CHAD (chondroadherin)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 1101
Gene name Chondroadherin
Gene symbol CHAD
Synonyms (NCBI Gene)
SLRR4A
Chromosome 17
Chromosome location 17q21.33
Summary Chondroadherin is a cartilage matrix protein thought to mediate adhesion of isolated chondrocytes. The protein contains 11 leucine-rich repeats flanked by cysteine-rich regions. The chondroadherin messenger RNA is present in chondrocytes at all ages. [pr
miRNA miRNA information provided by mirtarbase database.
10 Show/Hide all (10)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT888507 hsa-miR-2110 CLIP-seq
MIRT888508 hsa-miR-28-5p CLIP-seq
MIRT888509 hsa-miR-3135b CLIP-seq
MIRT888510 hsa-miR-3139 CLIP-seq
MIRT888511 hsa-miR-4271 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 28514442, 33961781
GO:0005576 Component Extracellular region IEA
GO:0005886 Component Plasma membrane IBA
GO:0038023 Function Signaling receptor activity IBA
GO:0060348 Process Bone development IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
602178 1909 ENSG00000136457
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O15335
Protein name Chondroadherin (Cartilage leucine-rich protein)
Protein function Promotes attachment of chondrocytes, fibroblasts, and osteoblasts. This binding is mediated (at least for chondrocytes and fibroblasts) by the integrin alpha(2)beta(1). May play an important role in the regulation of chondrocyte growth and proli
PDB 5LFN , 5MX1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01462 LRRNT 22 → 50 Leucine rich repeat N-terminal domain Family
PF13855 LRR_8 75 → 135 Leucine rich repeat Repeat
PF13855 LRR_8 147 → 207 Leucine rich repeat Repeat
PF13855 LRR_8 244 → 301 Leucine rich repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Present in chondrocytes at all ages.
Sequence 
MVRPMLLLSLGLLAGLLPALAACPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQR
NNFPVLAANSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFD
DLTELTYLYLDHNKVTELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSE
NALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQ
SFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLETLALTNN
PWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH
Sequence length 359
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Human papillomavirus infection
Sort by:
IBSP 2 shared pathwaysFocal adhesion, ECM-receptor interaction Related via 2 shared pathways including Focal adhesion, ECM-receptor interaction. TNN 2 shared pathwaysFocal adhesion, ECM-receptor interaction Related via 2 shared pathways including Focal adhesion, ECM-receptor interaction. TNR 2 shared pathwaysFocal adhesion, ECM-receptor interaction Related via 2 shared pathways including Focal adhesion, ECM-receptor interaction. TNXB 2 shared pathwaysFocal adhesion, ECM-receptor interaction Related via 2 shared pathways including Focal adhesion, ECM-receptor interaction. RELN 2 shared pathwaysFocal adhesion, ECM-receptor interaction Related via 2 shared pathways including Focal adhesion, ECM-receptor interaction.
Major depressive disorder Linked via 4 of 5 related genesIBSP, TNR, TNXB, RELN Schizophrenia Linked via 3 of 5 related genesTNR, TNXB, RELN Neurodevelopmental disorder Linked via 2 of 5 related genesTNR, RELN Open angle glaucoma Linked via 2 of 5 related genesTNR, RELN Sarcoidosis Linked via 2 of 5 related genesTNR, TNXB