Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	27243
Gene name	Charged multivesicular body protein 2A
Gene symbol	CHMP2A
Synonyms (NCBI Gene)	BC-2BC2CHMP2VPS2VPS2A
Chromosome	19
Chromosome location	19q13.43
Summary	CHMP2A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor p

16 Show/Hide all (16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001642	hsa-let-7b-5p	pSILAC	18668040
MIRT023921	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT001642	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT045097	hsa-miR-186-5p	CLASH	23622248
MIRT042781	hsa-miR-339-5p	CLASH	23622248
MIRT041151	hsa-miR-500a-3p	CLASH	23622248
MIRT039927	hsa-miR-615-3p	CLASH	23622248
MIRT2200161	hsa-miR-1285	CLIP-seq
MIRT2200162	hsa-miR-1343	CLIP-seq
MIRT2200163	hsa-miR-3187-5p	CLIP-seq
MIRT2200164	hsa-miR-3945	CLIP-seq
MIRT2200165	hsa-miR-4253	CLIP-seq
MIRT2200166	hsa-miR-4536	CLIP-seq
MIRT2200167	hsa-miR-4797-5p	CLIP-seq
MIRT2200168	hsa-miR-556-3p	CLIP-seq
MIRT2200169	hsa-miR-612	CLIP-seq

86 Show/Hide all (86)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000421	Component	Autophagosome membrane	IDA	17984323
GO:0000776	Component	Kinetochore	IDA	26040712
GO:0000776	Component	Kinetochore	IEA
GO:0000785	Component	Chromatin	IDA	28242692
GO:0000815	Component	ESCRT III complex	IBA
GO:0000815	Component	ESCRT III complex	IDA	18687924, 26040712
GO:0000815	Component	ESCRT III complex	NAS	36107470
GO:0000815	Component	ESCRT III complex	TAS	20588296
GO:0001778	Process	Plasma membrane repair	IDA	24482116
GO:0001778	Process	Plasma membrane repair	IEA
GO:0005515	Function	Protein binding	IPI	14505570, 14519844, 16730941, 18385515, 18687924, 19129480, 19525971, 21543490, 21975012, 23045692, 23051622, 23105106, 25416956, 26496610, 28514442, 32296183, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IDA	26040712
GO:0005635	Component	Nuclear envelope	IEA
GO:0005643	Component	Nuclear pore	IDA	26040713
GO:0005643	Component	Nuclear pore	IEA
GO:0005765	Component	Lysosomal membrane	IDA	17984323
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005771	Component	Multivesicular body	IBA
GO:0005828	Component	Kinetochore microtubule	IDA	26040712
GO:0005828	Component	Kinetochore microtubule	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	24878737
GO:0006914	Process	Autophagy	IMP	17984323
GO:0006997	Process	Nucleus organization	IMP	20616062
GO:0007034	Process	Vacuolar transport	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IMP	20616062
GO:0010324	Process	Membrane invagination	IMP	24878737
GO:0010458	Process	Exit from mitosis	IMP	26040712
GO:0010824	Process	Regulation of centrosome duplication	IMP	20616062
GO:0015031	Process	Protein transport	IBA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016236	Process	Macroautophagy	TAS	20588296
GO:0019076	Process	Viral release from host cell	IGI	23051622
GO:0019076	Process	Viral release from host cell	IMP	23051622
GO:0019904	Function	Protein domain specific binding	IPI	17928862
GO:0030117	Component	Membrane coat	IMP	24878737
GO:0030496	Component	Midbody	IDA	26040712
GO:0030496	Component	Midbody	IEA
GO:0031210	Function	Phosphatidylcholine binding	IMP	18687924
GO:0031468	Process	Nuclear membrane reassembly	IEA
GO:0031468	Process	Nuclear membrane reassembly	IMP	26040712, 26040713
GO:0031902	Component	Late endosome membrane	IEA
GO:0032509	Process	Endosome transport via multivesicular body sorting pathway	IBA
GO:0032585	Component	Multivesicular body membrane	IDA	16554368
GO:0032585	Component	Multivesicular body membrane	IEA
GO:0036258	Process	Multivesicular body assembly	NAS	16505166
GO:0036258	Process	Multivesicular body assembly	TAS	20588296
GO:0039702	Process	Viral budding via host ESCRT complex	IDA	24878737
GO:0039702	Process	Viral budding via host ESCRT complex	IEA
GO:0039702	Process	Viral budding via host ESCRT complex	IGI	24107264
GO:0039702	Process	Viral budding via host ESCRT complex	IMP	23051622
GO:0039702	Process	Viral budding via host ESCRT complex	TAS	20588296
GO:0043162	Process	Ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IDA	17984323
GO:0043162	Process	Ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IEA
GO:0045184	Process	Establishment of protein localization	IMP	23045692
GO:0045324	Process	Late endosome to vacuole transport	IBA
GO:0046761	Process	Viral budding from plasma membrane	IDA	24878737
GO:0046761	Process	Viral budding from plasma membrane	IEA
GO:0046761	Process	Viral budding from plasma membrane	IMP	14505570
GO:0051258	Process	Protein polymerization	IMP	23051622, 24878737
GO:0051260	Process	Protein homooligomerization	IMP	18687924
GO:0051469	Process	Vesicle fusion with vacuole	NAS	16505166
GO:0061763	Process	Multivesicular body-lysosome fusion	NAS	16505166
GO:0061952	Process	Midbody abscission	IEA
GO:0061952	Process	Midbody abscission	IMP	20616062
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0071985	Process	Multivesicular body sorting pathway	IDA	16554368
GO:0071985	Process	Multivesicular body sorting pathway	IEA
GO:0090148	Process	Membrane fission	NAS	19234443
GO:0097352	Process	Autophagosome maturation	IEA
GO:0097352	Process	Autophagosome maturation	IMP	17984323
GO:1901673	Process	Regulation of mitotic spindle assembly	IEA
GO:1901673	Process	Regulation of mitotic spindle assembly	IMP	20616062
GO:1902774	Process	Late endosome to lysosome transport	IEA
GO:1902774	Process	Late endosome to lysosome transport	IMP	17984323
GO:1903543	Process	Positive regulation of exosomal secretion	IMP	22660413
GO:1903723	Process	Negative regulation of centriole elongation	IMP	20616062
GO:1904903	Process	ESCRT III complex disassembly	NAS	20588296
GO:1904930	Component	Amphisome membrane	IDA	17984323
GO:1904930	Component	Amphisome membrane	IEA

MIM	HGNC	e!Ensembl
610893	30216	ENSG00000130724

O43633

Protein name

Charged multivesicular body protein 2a (Chromatin-modifying protein 2a) (CHMP2a) (Putative breast adenocarcinoma marker BC-2) (Vacuolar protein sorting-associated protein 2-1) (Vps2-1) (hVps2-1)

Protein function

Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (IL

PDB

7ZCG , 7ZCH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03357	Snf7	17 → 187	Snf7	Family

Sequence

MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVR
IMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLP
QIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELS
NLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD

Sequence length

222

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Endocytosis	Budding and maturation of HIV virion
Necroptosis	Macroautophagy
	Lysosome Vesicle Biogenesis
	Endosomal Sorting Complex Required For Transport (ESCRT)
	HCMV Late Events
	Sealing of the nuclear envelope (NE) by ESCRT-III

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
RNF103-CHMP3	[]	7	["Endocytosis","Necroptosis","Budding and maturation of HIV virion","Macroautophagy","Endosomal Sorting Complex Required For Transport (ESCRT)","HCMV Late Events","Sealing of the nuclear envelope (NE) by ESCRT-III"]	[]
CHMP2B	[]	7	["Endocytosis","Necroptosis","Budding and maturation of HIV virion","Macroautophagy","Endosomal Sorting Complex Required For Transport (ESCRT)","HCMV Late Events","Sealing of the nuclear envelope (NE) by ESCRT-III"]	[]
CHMP3	[]	7	["Endocytosis","Necroptosis","Budding and maturation of HIV virion","Macroautophagy","Endosomal Sorting Complex Required For Transport (ESCRT)","HCMV Late Events","Sealing of the nuclear envelope (NE) by ESCRT-III"]	[]
CHMP4C	[]	7	["Endocytosis","Necroptosis","Budding and maturation of HIV virion","Macroautophagy","Endosomal Sorting Complex Required For Transport (ESCRT)","HCMV Late Events","Sealing of the nuclear envelope (NE) by ESCRT-III"]	[]
CHMP6	[]	7	["Endocytosis","Necroptosis","Budding and maturation of HIV virion","Macroautophagy","Endosomal Sorting Complex Required For Transport (ESCRT)","HCMV Late Events","Sealing of the nuclear envelope (NE) by ESCRT-III"]	[]

CHMP2A (charged multivesicular body protein 2A)

Bookmark This Gene