISS
GO:0045579	Process	Positive regulation of B cell differentiation	IEA
GO:0045579	Process	Positive regulation of B cell differentiation	IMP	18369315
GO:0045588	Process	Positive regulation of gamma-delta T cell differentiation	IEA
GO:0045621	Process	Positive regulation of lymphocyte differentiation	IEA
GO:0045780	Process	Positive regulation of bone resorption	IEA
GO:0045780	Process	Positive regulation of bone resorption	ISS
GO:0046638	Process	Positive regulation of alpha-beta T cell differentiation	IEA
GO:0046641	Process	Positive regulation of alpha-beta T cell proliferation	IEA
GO:0048514	Process	Blood vessel morphogenesis	IEA
GO:0048514	Process	Blood vessel morphogenesis	ISS
GO:0050764	Process	Regulation of phagocytosis	IEA
GO:0050764	Process	Regulation of phagocytosis	ISS
GO:0050776	Process	Regulation of immune response	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IEA
GO:0050853	Process	B cell receptor signaling pathway	IBA
GO:0050853	Process	B cell receptor signaling pathway	IEA
GO:0050853	Process	B cell receptor signaling pathway	IMP	15509800
GO:0050853	Process	B cell receptor signaling pathway	ISS
GO:0050900	Process	Leukocyte migration	IEA
GO:0051090	Process	Regulation of DNA-binding transcription factor activity	IMP	23071339
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IEA
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	ISS
GO:0071226	Process	Cellular response to molecule of fungal origin	IEA
GO:0071226	Process	Cellular response to molecule of fungal origin	ISS
GO:0071396	Process	Cellular response to lipid	IMP	32514138
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	ISS
GO:0071639	Process	Positive regulation of monocyte chemotactic protein-1 production	IMP	25251945
GO:0090237	Process	Regulation of arachidonate secretion	IEA
GO:0090237	Process	Regulation of arachidonate secretion	ISS
GO:0090330	Process	Regulation of platelet aggregation	IEA
GO:0090330	Process	Regulation of platelet aggregation	ISS
GO:0097110	Function	Scaffold protein binding	IPI	11606584
GO:0097190	Process	Apoptotic signaling pathway	IMP	22267217
GO:0097242	Process	Amyloid-beta clearance	IDA	27477018
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	29235464
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	22017875, 22017876
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	34634301
GO:1904646	Process	Cellular response to amyloid-beta	IDA	29518356
GO:1990858	Process	Cellular response to lectin	IEA
GO:1990858	Process	Cellular response to lectin	ISS

MIM	HGNC	e!Ensembl
600085	11491	ENSG00000165025

P43405

Protein name

Tyrosine-protein kinase SYK (EC 2.7.10.2) (Spleen tyrosine kinase) (p72-Syk)

Protein function

Non-receptor tyrosine kinase which mediates signal transduction downstream of a variety of transmembrane receptors including classical immunoreceptors like the B-cell receptor (BCR). Regulates several biological processes including innate and ad

PDB

1A81 , 1CSY , 1CSZ , 1XBA , 1XBB , 1XBC , 3BUW , 3EMG , 3FQE , 3FQH , 3FQS , 3SRV , 3TUB , 3TUC , 3TUD , 3VF8 , 3VF9 , 4DFL , 4DFN , 4F4P , 4FL1 , 4FL2 , 4FL3 , 4FYN , 4FYO , 4FZ6 , 4FZ7 , 4GFG , 4I0R , 4I0S , 4I0T , 4PUZ , 4PV0 , 4PX6 , 4RSS , 4RX7 , 4RX8 , 4RX9 , 4WNM , 4XG2 , 4XG3 , 4XG4 , 4XG6 , 4XG7 , 4XG8 , 4XG9 , 4YJO , 4YJP , 4YJQ , 4YJR , 4YJS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00017	SH2	168 → 244	SH2 domain	Domain
PF00017	SH2	15 → 92	SH2 domain	Domain
PF07714	PK_Tyr_Ser-Thr	371 → 626	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed in hematopoietic cells (at protein level) (PubMed:8163536). Expressed in neutrophils (at protein level) (PubMed:15123770). Within the B-cell compartment, expressed from pro- and pre-B cells to plasma cells (PubMed:8163

Sequence

MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN

Sequence length

635

Interactions

View interactions

KEGG Pathway	Reactome Pathway
NF-kappa B signaling pathway	GPVI-mediated activation cascade
Phospholipase D signaling pathway	FCGR activation
PI3K-Akt signaling pathway	Regulation of actin dynamics for phagocytic cup formation
Osteoclast differentiation	Role of phospholipids in phagocytosis
Platelet activation	DAP12 signaling
Neutrophil extracellular trap formation	Fc epsilon receptor (FCERI) signaling
C-type lectin receptor signaling pathway	Role of LAT2/NTAL/LAB on calcium mobilization
Natural killer cell mediated cytotoxicity	FCERI mediated MAPK activation
B cell receptor signaling pathway	FCERI mediated Ca+2 mobilization
Fc epsilon RI signaling pathway	Integrin signaling
Fc gamma R-mediated phagocytosis	Dectin-2 family
Tuberculosis	Interleukin-2 signaling
Kaposi sarcoma-associated herpesvirus infection	Regulation of signaling by CBL
Herpes simplex virus 1 infection	FCGR3A-mediated IL10 synthesis
Epstein-Barr virus infection	FCGR3A-mediated phagocytosis
Coronavirus disease - COVID-19	Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
Viral carcinogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar Show/Hide Causal Diseases (6)
Arthritis	Likely pathogenic; Pathogenic	rs1304839707, rs1827861920, rs1828636794	RCV001270703 RCV001270909 RCV001270911	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Colitis	Likely pathogenic; Pathogenic	rs1304839707, rs1827861920, rs1828636794	RCV001270703 RCV001270909 RCV001270911	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Decreased circulating immunoglobulin concentration	Likely pathogenic; Pathogenic	rs1304839707, rs1827861920, rs1828636794	RCV001270703 RCV001270909 RCV001270911	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Immunodeficiency	Likely pathogenic; Pathogenic	rs1304839707, rs1827861920, rs1828636794	RCV001270703 RCV001270909 RCV001270911	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Immunodeficiency 82 with systemic inflammation	Likely pathogenic; Pathogenic	rs1827861920, rs1828636794	RCV002293255 RCV001527352	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Skin rash	Likely pathogenic; Pathogenic	rs1304839707, rs1827861920, rs1828636794	RCV001270703 RCV001270909 RCV001270911	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (18)
Acute myeloid leukemia	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	28416822	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS	—	CTD, Disgenet CTD, Disgenet	33782605	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Joint swelling	Conflicting classifications of pathogenicity	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, LARGE B-CELL, DIFFUSE	—	CTD	33782605	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	17145863	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA	—	CTD	17659810	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	21833088, 26920376, 31604244	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYK-related disorder	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	22456796	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	23480133	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (237)
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12717427, 25799995, 31817853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	23535559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27461624, 30251328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12717427, 31817853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	18006696, 22025527, 30872780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	15132768, 30066853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	11698299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	16341044, 25337257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	22321643, 24376657, 31545231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	22914861		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16452391, 38350168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29952085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	8590001	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	22321643, 24376657, 31545231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	22321643, 28260035	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	25715120, 31616406, 37301715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27406873, 28268139, 28468967, 28716125, 29056373, 29890824, 30172129, 31616406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	BEFREE	29869203		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	18006696		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23523010, 29340070, 29781323		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	19581935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	29297721, 33267658, 35309299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	BEFREE	21693067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11454707, 12445683, 12907655, 15455373, 15467753, 16288017, 19435818, 21347717, 22707146, 23803121, 24523870, 26889814, 29922076, 30733195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11859072, 12477728, 17214368, 19435818, 20562096, 20628393, 22451900, 22864779, 23613720, 23684705, 23803121, 24523870, 24914616, 25092868, 26126114 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15861514, 16431925, 19151749, 22864779, 24523870	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	28064214, 29740433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	28064214, 30617194, 33670716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16431925, 19151749, 22864779, 25310533, 30091681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16964403, 31492560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	28957395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	24523870	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	24523870	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17121887, 25310533, 26045814, 28302680, 29209123, 32730361, 33638929, 34258170, 34634301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	24523870	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	26884848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21067271, 23803069, 30251328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	19893036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	24564859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28423512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	14970867, 26096845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	24523870, 30942391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	37301715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	28260035	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	30499219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	20563729		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	20563729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cherubism	Cherubism	BEFREE	24916406, 29669173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	12717427, 31817853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19297020, 19549911, 19581935, 20335218, 24489640, 24547708, 25329694, 25632006, 27888629, 27890932, 28011996, 28155013, 28838991, 30555163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	24525236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	29537660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29272492, 30231985		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Colon Carcinoma	Colon Carcinoma	BEFREE	28957395, 30231985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33979042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23609194, 25921550, 27293079, 28957395, 29693170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24308539, 25287946, 28957395, 29693170, 33979042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Combined Saposin Deficiency	Combined saposin deficiency	Pubtator	30898992	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28869869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30898992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30898992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	30898992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30898992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29272492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	23480133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	GWASDB_DG	23480133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	GWASCAT_DG	23480133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	30919407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	25113532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	30536048, 30919407, 31356921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	28410990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	12670344, 36736734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36736734	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	35309299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	29601906, 30942391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	31949205, 32778679	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	22659134, 29901140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	18006696, 19369227, 19855081, 22025527, 23764004, 24169826, 26585955, 26773040, 27720936, 28291124, 28460620, 28639315, 30872780, 31471373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	30536048, 30919407, 31356921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28336564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29537660, 30219279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	16440290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29537660, 30742098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29401256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37107600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29401256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26245897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	25715120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	28391340, 29923438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	25715120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	32954852	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28445193, 30282825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28869869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	20439538, 24525236, 29719615, 29925062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	25092868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	11159536, 19581935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Hematuria	Pubtator	25715120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heparin Cofactor II Deficiency	Heparin cofactor 2 deficiency	Pubtator	21848694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	33435587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12881301, 28791394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	16304050	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	31059139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	28869869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37107600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	30735243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	35130915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	28391340, 29869203, 30177021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	22914861, 29272492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	39241232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	28967793, 29869203, 30951590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	BEFREE	29202301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29272492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	30249354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	15455373, 24523870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30499219, 31545231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	29537660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30599182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	26884848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	26884848		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15580314, 17130299, 26315286, 28881711		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17130299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20014315, 26315286, 32015510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	12763134, 26315286, 26785729, 33592500, 34536536	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23509157, 23535559, 24525236, 26315286, 28881711, 30071517, 31771968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	15132768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17121887, 22472882, 22585575, 25310533, 28302680, 29537660, 29922076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29537660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23803069, 30251328, 34252536, 37183231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	27461628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27461628	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	21720246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	33336508	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11352243, 19018007, 19201859, 21953500, 22235999, 24013589, 26582197, 37072752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22354960	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	21720246, 29336019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	21720246, 21953500, 22354960, 29988500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	25715120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28479222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	21720246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15188513, 15861514, 26884848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	23613720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	LHGDN	15059847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	15744341, 16888096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22025527, 23535559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	32005797, 35255496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	16835385, 16912221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	18981293, 21148756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	20670954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	17659810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11454707, 12445683, 12907655, 15455373, 16288017, 19435818, 21347717, 22707146, 23803121, 24523870, 26889814, 29922076, 30733195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	GWASDB_DG	21642993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	29861861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	26884848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21067271, 23803069, 30251328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	14970867, 26096845, 30668583, 31492560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25388286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	19293188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16322234, 16964403, 20439538, 23803121, 25329694, 25632006, 25921550, 26884848, 27406873, 28957395, 29137391, 29440271, 30135222, 31817853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	20563729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28957395, 30231985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11454707, 12907655, 16288017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12477728, 15062056, 16474166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	25388373, 28011673		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15955106, 17145863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	17145863, 19293188		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	17145863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	19293188	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	36409827	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	CTD_human_DG	17659810		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma Malignant	Mesothelioma	Pubtator	17659810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	25388286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	15580314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	30091681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	30737623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	15580314, 31174059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23412934, 25526461	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11159536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	25965880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	24525236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	25715120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	16431925, 28827787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22287277, 23036706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11454707, 12382187, 12717427, 12907655, 15467753, 16288017, 16964403, 17145863, 18981293, 19195024, 19293188, 19369227, 19770839, 20563729, 22237022 View all (20 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30744170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31324720		★★★★★ ★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	30744170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	15467753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular fasciitis	Nodular Fasciitis	BEFREE	16440290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23803069, 27461628, 29578158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29537660, 30219279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	24523870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	31719149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	31613396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36937804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26096802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35435107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	14970867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	14970867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26096845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26096845, 29643476, 30668583, 30737623, 32878513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	31613396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31613396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	16341044, 19295409, 20439538, 20439541, 20670954, 24376268, 25337257, 30217447, 31545408, 31808829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	18401419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	31812978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	11494125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	12717427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25388286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22219177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32099002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	29861861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	22237022, 23765217, 26404525, 29372378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Robinow Syndrome	Robinow Syndrome	BEFREE	21693067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	24564241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	11494125, 15132768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	25202827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	30674869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	24564859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	24564859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19195024, 29137391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29719615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24398980, 30091681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26884848	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	30898992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15188513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15188513	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	21518255, 24376268		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	16964403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	28919467, 31324720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25699542, 30665374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	LHGDN	18206515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	30158835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	36428281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	17252022, 25748087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	25748087, 30402490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
COPG1	2	["Immunodeficiency","Mesothelioma"]	0	[]	3	["HPO (Immunodeficiency)","ClinVar (Immunodeficiency)","CTD (Mesothelioma)"]
ZFP36	2	["Arthritis","Dermatitis"]	1	["Kaposi sarcoma-associated herpesvirus infection"]	4	["Disgenet (Arthritis)","CTD (Arthritis)","Disgenet (Dermatitis)","CTD (Dermatitis)"]
BCL10	2	["Immunodeficiency","Mesothelioma"]	4	["NF-kappa B signaling pathway","C-type lectin receptor signaling pathway","B cell receptor signaling pathway","Tuberculosis"]	5	["HPO (Immunodeficiency)","Disgenet (Immunodeficiency)","ClinVar (Immunodeficiency)","GWAS catalog (Immunodeficiency)","CTD (Mesothelioma)"]
MALT1	2	["Diffuse large b-cell lymphoma","Immunodeficiency"]	4	["NF-kappa B signaling pathway","C-type lectin receptor signaling pathway","B cell receptor signaling pathway","Tuberculosis"]	3	["HPO (Immunodeficiency)","Disgenet (Immunodeficiency)","CTD (Diffuse large b-cell lymphoma)"]
IKBKB	2	["Dermatitis","Immunodeficiency"]	8	["NF-kappa B signaling pathway","Osteoclast differentiation","C-type lectin receptor signaling pathway","B cell receptor signaling pathway","Kaposi sarcoma-associated herpesvirus infection","Herpes simplex virus 1 infection","Epstein-Barr virus infection","Coronavirus disease - COVID-19"]	5	["Disgenet (Dermatitis)","HPO (Immunodeficiency)","Disgenet (Immunodeficiency)","ClinVar (Immunodeficiency)","GWAS catalog (Immunodeficiency)"]

SYK (spleen associated tyrosine kinase)

Bookmark This Gene