CD3G (CD3 gamma subunit of T-cell receptor complex)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 917
• Gene name: CD3 gamma subunit of T-cell receptor complex
• Gene symbol: CD3G
• Synonyms (NCBI Gene): CD3-GAMMA, CD3GAMMA, IMD17, T3G
• Chromosome: 11
• Chromosome location: 11q23.3
• Summary: The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs199676861	A>T	Pathogenic	Stop gained, coding sequence variant
rs483352927	AAACCACTTGGTTAAGG>-	Pathogenic	Splice acceptor variant, coding sequence variant
rs570768621	A>-,AA	Pathogenic, conflicting-interpretations-of-pathogenicity	Coding sequence variant, frameshift variant

miRNA Show/Hide all (142)

miRTarBase ID	miRNA	Experiments	Reference
MIRT875312	hsa-miR-10a	CLIP-seq
MIRT875313	hsa-miR-10b	CLIP-seq
MIRT875314	hsa-miR-1227	CLIP-seq
MIRT875315	hsa-miR-142-3p	CLIP-seq
MIRT875316	hsa-miR-1909	CLIP-seq
MIRT875317	hsa-miR-3132	CLIP-seq
MIRT875318	hsa-miR-3187-3p	CLIP-seq
MIRT875319	hsa-miR-339-5p	CLIP-seq
MIRT875320	hsa-miR-3926	CLIP-seq
MIRT875321	hsa-miR-3929	CLIP-seq
MIRT875322	hsa-miR-3934	CLIP-seq
MIRT875323	hsa-miR-4419b	CLIP-seq
MIRT875324	hsa-miR-4421	CLIP-seq
MIRT875325	hsa-miR-4433	CLIP-seq
MIRT875326	hsa-miR-4435	CLIP-seq
MIRT875327	hsa-miR-4453	CLIP-seq
MIRT875328	hsa-miR-4478	CLIP-seq
MIRT875329	hsa-miR-4536	CLIP-seq
MIRT875330	hsa-miR-4538	CLIP-seq
MIRT875331	hsa-miR-4649-3p	CLIP-seq
MIRT875332	hsa-miR-4662a-5p	CLIP-seq
MIRT875333	hsa-miR-4676-5p	CLIP-seq
MIRT875334	hsa-miR-4684-5p	CLIP-seq
MIRT875335	hsa-miR-4690-5p	CLIP-seq
MIRT875336	hsa-miR-4701-5p	CLIP-seq
MIRT875337	hsa-miR-4722-5p	CLIP-seq
MIRT875338	hsa-miR-4768-3p	CLIP-seq
MIRT875339	hsa-miR-4786-5p	CLIP-seq
MIRT875340	hsa-miR-485-5p	CLIP-seq
MIRT875341	hsa-miR-548p	CLIP-seq
MIRT875342	hsa-miR-548s	CLIP-seq
MIRT875343	hsa-miR-550a	CLIP-seq
MIRT875344	hsa-miR-575	CLIP-seq
MIRT875345	hsa-miR-588	CLIP-seq
MIRT875346	hsa-miR-593	CLIP-seq
MIRT875347	hsa-miR-648	CLIP-seq
MIRT875348	hsa-miR-940	CLIP-seq
MIRT875315	hsa-miR-142-3p	CLIP-seq
MIRT875316	hsa-miR-1909	CLIP-seq
MIRT875318	hsa-miR-3187-3p	CLIP-seq
MIRT1959519	hsa-miR-3614-5p	CLIP-seq
MIRT875320	hsa-miR-3926	CLIP-seq
MIRT875321	hsa-miR-3929	CLIP-seq
MIRT875322	hsa-miR-3934	CLIP-seq
MIRT875323	hsa-miR-4419b	CLIP-seq
MIRT875325	hsa-miR-4433	CLIP-seq
MIRT875326	hsa-miR-4435	CLIP-seq
MIRT875327	hsa-miR-4453	CLIP-seq
MIRT875328	hsa-miR-4478	CLIP-seq
MIRT875329	hsa-miR-4536	CLIP-seq
MIRT875330	hsa-miR-4538	CLIP-seq
MIRT875331	hsa-miR-4649-3p	CLIP-seq
MIRT875332	hsa-miR-4662a-5p	CLIP-seq
MIRT875333	hsa-miR-4676-5p	CLIP-seq
MIRT875335	hsa-miR-4690-5p	CLIP-seq
MIRT875336	hsa-miR-4701-5p	CLIP-seq
MIRT875337	hsa-miR-4722-5p	CLIP-seq
MIRT1959520	hsa-miR-4767	CLIP-seq
MIRT875338	hsa-miR-4768-3p	CLIP-seq
MIRT875339	hsa-miR-4786-5p	CLIP-seq
MIRT875340	hsa-miR-485-5p	CLIP-seq
MIRT875342	hsa-miR-548s	CLIP-seq
MIRT875343	hsa-miR-550a	CLIP-seq
MIRT875344	hsa-miR-575	CLIP-seq
MIRT875345	hsa-miR-588	CLIP-seq
MIRT875347	hsa-miR-648	CLIP-seq
MIRT875348	hsa-miR-940	CLIP-seq
MIRT2196499	hsa-miR-22	CLIP-seq
MIRT875318	hsa-miR-3187-3p	CLIP-seq
MIRT1959519	hsa-miR-3614-5p	CLIP-seq
MIRT2196500	hsa-miR-3921	CLIP-seq
MIRT875320	hsa-miR-3926	CLIP-seq
MIRT875321	hsa-miR-3929	CLIP-seq
MIRT875323	hsa-miR-4419b	CLIP-seq
MIRT875325	hsa-miR-4433	CLIP-seq
MIRT875326	hsa-miR-4435	CLIP-seq
MIRT875327	hsa-miR-4453	CLIP-seq
MIRT875328	hsa-miR-4478	CLIP-seq
MIRT875330	hsa-miR-4538	CLIP-seq
MIRT875331	hsa-miR-4649-3p	CLIP-seq
MIRT2196501	hsa-miR-4653-5p	CLIP-seq
MIRT875336	hsa-miR-4701-5p	CLIP-seq
MIRT875337	hsa-miR-4722-5p	CLIP-seq
MIRT1959520	hsa-miR-4767	CLIP-seq
MIRT875338	hsa-miR-4768-3p	CLIP-seq
MIRT875339	hsa-miR-4786-5p	CLIP-seq
MIRT875340	hsa-miR-485-5p	CLIP-seq
MIRT875342	hsa-miR-548s	CLIP-seq
MIRT875345	hsa-miR-588	CLIP-seq
MIRT875348	hsa-miR-940	CLIP-seq
MIRT875316	hsa-miR-1909	CLIP-seq
MIRT875317	hsa-miR-3132	CLIP-seq
MIRT875335	hsa-miR-4690-5p	CLIP-seq
MIRT875312	hsa-miR-10a	CLIP-seq
MIRT875313	hsa-miR-10b	CLIP-seq
MIRT875319	hsa-miR-339-5p	CLIP-seq
MIRT875322	hsa-miR-3934	CLIP-seq
MIRT875324	hsa-miR-4421	CLIP-seq
MIRT875329	hsa-miR-4536	CLIP-seq
MIRT875332	hsa-miR-4662a-5p	CLIP-seq
MIRT875333	hsa-miR-4676-5p	CLIP-seq
MIRT875334	hsa-miR-4684-5p	CLIP-seq
MIRT875337	hsa-miR-4722-5p	CLIP-seq
MIRT875338	hsa-miR-4768-3p	CLIP-seq
MIRT2446600	hsa-miR-548c-3p	CLIP-seq
MIRT875344	hsa-miR-575	CLIP-seq
MIRT875346	hsa-miR-593	CLIP-seq
MIRT875348	hsa-miR-940	CLIP-seq
MIRT875312	hsa-miR-10a	CLIP-seq
MIRT875313	hsa-miR-10b	CLIP-seq
MIRT875315	hsa-miR-142-3p	CLIP-seq
MIRT875319	hsa-miR-339-5p	CLIP-seq
MIRT875322	hsa-miR-3934	CLIP-seq
MIRT875324	hsa-miR-4421	CLIP-seq
MIRT875329	hsa-miR-4536	CLIP-seq
MIRT875332	hsa-miR-4662a-5p	CLIP-seq
MIRT875333	hsa-miR-4676-5p	CLIP-seq
MIRT875334	hsa-miR-4684-5p	CLIP-seq
MIRT875337	hsa-miR-4722-5p	CLIP-seq
MIRT875338	hsa-miR-4768-3p	CLIP-seq
MIRT2446600	hsa-miR-548c-3p	CLIP-seq
MIRT875341	hsa-miR-548p	CLIP-seq
MIRT875344	hsa-miR-575	CLIP-seq
MIRT875346	hsa-miR-593	CLIP-seq
MIRT875347	hsa-miR-648	CLIP-seq
MIRT875348	hsa-miR-940	CLIP-seq
MIRT875312	hsa-miR-10a	CLIP-seq
MIRT875313	hsa-miR-10b	CLIP-seq
MIRT875319	hsa-miR-339-5p	CLIP-seq
MIRT875322	hsa-miR-3934	CLIP-seq
MIRT875324	hsa-miR-4421	CLIP-seq
MIRT875329	hsa-miR-4536	CLIP-seq
MIRT875332	hsa-miR-4662a-5p	CLIP-seq
MIRT875333	hsa-miR-4676-5p	CLIP-seq
MIRT875334	hsa-miR-4684-5p	CLIP-seq
MIRT875337	hsa-miR-4722-5p	CLIP-seq
MIRT875338	hsa-miR-4768-3p	CLIP-seq
MIRT2446600	hsa-miR-548c-3p	CLIP-seq
MIRT875341	hsa-miR-548p	CLIP-seq
MIRT875344	hsa-miR-575	CLIP-seq
MIRT875346	hsa-miR-593	CLIP-seq
MIRT875348	hsa-miR-940	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFATC1	Activation	15879122;16219537
NFATC1	Repression	15879122
NFATC2	Repression	15879122;16219537
NFKB1	Activation	16219537

Gene ontology (GO) Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	NAS	29789755, 30976362
GO:0002376	Process	Immune system process	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0004888	Function	Transmembrane signaling receptor activity	IC	9485181
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IMP	12794121
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	31461748
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	NAS	9485181, 30976362
GO:0005886	Component	Plasma membrane	TAS
GO:0007163	Process	Establishment or maintenance of cell polarity	IMP	12407027
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	IC	9485181
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IMP	12407027
GO:0009897	Component	External side of plasma membrane	IBA
GO:0015031	Process	Protein transport	IMP	12794121
GO:0016020	Component	Membrane	IEA
GO:0030159	Function	Signaling receptor complex adaptor activity	NAS	12794121
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0042105	Component	Alpha-beta T cell receptor complex	IBA
GO:0042105	Component	Alpha-beta T cell receptor complex	IDA	9485181
GO:0042105	Component	Alpha-beta T cell receptor complex	IEA
GO:0042105	Component	Alpha-beta T cell receptor complex	IPI	31461748
GO:0042105	Component	Alpha-beta T cell receptor complex	ISS
GO:0042106	Component	Gamma-delta T cell receptor complex	NAS	16418397
GO:0042110	Process	T cell activation	NAS	12407027
GO:0042608	Function	T cell receptor binding	NAS	11186279
GO:0042802	Function	Identical protein binding	IDA	14967045
GO:0045059	Process	Positive thymic T cell selection	IBA
GO:0046629	Process	Gamma-delta T cell activation	NAS	30976362
GO:0046631	Process	Alpha-beta T cell activation	NAS	29789755
GO:0050852	Process	T cell receptor signaling pathway	NAS	29789755, 30976362
GO:0065003	Process	Protein-containing complex assembly	NAS	12794121
GO:0070228	Process	Regulation of lymphocyte apoptotic process	IMP	12407027

Other IDs

• MIM: 186740
• HGNC: 1675
• e!Ensembl: ENSG00000160654

Protein

• UniProt ID: P09693
• Protein name: T-cell surface glycoprotein CD3 gamma chain (T-cell receptor T3 gamma chain) (CD antigen CD3g)
• Protein function: Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell
• PDB: 1SY6 , 6JXR , 7FJD , 7FJE , 7FJF , 7PHR , 7Q5U , 8ES7 , 8ES8 , 8ES9 , 8JC0 , 8JCB , 8TW4 , 8TW6 , 8WXE , 8WY0 , 8WYI , 8YC0 , 9BBC , 9C3E , 9CI8 , 9CIA , 9CQ4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02189	ITAM	157 → 176	Immunoreceptor tyrosine-based activation motif	Motif
  PF16680	Ig_4	39 → 115	T-cell surface glycoprotein CD3 delta chain	Domain

• Sequence:

  MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGK
  MIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLF
  AEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLR
  RN

• Sequence length: 182

Pathways

KEGG Pathway	Reactome Pathway
Hematopoietic cell lineage	Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Th1 and Th2 cell differentiation	Downstream TCR signaling
Th17 cell differentiation	Phosphorylation of CD3 and TCR zeta chains
T cell receptor signaling pathway	Translocation of ZAP-70 to Immunological synapse
Chagas disease	Generation of second messenger molecules
Measles	FCGR activation
Human T-cell leukemia virus 1 infection	Regulation of actin dynamics for phagocytic cup formation
Epstein-Barr virus infection	Role of phospholipids in phagocytosis
Human immunodeficiency virus 1 infection	PD-1 signaling
PD-L1 expression and PD-1 checkpoint pathway in cancer	Cargo recognition for clathrin-mediated endocytosis
	Clathrin-mediated endocytosis
	FCGR3A-mediated IL10 synthesis
	FCGR3A-mediated phagocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Combined immunodeficiency due to CD3gamma deficiency	Pathogenic; Likely pathogenic	rs2134069699, rs199676861, rs2134068305, rs201529449, rs1440888766, rs2496901413, rs2496908575, rs104894199, rs483352927, rs1948388503, rs570768621, rs1948335884	RCV001382623 RCV000087023 RCV001994521 RCV001956130 RCV002721314 RCV002801149 RCV002922630 RCV000087021 RCV000087022 RCV003744359 RCV000651962 RCV000704172 RCV001239548	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Severe combined immunodeficiency disease	Likely pathogenic; Pathogenic	rs1948391148, rs1948418139, rs570768621	RCV002266218 RCV002281890 RCV002282292 RCV002271572	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (7)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CD3G-related disorder	Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 17	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunodeficiency due to defect in CD3-gamma	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	38469033	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE COMBINED IMMUNODEFICIENCY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

LCK 3 shared diseasesCombined immunodeficiency disease, Immunodeficiency, Severe combined immunodeficiency 10 shared pathwaysTh1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, Human T-cell leukemia virus 1 infection, PD-L1 expression and PD-1 checkpoint pathway in cancer, Downstream TCR signaling, Phosphorylation of CD3 and TCR zeta chains, PD-1 signaling, Generation of second messenger molecules, Translocation of ZAP-70 to Immunological synapse 5 shared evidence sourcesOrphanet (Combined immunodeficiency disease), HPO (Immunodeficiency), Disgenet (Immunodeficiency), CTD (Immunodeficiency), Disgenet (Severe combined immunodeficiency) Related via 10 shared pathways including Th1 and Th2 cell differentiation, Th17 cell differentiation — evidence mostly Disgenet. STK4 3 shared diseasesCombined immunodeficiency disease, Immunodeficiency, Severe combined immunodeficiency 8 shared evidence sourcesClinGen (Combined immunodeficiency disease), Disgenet (Combined immunodeficiency disease), Orphanet (Combined immunodeficiency disease), ClinVar (Combined immunodeficiency disease), HPO (Immunodeficiency), Disgenet (Immunodeficiency), CTD (Immunodeficiency), Disgenet (Severe combined immunodeficiency) Related via 3 shared diseases including Combined immunodeficiency disease, Immunodeficiency — evidence mostly Disgenet. ZAP70 3 shared diseasesCombined immunodeficiency disease, Immunodeficiency, Severe combined immunodeficiency 6 shared pathwaysTh1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, PD-L1 expression and PD-1 checkpoint pathway in cancer, Generation of second messenger molecules, Translocation of ZAP-70 to Immunological synapse 9 shared evidence sourcesClinGen (Combined immunodeficiency disease), Disgenet (Combined immunodeficiency disease), GWAS catalog (Combined immunodeficiency disease), Orphanet (Combined immunodeficiency disease), ClinVar (Combined immunodeficiency disease), HPO (Immunodeficiency), Disgenet (Immunodeficiency), CTD (Immunodeficiency), Disgenet (Severe combined immunodeficiency) Related via 6 shared pathways including Th1 and Th2 cell differentiation, Th17 cell differentiation — evidence mostly Disgenet. CD3E 2 shared diseasesImmunodeficiency, Severe combined immunodeficiency 16 shared pathwaysHematopoietic cell lineage, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, Chagas disease, Measles, Human T-cell leukemia virus 1 infection, Epstein-Barr virus infection, Human immunodeficiency virus 1 infection, PD-L1 expression and PD-1 checkpoint pathway in cancer, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell, Downstream TCR signaling +4 more 4 shared evidence sourcesHPO (Immunodeficiency), Disgenet (Immunodeficiency), CTD (Immunodeficiency), Disgenet (Severe combined immunodeficiency) Related via 16 shared pathways including Hematopoietic cell lineage, Th1 and Th2 cell differentiation — evidence mostly Disgenet. MALT1 3 shared diseasesCombined immunodeficiency disease, Immunodeficiency, Severe combined immunodeficiency 2 shared pathwaysT cell receptor signaling pathway, Downstream TCR signaling 8 shared evidence sourcesClinGen (Combined immunodeficiency disease), Disgenet (Combined immunodeficiency disease), Orphanet (Combined immunodeficiency disease), ClinVar (Combined immunodeficiency disease), HPO (Immunodeficiency), Disgenet (Immunodeficiency), CTD (Immunodeficiency), Disgenet (Severe combined immunodeficiency) Related via 3 shared diseases including Combined immunodeficiency disease, Immunodeficiency — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
LCK	3	["Combined immunodeficiency disease","Immunodeficiency","Severe combined immunodeficiency"]	10	["Th1 and Th2 cell differentiation","Th17 cell differentiation","T cell receptor signaling pathway","Human T-cell leukemia virus 1 infection","PD-L1 expression and PD-1 checkpoint pathway in cancer","Downstream TCR signaling","Phosphorylation of CD3 and TCR zeta chains","PD-1 signaling","Generation of second messenger molecules","Translocation of ZAP-70 to Immunological synapse"]	5	["Orphanet (Combined immunodeficiency disease)","HPO (Immunodeficiency)","Disgenet (Immunodeficiency)","CTD (Immunodeficiency)","Disgenet (Severe combined immunodeficiency)"]
STK4	3	["Combined immunodeficiency disease","Immunodeficiency","Severe combined immunodeficiency"]	0	[]	8	["ClinGen (Combined immunodeficiency disease)","Disgenet (Combined immunodeficiency disease)","Orphanet (Combined immunodeficiency disease)","ClinVar (Combined immunodeficiency disease)","HPO (Immunodeficiency)","Disgenet (Immunodeficiency)","CTD (Immunodeficiency)","Disgenet (Severe combined immunodeficiency)"]
ZAP70	3	["Combined immunodeficiency disease","Immunodeficiency","Severe combined immunodeficiency"]	6	["Th1 and Th2 cell differentiation","Th17 cell differentiation","T cell receptor signaling pathway","PD-L1 expression and PD-1 checkpoint pathway in cancer","Generation of second messenger molecules","Translocation of ZAP-70 to Immunological synapse"]	9	["ClinGen (Combined immunodeficiency disease)","Disgenet (Combined immunodeficiency disease)","GWAS catalog (Combined immunodeficiency disease)","Orphanet (Combined immunodeficiency disease)","ClinVar (Combined immunodeficiency disease)","HPO (Immunodeficiency)","Disgenet (Immunodeficiency)","CTD (Immunodeficiency)","Disgenet (Severe combined immunodeficiency)"]
CD3E	2	["Immunodeficiency","Severe combined immunodeficiency"]	16	["Hematopoietic cell lineage","Th1 and Th2 cell differentiation","Th17 cell differentiation","T cell receptor signaling pathway","Chagas disease","Measles","Human T-cell leukemia virus 1 infection","Epstein-Barr virus infection","Human immunodeficiency virus 1 infection","PD-L1 expression and PD-1 checkpoint pathway in cancer","Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell","Downstream TCR signaling"]	4	["HPO (Immunodeficiency)","Disgenet (Immunodeficiency)","CTD (Immunodeficiency)","Disgenet (Severe combined immunodeficiency)"]
MALT1	3	["Combined immunodeficiency disease","Immunodeficiency","Severe combined immunodeficiency"]	2	["T cell receptor signaling pathway","Downstream TCR signaling"]	8	["ClinGen (Combined immunodeficiency disease)","Disgenet (Combined immunodeficiency disease)","Orphanet (Combined immunodeficiency disease)","ClinVar (Combined immunodeficiency disease)","HPO (Immunodeficiency)","Disgenet (Immunodeficiency)","CTD (Immunodeficiency)","Disgenet (Severe combined immunodeficiency)"]

Diseases Linked via Similar Genes

severe combined immunodeficiency due to LCK deficiency Linked via 1 of 5 related genesLCK Bipolar disorder Linked via 1 of 5 related genesSTK4 Bipolar depression Linked via 1 of 5 related genesSTK4 Major depressive disorder Linked via 1 of 5 related genesSTK4 Schizophrenia Linked via 1 of 5 related genesSTK4

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
severe combined immunodeficiency due to LCK deficiency	1	["LCK"]
Bipolar disorder	1	["STK4"]
Bipolar depression	1	["STK4"]
Major depressive disorder	1	["STK4"]
Schizophrenia	1	["STK4"]