CCNC (cyclin C)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 892
• Gene name: Cyclin C
• Gene symbol: CCNC
• Synonyms (NCBI Gene): CycC, SRB11, hSRB11
• Chromosome: 6
• Chromosome location: 6q16.2
• Summary: The protein encoded by this gene is a member of the cyclin family of proteins. The encoded protein interacts with cyclin-dependent kinase 8 and induces the phophorylation of the carboxy-terminal domain of the large subunit of RNA polymerase II. The level

miRNA Show/Hide all (192)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019265	hsa-miR-148b-3p	Microarray	17612493
MIRT051792	hsa-let-7c-5p	CLASH	23622248
MIRT871252	hsa-miR-1343	CLIP-seq
MIRT871253	hsa-miR-219-5p	CLIP-seq
MIRT871254	hsa-miR-3148	CLIP-seq
MIRT871255	hsa-miR-338-3p	CLIP-seq
MIRT871256	hsa-miR-3607-3p	CLIP-seq
MIRT871257	hsa-miR-3686	CLIP-seq
MIRT871258	hsa-miR-4310	CLIP-seq
MIRT871259	hsa-miR-4326	CLIP-seq
MIRT871260	hsa-miR-4445	CLIP-seq
MIRT871261	hsa-miR-4668-5p	CLIP-seq
MIRT871262	hsa-miR-4698	CLIP-seq
MIRT871263	hsa-miR-4782-3p	CLIP-seq
MIRT871264	hsa-miR-4802-5p	CLIP-seq
MIRT871265	hsa-miR-508-3p	CLIP-seq
MIRT871266	hsa-miR-522	CLIP-seq
MIRT871267	hsa-miR-605	CLIP-seq
MIRT871268	hsa-miR-607	CLIP-seq
MIRT871269	hsa-miR-1257	CLIP-seq
MIRT871270	hsa-miR-1279	CLIP-seq
MIRT871271	hsa-miR-1284	CLIP-seq
MIRT871272	hsa-miR-25	CLIP-seq
MIRT871273	hsa-miR-31	CLIP-seq
MIRT871274	hsa-miR-3146	CLIP-seq
MIRT871275	hsa-miR-32	CLIP-seq
MIRT871276	hsa-miR-363	CLIP-seq
MIRT871277	hsa-miR-3653	CLIP-seq
MIRT871278	hsa-miR-3658	CLIP-seq
MIRT871279	hsa-miR-367	CLIP-seq
MIRT871280	hsa-miR-371-5p	CLIP-seq
MIRT871281	hsa-miR-378g	CLIP-seq
MIRT871282	hsa-miR-3920	CLIP-seq
MIRT871283	hsa-miR-3929	CLIP-seq
MIRT871284	hsa-miR-3973	CLIP-seq
MIRT871285	hsa-miR-4325	CLIP-seq
MIRT871286	hsa-miR-4419b	CLIP-seq
MIRT871287	hsa-miR-4427	CLIP-seq
MIRT871288	hsa-miR-4478	CLIP-seq
MIRT871289	hsa-miR-4505	CLIP-seq
MIRT871262	hsa-miR-4698	CLIP-seq
MIRT871290	hsa-miR-4724-5p	CLIP-seq
MIRT871291	hsa-miR-4795-3p	CLIP-seq
MIRT871292	hsa-miR-520g	CLIP-seq
MIRT871293	hsa-miR-520h	CLIP-seq
MIRT871294	hsa-miR-544	CLIP-seq
MIRT871295	hsa-miR-548l	CLIP-seq
MIRT871296	hsa-miR-584	CLIP-seq
MIRT871297	hsa-miR-606	CLIP-seq
MIRT871268	hsa-miR-607	CLIP-seq
MIRT871298	hsa-miR-645	CLIP-seq
MIRT871299	hsa-miR-656	CLIP-seq
MIRT871300	hsa-miR-92a	CLIP-seq
MIRT871301	hsa-miR-92b	CLIP-seq
MIRT871270	hsa-miR-1279	CLIP-seq
MIRT871271	hsa-miR-1284	CLIP-seq
MIRT871272	hsa-miR-25	CLIP-seq
MIRT1958680	hsa-miR-299-5p	CLIP-seq
MIRT1958681	hsa-miR-3145-5p	CLIP-seq
MIRT871274	hsa-miR-3146	CLIP-seq
MIRT871275	hsa-miR-32	CLIP-seq
MIRT1958682	hsa-miR-3545-5p	CLIP-seq
MIRT871276	hsa-miR-363	CLIP-seq
MIRT871279	hsa-miR-367	CLIP-seq
MIRT1958683	hsa-miR-3691-3p	CLIP-seq
MIRT871285	hsa-miR-4325	CLIP-seq
MIRT1958684	hsa-miR-4711-5p	CLIP-seq
MIRT871290	hsa-miR-4724-5p	CLIP-seq
MIRT871294	hsa-miR-544	CLIP-seq
MIRT1958685	hsa-miR-579	CLIP-seq
MIRT1958686	hsa-miR-590-3p	CLIP-seq
MIRT871299	hsa-miR-656	CLIP-seq
MIRT871300	hsa-miR-92a	CLIP-seq
MIRT871301	hsa-miR-92b	CLIP-seq
MIRT2195425	hsa-miR-2681	CLIP-seq
MIRT1958685	hsa-miR-579	CLIP-seq
MIRT2195426	hsa-miR-1273e	CLIP-seq
MIRT871270	hsa-miR-1279	CLIP-seq
MIRT871271	hsa-miR-1284	CLIP-seq
MIRT871272	hsa-miR-25	CLIP-seq
MIRT2195425	hsa-miR-2681	CLIP-seq
MIRT871274	hsa-miR-3146	CLIP-seq
MIRT871275	hsa-miR-32	CLIP-seq
MIRT871276	hsa-miR-363	CLIP-seq
MIRT2195427	hsa-miR-3662	CLIP-seq
MIRT871279	hsa-miR-367	CLIP-seq
MIRT871284	hsa-miR-3973	CLIP-seq
MIRT871285	hsa-miR-4325	CLIP-seq
MIRT871292	hsa-miR-520g	CLIP-seq
MIRT871293	hsa-miR-520h	CLIP-seq
MIRT871295	hsa-miR-548l	CLIP-seq
MIRT871300	hsa-miR-92a	CLIP-seq
MIRT871301	hsa-miR-92b	CLIP-seq
MIRT2498738	hsa-miR-1	CLIP-seq
MIRT2498739	hsa-miR-1272	CLIP-seq
MIRT871270	hsa-miR-1279	CLIP-seq
MIRT2498740	hsa-miR-1297	CLIP-seq
MIRT2498741	hsa-miR-1322	CLIP-seq
MIRT871252	hsa-miR-1343	CLIP-seq
MIRT2498742	hsa-miR-193a-3p	CLIP-seq
MIRT2498743	hsa-miR-193b	CLIP-seq
MIRT2498744	hsa-miR-205	CLIP-seq
MIRT2498745	hsa-miR-206	CLIP-seq
MIRT871253	hsa-miR-219-5p	CLIP-seq
MIRT2498746	hsa-miR-26a	CLIP-seq
MIRT2498747	hsa-miR-26b	CLIP-seq
MIRT2498748	hsa-miR-2964a-5p	CLIP-seq
MIRT1958680	hsa-miR-299-5p	CLIP-seq
MIRT2498749	hsa-miR-3143	CLIP-seq
MIRT1958681	hsa-miR-3145-5p	CLIP-seq
MIRT2498750	hsa-miR-3176	CLIP-seq
MIRT2498751	hsa-miR-3185	CLIP-seq
MIRT2498752	hsa-miR-323-3p	CLIP-seq
MIRT2498753	hsa-miR-34c-3p	CLIP-seq
MIRT1958682	hsa-miR-3545-5p	CLIP-seq
MIRT871256	hsa-miR-3607-3p	CLIP-seq
MIRT2498754	hsa-miR-3617	CLIP-seq
MIRT2195427	hsa-miR-3662	CLIP-seq
MIRT2498755	hsa-miR-3669	CLIP-seq
MIRT871257	hsa-miR-3686	CLIP-seq
MIRT2498756	hsa-miR-3688-3p	CLIP-seq
MIRT1958683	hsa-miR-3691-3p	CLIP-seq
MIRT2498757	hsa-miR-3922-3p	CLIP-seq
MIRT871259	hsa-miR-4326	CLIP-seq
MIRT2498758	hsa-miR-4436b-5p	CLIP-seq
MIRT871260	hsa-miR-4445	CLIP-seq
MIRT2498759	hsa-miR-4465	CLIP-seq
MIRT2498760	hsa-miR-4477b	CLIP-seq
MIRT2498761	hsa-miR-4639-3p	CLIP-seq
MIRT2498762	hsa-miR-4676-5p	CLIP-seq
MIRT871290	hsa-miR-4724-5p	CLIP-seq
MIRT2498763	hsa-miR-4775	CLIP-seq
MIRT871263	hsa-miR-4782-3p	CLIP-seq
MIRT871265	hsa-miR-508-3p	CLIP-seq
MIRT2498764	hsa-miR-543	CLIP-seq
MIRT2498765	hsa-miR-575	CLIP-seq
MIRT1958685	hsa-miR-579	CLIP-seq
MIRT1958686	hsa-miR-590-3p	CLIP-seq
MIRT2498766	hsa-miR-599	CLIP-seq
MIRT871267	hsa-miR-605	CLIP-seq
MIRT2498767	hsa-miR-613	CLIP-seq
MIRT2498768	hsa-miR-641	CLIP-seq
MIRT2498769	hsa-miR-664	CLIP-seq
MIRT2498770	hsa-miR-676	CLIP-seq
MIRT1958685	hsa-miR-579	CLIP-seq
MIRT2498739	hsa-miR-1272	CLIP-seq
MIRT871270	hsa-miR-1279	CLIP-seq
MIRT2498740	hsa-miR-1297	CLIP-seq
MIRT2498741	hsa-miR-1322	CLIP-seq
MIRT871252	hsa-miR-1343	CLIP-seq
MIRT2498742	hsa-miR-193a-3p	CLIP-seq
MIRT2498743	hsa-miR-193b	CLIP-seq
MIRT2498744	hsa-miR-205	CLIP-seq
MIRT871253	hsa-miR-219-5p	CLIP-seq
MIRT2498746	hsa-miR-26a	CLIP-seq
MIRT2498747	hsa-miR-26b	CLIP-seq
MIRT2498748	hsa-miR-2964a-5p	CLIP-seq
MIRT1958680	hsa-miR-299-5p	CLIP-seq
MIRT2498749	hsa-miR-3143	CLIP-seq
MIRT1958681	hsa-miR-3145-5p	CLIP-seq
MIRT2498750	hsa-miR-3176	CLIP-seq
MIRT2498751	hsa-miR-3185	CLIP-seq
MIRT2498752	hsa-miR-323-3p	CLIP-seq
MIRT2498753	hsa-miR-34c-3p	CLIP-seq
MIRT1958682	hsa-miR-3545-5p	CLIP-seq
MIRT871256	hsa-miR-3607-3p	CLIP-seq
MIRT2498754	hsa-miR-3617	CLIP-seq
MIRT2195427	hsa-miR-3662	CLIP-seq
MIRT871257	hsa-miR-3686	CLIP-seq
MIRT2498756	hsa-miR-3688-3p	CLIP-seq
MIRT1958683	hsa-miR-3691-3p	CLIP-seq
MIRT2498757	hsa-miR-3922-3p	CLIP-seq
MIRT871259	hsa-miR-4326	CLIP-seq
MIRT2498758	hsa-miR-4436b-5p	CLIP-seq
MIRT871260	hsa-miR-4445	CLIP-seq
MIRT2498759	hsa-miR-4465	CLIP-seq
MIRT2498760	hsa-miR-4477b	CLIP-seq
MIRT2498761	hsa-miR-4639-3p	CLIP-seq
MIRT2498762	hsa-miR-4676-5p	CLIP-seq
MIRT871290	hsa-miR-4724-5p	CLIP-seq
MIRT2498763	hsa-miR-4775	CLIP-seq
MIRT871263	hsa-miR-4782-3p	CLIP-seq
MIRT871265	hsa-miR-508-3p	CLIP-seq
MIRT2498764	hsa-miR-543	CLIP-seq
MIRT2498765	hsa-miR-575	CLIP-seq
MIRT1958685	hsa-miR-579	CLIP-seq
MIRT1958686	hsa-miR-590-3p	CLIP-seq
MIRT2498766	hsa-miR-599	CLIP-seq
MIRT871267	hsa-miR-605	CLIP-seq
MIRT2498768	hsa-miR-641	CLIP-seq
MIRT2498769	hsa-miR-664	CLIP-seq
MIRT2498770	hsa-miR-676	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
YBX1	Repression	20596676

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IDA	21806996
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IPI	15084261
GO:0005515	Function	Protein binding	IPI	7568034, 15084261, 19047373, 19914168, 20098423, 21516116, 21806996, 23602568, 23746844, 25344755, 25416956, 25852190, 26502155, 29568061, 29997244, 31515488, 32296183, 32707033, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IEA
GO:0016592	Component	Mediator complex	IBA
GO:0016592	Component	Mediator complex	IEA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0045023	Process	G0 to G1 transition	IDA	15084261
GO:0045746	Process	Negative regulation of Notch signaling pathway	IDA	25344755
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15009212
GO:1990508	Component	CKM complex	IEA
GO:1990508	Component	CKM complex	IPI	19047373
GO:1990508	Component	CKM complex	ISS

Other IDs

• MIM: 123838
• HGNC: 1581
• e!Ensembl: ENSG00000112237

Protein

• UniProt ID: P24863
• Protein name: Cyclin-C (SRB11 homolog) (hSRB11)
• Protein function: Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal R
• PDB: 3RGF , 4CRL , 4F6S , 4F6U , 4F6W , 4F70 , 4F7J , 4F7L , 4F7N , 4F7S , 4G6L , 5BNJ , 5CEI , 5FGK , 5HBE , 5HBH , 5HBJ , 5HNB , 5HVY , 5I5Z , 5ICP , 5IDN , 5IDP , 5XQX , 5XS2 , 6QTG , 6QTJ , 6R3S , 6T41 , 6TPA , 6Y0A , 8TQ2 , 8TQC , 8TQW , 9H8C , 9H8S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00134	Cyclin_N	8 → 151	Cyclin, N-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highest levels in pancreas. High levels in heart, liver, skeletal muscle and kidney. Low levels in brain.
• Sequence:

  MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQ
  VIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRF
  SYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIV
  NDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQ
  WKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS

• Sequence length: 283

Pathways

Reactome Pathway

PPARA activates gene expression

Generic Transcription Pathway

SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription

Constitutive Signaling by NOTCH1 PEST Domain Mutants

Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants

Transcriptional regulation of white adipocyte differentiation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
CIC-rearranged sarcoma	not provided	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (32)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	8833152		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	15858123		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26452386, 28147342		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15863722	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12679910	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32462022	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24504440	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22379099		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	15858123	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29737445		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22379099	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31293642		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	30905399	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Disorders	Headache	Pubtator	30905399	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	30905399	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	27085780		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12679910		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26452386, 28147342		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22379099		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22379099	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24289491		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17089020, 24289491, 25344755, 31331961, 31382571, 8833152		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	36398965	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26042770		★☆☆☆☆ Found in Text Mining only
North Carolina macular dystrophy	North Carolina Macular Dystrophy	BEFREE	28973654		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17089020, 22379099		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22379099	Associate	★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	25344755		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24504440		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17229543, 35343092	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31331961		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	29440396		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CDK8 5 shared pathwaysPPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation, Constitutive Signaling by NOTCH1 PEST Domain Mutants, Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants, SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription Related via 5 shared pathways including PPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation. MED6 2 shared pathwaysPPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation Related via 2 shared pathways including PPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation. MED8 2 shared pathwaysPPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation Related via 2 shared pathways including PPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation. MED19 2 shared pathwaysPPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation Related via 2 shared pathways including PPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation. CDK19 2 shared pathwaysPPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation Related via 2 shared pathways including PPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CDK8	0	[]	5	["PPARA activates gene expression","Transcriptional regulation of white adipocyte differentiation","Constitutive Signaling by NOTCH1 PEST Domain Mutants","Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants","SMAD2\/SMAD3:SMAD4 heterotrimer regulates transcription"]	0	[]
MED6	0	[]	2	["PPARA activates gene expression","Transcriptional regulation of white adipocyte differentiation"]	0	[]
MED8	0	[]	2	["PPARA activates gene expression","Transcriptional regulation of white adipocyte differentiation"]	0	[]
MED19	0	[]	2	["PPARA activates gene expression","Transcriptional regulation of white adipocyte differentiation"]	0	[]
CDK19	0	[]	2	["PPARA activates gene expression","Transcriptional regulation of white adipocyte differentiation"]	0	[]

Diseases Linked via Similar Genes

Major depressive disorder Linked via 2 of 5 related genesCDK8, CDK19 Bipolar disorder Linked via 1 of 5 related genesCDK8 Dilated cardiomyopathy Linked via 1 of 5 related genesCDK8 Color vision deficiency Linked via 1 of 5 related genesCDK8 Common atrium Linked via 1 of 5 related genesCDK8

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Major depressive disorder	2	["CDK8","CDK19"]
Bipolar disorder	1	["CDK8"]
Dilated cardiomyopathy	1	["CDK8"]
Color vision deficiency	1	["CDK8"]
Common atrium	1	["CDK8"]