Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	598
Gene name	BCL2 like 1
Gene symbol	BCL2L1
Synonyms (NCBI Gene)	BCL-XL/SBCL2LBCLXBcl-XPPP1R52
Chromosome	20
Chromosome location	20q11.21
Summary	The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gen

572 Show/Hide all (572)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004285	hsa-miR-491-5p	Luciferase reporter assayWestern blot	20039318
MIRT004490	hsa-let-7g-5p	Luciferase reporter assayqRT-PCRWestern blot	20347499
MIRT004491	hsa-let-7c-5p	Luciferase reporter assayqRT-PCRWestern blot	20347499
MIRT004491	hsa-let-7c-5p	Luciferase reporter assayqRT-PCRWestern blot	22917031
MIRT004491	hsa-let-7c-5p	Luciferase reporter assayqRT-PCRWestern blot	22917031
MIRT023334	hsa-miR-122-5p	Western blot;qRT-PCR	18692484
MIRT028457	hsa-miR-30a-5p	Proteomics	18668040
MIRT052647	hsa-miR-133a-3p	Luciferase reporter assayWestern blot	23756231
MIRT046292	hsa-miR-23b-3p	CLASH	23622248
MIRT042070	hsa-miR-484	CLASH	23622248
MIRT004285	hsa-miR-491-5p	Flow cytometryGFP reporterQRTPCRWestern blot	23519249
MIRT528165	hsa-miR-449b-3p	PAR-CLIP	22012620
MIRT528164	hsa-miR-4691-3p	PAR-CLIP	22012620
MIRT528163	hsa-miR-361-3p	PAR-CLIP	22012620
MIRT528162	hsa-miR-4722-3p	PAR-CLIP	22012620
MIRT528161	hsa-miR-6727-3p	PAR-CLIP	22012620
MIRT528160	hsa-miR-6747-3p	PAR-CLIP	22012620
MIRT528159	hsa-miR-1976	PAR-CLIP	22012620
MIRT528158	hsa-miR-1913	PAR-CLIP	22012620
MIRT528157	hsa-miR-324-3p	PAR-CLIP	22012620
MIRT528156	hsa-miR-4313	PAR-CLIP	22012620
MIRT528155	hsa-miR-587	PAR-CLIP	22012620
MIRT528154	hsa-miR-4749-3p	PAR-CLIP	22012620
MIRT455304	hsa-miR-6858-3p	PAR-CLIP	23592263
MIRT455303	hsa-miR-4676-5p	PAR-CLIP	23592263
MIRT455302	hsa-miR-575	PAR-CLIP	23592263
MIRT455300	hsa-miR-4779	PAR-CLIP	23592263
MIRT455301	hsa-miR-4257	PAR-CLIP	23592263
MIRT455299	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT455298	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT455297	hsa-miR-4784	PAR-CLIP	23592263
MIRT455296	hsa-miR-4419a	PAR-CLIP	23592263
MIRT455295	hsa-miR-4510	PAR-CLIP	23592263
MIRT455294	hsa-miR-6127	PAR-CLIP	23592263
MIRT455293	hsa-miR-6129	PAR-CLIP	23592263
MIRT455292	hsa-miR-6130	PAR-CLIP	23592263
MIRT455291	hsa-miR-6133	PAR-CLIP	23592263
MIRT455290	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT455289	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT455288	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT455287	hsa-miR-4710	PAR-CLIP	23592263
MIRT455286	hsa-miR-198	PAR-CLIP	23592263
MIRT455285	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT455284	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT455283	hsa-miR-1287-3p	PAR-CLIP	23592263
MIRT455282	hsa-miR-4689	PAR-CLIP	23592263
MIRT455281	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT441111	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441111	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT004285	hsa-miR-491-5p	Luciferase reporter assay	24747968
MIRT731772	hsa-miR-133b	ChIP-seqLuciferase reporter assayqRT-PCRWestern blot	26276722
MIRT731772	hsa-miR-133b	ChIP-seqLuciferase reporter assayqRT-PCRWestern blot	26276722
MIRT052647	hsa-miR-133a-3p	ChIP-seqLuciferase reporter assayqRT-PCRWestern blot	26276722
MIRT052647	hsa-miR-133a-3p	ChIP-seqLuciferase reporter assayqRT-PCRWestern blot	26276722
MIRT528157	hsa-miR-324-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	27245778
MIRT455289	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT455289	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT455283	hsa-miR-1287-3p	PAR-CLIP	26701625
MIRT455283	hsa-miR-1287-3p	PAR-CLIP	26701625
MIRT455286	hsa-miR-198	PAR-CLIP	26701625
MIRT455286	hsa-miR-198	PAR-CLIP	26701625
MIRT455298	hsa-miR-3150b-3p	PAR-CLIP	26701625
MIRT455298	hsa-miR-3150b-3p	PAR-CLIP	26701625
MIRT455301	hsa-miR-4257	PAR-CLIP	26701625
MIRT455301	hsa-miR-4257	PAR-CLIP	26701625
MIRT455296	hsa-miR-4419a	PAR-CLIP	26701625
MIRT455296	hsa-miR-4419a	PAR-CLIP	26701625
MIRT455296	hsa-miR-4419a	PAR-CLIP	26701625
MIRT455295	hsa-miR-4510	PAR-CLIP	26701625
MIRT455295	hsa-miR-4510	PAR-CLIP	26701625
MIRT455295	hsa-miR-4510	PAR-CLIP	26701625
MIRT455299	hsa-miR-455-3p	PAR-CLIP	26701625
MIRT455299	hsa-miR-455-3p	PAR-CLIP	26701625
MIRT455303	hsa-miR-4676-5p	PAR-CLIP	26701625
MIRT455303	hsa-miR-4676-5p	PAR-CLIP	26701625
MIRT455282	hsa-miR-4689	PAR-CLIP	26701625
MIRT455282	hsa-miR-4689	PAR-CLIP	26701625
MIRT455287	hsa-miR-4710	PAR-CLIP	26701625
MIRT455287	hsa-miR-4710	PAR-CLIP	26701625
MIRT455300	hsa-miR-4779	PAR-CLIP	26701625
MIRT455300	hsa-miR-4779	PAR-CLIP	26701625
MIRT455297	hsa-miR-4784	PAR-CLIP	26701625
MIRT455297	hsa-miR-4784	PAR-CLIP	26701625
MIRT455285	hsa-miR-520a-5p	PAR-CLIP	26701625
MIRT455285	hsa-miR-520a-5p	PAR-CLIP	26701625
MIRT455284	hsa-miR-525-5p	PAR-CLIP	26701625
MIRT455284	hsa-miR-525-5p	PAR-CLIP	26701625
MIRT455302	hsa-miR-575	PAR-CLIP	26701625
MIRT455302	hsa-miR-575	PAR-CLIP	26701625
MIRT455294	hsa-miR-6127	PAR-CLIP	26701625
MIRT455294	hsa-miR-6127	PAR-CLIP	26701625
MIRT455294	hsa-miR-6127	PAR-CLIP	26701625
MIRT455293	hsa-miR-6129	PAR-CLIP	26701625
MIRT455293	hsa-miR-6129	PAR-CLIP	26701625
MIRT455293	hsa-miR-6129	PAR-CLIP	26701625
MIRT455292	hsa-miR-6130	PAR-CLIP	26701625
MIRT455292	hsa-miR-6130	PAR-CLIP	26701625
MIRT455292	hsa-miR-6130	PAR-CLIP	26701625
MIRT455291	hsa-miR-6133	PAR-CLIP	26701625
MIRT455291	hsa-miR-6133	PAR-CLIP	26701625
MIRT455291	hsa-miR-6133	PAR-CLIP	26701625
MIRT455288	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT455288	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT455304	hsa-miR-6858-3p	PAR-CLIP	26701625
MIRT455304	hsa-miR-6858-3p	PAR-CLIP	26701625
MIRT455281	hsa-miR-6858-5p	PAR-CLIP	26701625
MIRT455281	hsa-miR-6858-5p	PAR-CLIP	26701625
MIRT455290	hsa-miR-7854-3p	PAR-CLIP	26701625
MIRT455290	hsa-miR-7854-3p	PAR-CLIP	26701625
MIRT732574	hsa-miR-1269a	MicroarrayqRT-PCR	34258170
MIRT732576	hsa-miR-193b-3p	MicroarrayqRT-PCR	34258170
MIRT734463	hsa-miR-663b	ELISAFlow cytometryLuciferase reporter assayqRT-PCRWestern blotting	32346421
MIRT528165	hsa-miR-449b-3p	PAR-CLIP	22012620
MIRT528164	hsa-miR-4691-3p	PAR-CLIP	22012620
MIRT528163	hsa-miR-361-3p	PAR-CLIP	22012620
MIRT528162	hsa-miR-4722-3p	PAR-CLIP	22012620
MIRT528161	hsa-miR-6727-3p	PAR-CLIP	22012620
MIRT528160	hsa-miR-6747-3p	PAR-CLIP	22012620
MIRT528159	hsa-miR-1976	PAR-CLIP	22012620
MIRT528158	hsa-miR-1913	PAR-CLIP	22012620
MIRT528157	hsa-miR-324-3p	PAR-CLIP	22012620
MIRT528156	hsa-miR-4313	PAR-CLIP	22012620
MIRT528155	hsa-miR-587	PAR-CLIP	22012620
MIRT528154	hsa-miR-4749-3p	PAR-CLIP	22012620
MIRT455304	hsa-miR-6858-3p	PAR-CLIP	23592263
MIRT455303	hsa-miR-4676-5p	PAR-CLIP	23592263
MIRT455302	hsa-miR-575	PAR-CLIP	23592263
MIRT455300	hsa-miR-4779	PAR-CLIP	23592263
MIRT455301	hsa-miR-4257	PAR-CLIP	23592263
MIRT455299	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT455298	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT455297	hsa-miR-4784	PAR-CLIP	23592263
MIRT455296	hsa-miR-4419a	PAR-CLIP	23592263
MIRT455295	hsa-miR-4510	PAR-CLIP	23592263
MIRT455294	hsa-miR-6127	PAR-CLIP	23592263
MIRT455293	hsa-miR-6129	PAR-CLIP	23592263
MIRT455292	hsa-miR-6130	PAR-CLIP	23592263
MIRT455291	hsa-miR-6133	PAR-CLIP	23592263
MIRT455290	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT455289	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT455288	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT455287	hsa-miR-4710	PAR-CLIP	23592263
MIRT455286	hsa-miR-198	PAR-CLIP	23592263
MIRT455285	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT455284	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT455283	hsa-miR-1287-3p	PAR-CLIP	23592263
MIRT455282	hsa-miR-4689	PAR-CLIP	23592263
MIRT455281	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT818887	hsa-miR-1252	CLIP-seq
MIRT818888	hsa-miR-1255a	CLIP-seq
MIRT818889	hsa-miR-1255b	CLIP-seq
MIRT818890	hsa-miR-1275	CLIP-seq
MIRT818891	hsa-miR-1276	CLIP-seq
MIRT818892	hsa-miR-2110	CLIP-seq
MIRT818893	hsa-miR-3150a-3p	CLIP-seq
MIRT818894	hsa-miR-3151	CLIP-seq
MIRT818895	hsa-miR-3175	CLIP-seq
MIRT818896	hsa-miR-3202	CLIP-seq
MIRT818897	hsa-miR-331-3p	CLIP-seq
MIRT818898	hsa-miR-342-5p	CLIP-seq
MIRT818899	hsa-miR-3591-5p	CLIP-seq
MIRT818900	hsa-miR-3649	CLIP-seq
MIRT818901	hsa-miR-3662	CLIP-seq
MIRT818902	hsa-miR-377	CLIP-seq
MIRT818903	hsa-miR-4271	CLIP-seq
MIRT818904	hsa-miR-4303	CLIP-seq
MIRT818905	hsa-miR-4314	CLIP-seq
MIRT818906	hsa-miR-4325	CLIP-seq
MIRT818907	hsa-miR-4447	CLIP-seq
MIRT818908	hsa-miR-4450	CLIP-seq
MIRT818909	hsa-miR-4472	CLIP-seq
MIRT818910	hsa-miR-4481	CLIP-seq
MIRT818911	hsa-miR-4487	CLIP-seq
MIRT818912	hsa-miR-4533	CLIP-seq
MIRT818913	hsa-miR-4649-3p	CLIP-seq
MIRT818914	hsa-miR-4664-5p	CLIP-seq
MIRT818915	hsa-miR-4665-5p	CLIP-seq
MIRT818916	hsa-miR-4667-5p	CLIP-seq
MIRT818917	hsa-miR-4668-5p	CLIP-seq
MIRT818918	hsa-miR-4693-3p	CLIP-seq
MIRT818919	hsa-miR-4700-5p	CLIP-seq
MIRT818920	hsa-miR-4725-3p	CLIP-seq
MIRT818921	hsa-miR-4726-3p	CLIP-seq
MIRT818922	hsa-miR-4745-5p	CLIP-seq
MIRT818923	hsa-miR-4766-5p	CLIP-seq
MIRT818924	hsa-miR-4793-3p	CLIP-seq
MIRT818925	hsa-miR-5096	CLIP-seq
MIRT818926	hsa-miR-554	CLIP-seq
MIRT818927	hsa-miR-570	CLIP-seq
MIRT818928	hsa-miR-595	CLIP-seq
MIRT818929	hsa-miR-607	CLIP-seq
MIRT818930	hsa-miR-625	CLIP-seq
MIRT818931	hsa-miR-637	CLIP-seq
MIRT818932	hsa-miR-648	CLIP-seq
MIRT818933	hsa-miR-939	CLIP-seq
MIRT818934	hsa-miR-1251	CLIP-seq
MIRT818891	hsa-miR-1276	CLIP-seq
MIRT818935	hsa-miR-1909	CLIP-seq
MIRT818896	hsa-miR-3202	CLIP-seq
MIRT818902	hsa-miR-377	CLIP-seq
MIRT818936	hsa-miR-4270	CLIP-seq
MIRT818903	hsa-miR-4271	CLIP-seq
MIRT818937	hsa-miR-4300	CLIP-seq
MIRT818938	hsa-miR-4441	CLIP-seq
MIRT818939	hsa-miR-4475	CLIP-seq
MIRT818920	hsa-miR-4725-3p	CLIP-seq
MIRT818940	hsa-miR-4733-5p	CLIP-seq
MIRT818941	hsa-miR-4747-5p	CLIP-seq
MIRT818929	hsa-miR-607	CLIP-seq
MIRT818942	hsa-miR-920	CLIP-seq
MIRT818887	hsa-miR-1252	CLIP-seq
MIRT1941983	hsa-miR-1257	CLIP-seq
MIRT1941984	hsa-miR-1293	CLIP-seq
MIRT818892	hsa-miR-2110	CLIP-seq
MIRT1941985	hsa-miR-2113	CLIP-seq
MIRT1941986	hsa-miR-2276	CLIP-seq
MIRT1941987	hsa-miR-296-3p	CLIP-seq
MIRT1941988	hsa-miR-3074-3p	CLIP-seq
MIRT1941989	hsa-miR-3074-5p	CLIP-seq
MIRT1941990	hsa-miR-3127-5p	CLIP-seq
MIRT818894	hsa-miR-3151	CLIP-seq
MIRT818896	hsa-miR-3202	CLIP-seq
MIRT1941991	hsa-miR-342-3p	CLIP-seq
MIRT818898	hsa-miR-342-5p	CLIP-seq
MIRT1941992	hsa-miR-3545-3p	CLIP-seq
MIRT818899	hsa-miR-3591-5p	CLIP-seq
MIRT1941993	hsa-miR-3622b-5p	CLIP-seq
MIRT1941994	hsa-miR-3665	CLIP-seq
MIRT1941995	hsa-miR-3936	CLIP-seq
MIRT1941996	hsa-miR-3945	CLIP-seq
MIRT1941997	hsa-miR-3975	CLIP-seq
MIRT1941998	hsa-miR-412	CLIP-seq
MIRT1941999	hsa-miR-4253	CLIP-seq
MIRT818936	hsa-miR-4270	CLIP-seq
MIRT818903	hsa-miR-4271	CLIP-seq
MIRT818904	hsa-miR-4303	CLIP-seq
MIRT818905	hsa-miR-4314	CLIP-seq
MIRT818938	hsa-miR-4441	CLIP-seq
MIRT818907	hsa-miR-4447	CLIP-seq
MIRT1942000	hsa-miR-4452	CLIP-seq
MIRT1942001	hsa-miR-4471	CLIP-seq
MIRT818909	hsa-miR-4472	CLIP-seq
MIRT1942002	hsa-miR-4483	CLIP-seq
MIRT1942003	hsa-miR-4520a-3p	CLIP-seq
MIRT818912	hsa-miR-4533	CLIP-seq
MIRT1942004	hsa-miR-4539	CLIP-seq
MIRT818913	hsa-miR-4649-3p	CLIP-seq
MIRT818914	hsa-miR-4664-5p	CLIP-seq
MIRT1942005	hsa-miR-4667-3p	CLIP-seq
MIRT818916	hsa-miR-4667-5p	CLIP-seq
MIRT818919	hsa-miR-4700-5p	CLIP-seq
MIRT818920	hsa-miR-4725-3p	CLIP-seq
MIRT818921	hsa-miR-4726-3p	CLIP-seq
MIRT1942006	hsa-miR-4736	CLIP-seq
MIRT818923	hsa-miR-4766-5p	CLIP-seq
MIRT1942007	hsa-miR-4804-3p	CLIP-seq
MIRT1942008	hsa-miR-495	CLIP-seq
MIRT1942009	hsa-miR-498	CLIP-seq
MIRT1942010	hsa-miR-541	CLIP-seq
MIRT1942011	hsa-miR-548an	CLIP-seq
MIRT818926	hsa-miR-554	CLIP-seq
MIRT1942012	hsa-miR-555	CLIP-seq
MIRT818927	hsa-miR-570	CLIP-seq
MIRT818928	hsa-miR-595	CLIP-seq
MIRT818930	hsa-miR-625	CLIP-seq
MIRT818931	hsa-miR-637	CLIP-seq
MIRT818932	hsa-miR-648	CLIP-seq
MIRT1942013	hsa-miR-654-5p	CLIP-seq
MIRT1942014	hsa-miR-767-5p	CLIP-seq
MIRT2180784	hsa-let-7a	CLIP-seq
MIRT2180785	hsa-let-7b	CLIP-seq
MIRT2180786	hsa-let-7c	CLIP-seq
MIRT2180787	hsa-let-7d	CLIP-seq
MIRT2180788	hsa-let-7e	CLIP-seq
MIRT2180789	hsa-let-7f	CLIP-seq
MIRT2180790	hsa-let-7g	CLIP-seq
MIRT2180791	hsa-let-7i	CLIP-seq
MIRT2180792	hsa-miR-1226	CLIP-seq
MIRT1941983	hsa-miR-1257	CLIP-seq
MIRT818891	hsa-miR-1276	CLIP-seq
MIRT2180793	hsa-miR-202	CLIP-seq
MIRT2180794	hsa-miR-22	CLIP-seq
MIRT1941986	hsa-miR-2276	CLIP-seq
MIRT1941988	hsa-miR-3074-3p	CLIP-seq
MIRT1941989	hsa-miR-3074-5p	CLIP-seq
MIRT2180795	hsa-miR-3140-5p	CLIP-seq
MIRT818894	hsa-miR-3151	CLIP-seq
MIRT818896	hsa-miR-3202	CLIP-seq
MIRT1941991	hsa-miR-342-3p	CLIP-seq
MIRT818898	hsa-miR-342-5p	CLIP-seq
MIRT1941992	hsa-miR-3545-3p	CLIP-seq
MIRT2180796	hsa-miR-3667-5p	CLIP-seq
MIRT2180797	hsa-miR-3681	CLIP-seq
MIRT2180798	hsa-miR-3689a-5p	CLIP-seq
MIRT2180799	hsa-miR-3689b	CLIP-seq
MIRT2180800	hsa-miR-3689e	CLIP-seq
MIRT2180801	hsa-miR-3689f	CLIP-seq
MIRT2180802	hsa-miR-371-5p	CLIP-seq
MIRT818902	hsa-miR-377	CLIP-seq
MIRT2180803	hsa-miR-3939	CLIP-seq
MIRT1941998	hsa-miR-412	CLIP-seq
MIRT2180804	hsa-miR-4267	CLIP-seq
MIRT818936	hsa-miR-4270	CLIP-seq
MIRT2180805	hsa-miR-4293	CLIP-seq
MIRT818904	hsa-miR-4303	CLIP-seq
MIRT818906	hsa-miR-4325	CLIP-seq
MIRT818938	hsa-miR-4441	CLIP-seq
MIRT818907	hsa-miR-4447	CLIP-seq
MIRT1942000	hsa-miR-4452	CLIP-seq
MIRT2180806	hsa-miR-4457	CLIP-seq
MIRT2180807	hsa-miR-4458	CLIP-seq
MIRT1942001	hsa-miR-4471	CLIP-seq
MIRT818909	hsa-miR-4472	CLIP-seq
MIRT818939	hsa-miR-4475	CLIP-seq
MIRT818911	hsa-miR-4487	CLIP-seq
MIRT2180808	hsa-miR-4500	CLIP-seq
MIRT1942004	hsa-miR-4539	CLIP-seq
MIRT818913	hsa-miR-4649-3p	CLIP-seq
MIRT2180809	hsa-miR-4661-5p	CLIP-seq
MIRT818914	hsa-miR-4664-5p	CLIP-seq
MIRT818916	hsa-miR-4667-5p	CLIP-seq
MIRT2180810	hsa-miR-4690-3p	CLIP-seq
MIRT818919	hsa-miR-4700-5p	CLIP-seq
MIRT2180811	hsa-miR-4708-3p	CLIP-seq
MIRT2180812	hsa-miR-4724-5p	CLIP-seq
MIRT2180813	hsa-miR-4725-5p	CLIP-seq
MIRT2180814	hsa-miR-4777-5p	CLIP-seq
MIRT818924	hsa-miR-4793-3p	CLIP-seq
MIRT1942009	hsa-miR-498	CLIP-seq
MIRT2180815	hsa-miR-504	CLIP-seq
MIRT818925	hsa-miR-5096	CLIP-seq
MIRT2180816	hsa-miR-513b	CLIP-seq
MIRT2180817	hsa-miR-518d-5p	CLIP-seq
MIRT2180818	hsa-miR-519b-5p	CLIP-seq
MIRT2180819	hsa-miR-519c-5p	CLIP-seq
MIRT2180820	hsa-miR-520c-5p	CLIP-seq
MIRT2180821	hsa-miR-526a	CLIP-seq
MIRT2180822	hsa-miR-544b	CLIP-seq
MIRT2180823	hsa-miR-548ac	CLIP-seq
MIRT2180824	hsa-miR-548ae	CLIP-seq
MIRT2180825	hsa-miR-548aj	CLIP-seq
MIRT2180826	hsa-miR-548am	CLIP-seq
MIRT2180827	hsa-miR-548d-3p	CLIP-seq
MIRT2180828	hsa-miR-548x	CLIP-seq
MIRT2180829	hsa-miR-548z	CLIP-seq
MIRT818927	hsa-miR-570	CLIP-seq
MIRT818928	hsa-miR-595	CLIP-seq
MIRT818929	hsa-miR-607	CLIP-seq
MIRT818931	hsa-miR-637	CLIP-seq
MIRT2180830	hsa-miR-7	CLIP-seq
MIRT2180831	hsa-miR-98	CLIP-seq
MIRT818907	hsa-miR-4447	CLIP-seq
MIRT818909	hsa-miR-4472	CLIP-seq
MIRT818913	hsa-miR-4649-3p	CLIP-seq
MIRT818916	hsa-miR-4667-5p	CLIP-seq
MIRT818919	hsa-miR-4700-5p	CLIP-seq
MIRT2444747	hsa-miR-1827	CLIP-seq
MIRT2444748	hsa-miR-4316	CLIP-seq
MIRT2444749	hsa-miR-4476	CLIP-seq
MIRT818913	hsa-miR-4649-3p	CLIP-seq
MIRT2180784	hsa-let-7a	CLIP-seq
MIRT2180785	hsa-let-7b	CLIP-seq
MIRT2180786	hsa-let-7c	CLIP-seq
MIRT2180787	hsa-let-7d	CLIP-seq
MIRT2180788	hsa-let-7e	CLIP-seq
MIRT2180789	hsa-let-7f	CLIP-seq
MIRT2180790	hsa-let-7g	CLIP-seq
MIRT2180791	hsa-let-7i	CLIP-seq
MIRT2484220	hsa-miR-103a	CLIP-seq
MIRT2484221	hsa-miR-107	CLIP-seq
MIRT2484222	hsa-miR-1200	CLIP-seq
MIRT818934	hsa-miR-1251	CLIP-seq
MIRT818888	hsa-miR-1255a	CLIP-seq
MIRT818889	hsa-miR-1255b	CLIP-seq
MIRT2484223	hsa-miR-1266	CLIP-seq
MIRT2484224	hsa-miR-1291	CLIP-seq
MIRT1941984	hsa-miR-1293	CLIP-seq
MIRT2484225	hsa-miR-133a	CLIP-seq
MIRT2444747	hsa-miR-1827	CLIP-seq
MIRT2180793	hsa-miR-202	CLIP-seq
MIRT2484226	hsa-miR-204	CLIP-seq
MIRT2484227	hsa-miR-211	CLIP-seq
MIRT2484228	hsa-miR-214	CLIP-seq
MIRT2484229	hsa-miR-296-5p	CLIP-seq
MIRT2484230	hsa-miR-3064-3p	CLIP-seq
MIRT1941988	hsa-miR-3074-3p	CLIP-seq
MIRT1941989	hsa-miR-3074-5p	CLIP-seq
MIRT2484231	hsa-miR-3120-5p	CLIP-seq
MIRT1941990	hsa-miR-3127-5p	CLIP-seq
MIRT2180795	hsa-miR-3140-5p	CLIP-seq
MIRT2484232	hsa-miR-3155	CLIP-seq
MIRT2484233	hsa-miR-3155b	CLIP-seq
MIRT2484234	hsa-miR-3162-3p	CLIP-seq
MIRT818896	hsa-miR-3202	CLIP-seq
MIRT2484235	hsa-miR-328	CLIP-seq
MIRT2484236	hsa-miR-330-5p	CLIP-seq
MIRT818897	hsa-miR-331-3p	CLIP-seq
MIRT2484237	hsa-miR-3619-5p	CLIP-seq
MIRT818900	hsa-miR-3649	CLIP-seq
MIRT2484238	hsa-miR-3667-3p	CLIP-seq
MIRT2180796	hsa-miR-3667-5p	CLIP-seq
MIRT2484239	hsa-miR-3677-5p	CLIP-seq
MIRT2180802	hsa-miR-371-5p	CLIP-seq
MIRT2484240	hsa-miR-3907	CLIP-seq
MIRT2484241	hsa-miR-3918	CLIP-seq
MIRT1941998	hsa-miR-412	CLIP-seq
MIRT818936	hsa-miR-4270	CLIP-seq
MIRT818903	hsa-miR-4271	CLIP-seq
MIRT2484242	hsa-miR-4278	CLIP-seq
MIRT2484243	hsa-miR-4281	CLIP-seq
MIRT2484244	hsa-miR-4283	CLIP-seq
MIRT2484245	hsa-miR-4287	CLIP-seq
MIRT2180805	hsa-miR-4293	CLIP-seq
MIRT818937	hsa-miR-4300	CLIP-seq
MIRT2484246	hsa-miR-431	CLIP-seq
MIRT2444748	hsa-miR-4316	CLIP-seq
MIRT2484247	hsa-miR-4326	CLIP-seq
MIRT2484248	hsa-miR-4438	CLIP-seq
MIRT818938	hsa-miR-4441	CLIP-seq
MIRT2484249	hsa-miR-4446-3p	CLIP-seq
MIRT818908	hsa-miR-4450	CLIP-seq
MIRT2180806	hsa-miR-4457	CLIP-seq
MIRT2180807	hsa-miR-4458	CLIP-seq
MIRT818939	hsa-miR-4475	CLIP-seq
MIRT2444749	hsa-miR-4476	CLIP-seq
MIRT1942002	hsa-miR-4483	CLIP-seq
MIRT2484250	hsa-miR-4489	CLIP-seq
MIRT2180808	hsa-miR-4500	CLIP-seq
MIRT2484251	hsa-miR-4518	CLIP-seq
MIRT818913	hsa-miR-4649-3p	CLIP-seq
MIRT2484252	hsa-miR-4656	CLIP-seq
MIRT818916	hsa-miR-4667-5p	CLIP-seq
MIRT2484253	hsa-miR-4685-3p	CLIP-seq
MIRT2180810	hsa-miR-4690-3p	CLIP-seq
MIRT2484254	hsa-miR-4690-5p	CLIP-seq
MIRT2484255	hsa-miR-4694-3p	CLIP-seq
MIRT818919	hsa-miR-4700-5p	CLIP-seq
MIRT2484256	hsa-miR-4716-3p	CLIP-seq
MIRT818920	hsa-miR-4725-3p	CLIP-seq
MIRT2180813	hsa-miR-4725-5p	CLIP-seq
MIRT818940	hsa-miR-4733-5p	CLIP-seq
MIRT818941	hsa-miR-4747-5p	CLIP-seq
MIRT2484257	hsa-miR-4796-3p	CLIP-seq
MIRT2484258	hsa-miR-4797-3p	CLIP-seq
MIRT1942007	hsa-miR-4804-3p	CLIP-seq
MIRT2484259	hsa-miR-486-3p	CLIP-seq
MIRT1942008	hsa-miR-495	CLIP-seq
MIRT2180815	hsa-miR-504	CLIP-seq
MIRT818925	hsa-miR-5096	CLIP-seq
MIRT2180816	hsa-miR-513b	CLIP-seq
MIRT2484260	hsa-miR-522	CLIP-seq
MIRT2180822	hsa-miR-544b	CLIP-seq
MIRT2180823	hsa-miR-548ac	CLIP-seq
MIRT2180824	hsa-miR-548ae	CLIP-seq
MIRT2180825	hsa-miR-548aj	CLIP-seq
MIRT2180826	hsa-miR-548am	CLIP-seq
MIRT2180827	hsa-miR-548d-3p	CLIP-seq
MIRT2484261	hsa-miR-548t	CLIP-seq
MIRT2180828	hsa-miR-548x	CLIP-seq
MIRT2180829	hsa-miR-548z	CLIP-seq
MIRT818926	hsa-miR-554	CLIP-seq
MIRT2484262	hsa-miR-635	CLIP-seq
MIRT818931	hsa-miR-637	CLIP-seq
MIRT2484263	hsa-miR-643	CLIP-seq
MIRT2180830	hsa-miR-7	CLIP-seq
MIRT2484264	hsa-miR-760	CLIP-seq
MIRT2484265	hsa-miR-761	CLIP-seq
MIRT818942	hsa-miR-920	CLIP-seq
MIRT2484266	hsa-miR-938	CLIP-seq
MIRT2180831	hsa-miR-98	CLIP-seq
MIRT2180784	hsa-let-7a	CLIP-seq
MIRT2180785	hsa-let-7b	CLIP-seq
MIRT2180786	hsa-let-7c	CLIP-seq
MIRT2180787	hsa-let-7d	CLIP-seq
MIRT2180788	hsa-let-7e	CLIP-seq
MIRT2180789	hsa-let-7f	CLIP-seq
MIRT2180790	hsa-let-7g	CLIP-seq
MIRT2180791	hsa-let-7i	CLIP-seq
MIRT2484220	hsa-miR-103a	CLIP-seq
MIRT2484221	hsa-miR-107	CLIP-seq
MIRT2484222	hsa-miR-1200	CLIP-seq
MIRT818934	hsa-miR-1251	CLIP-seq
MIRT2484223	hsa-miR-1266	CLIP-seq
MIRT2484224	hsa-miR-1291	CLIP-seq
MIRT2484225	hsa-miR-133a	CLIP-seq
MIRT2444747	hsa-miR-1827	CLIP-seq
MIRT2180793	hsa-miR-202	CLIP-seq
MIRT2484226	hsa-miR-204	CLIP-seq
MIRT2484227	hsa-miR-211	CLIP-seq
MIRT2484228	hsa-miR-214	CLIP-seq
MIRT2484229	hsa-miR-296-5p	CLIP-seq
MIRT2484230	hsa-miR-3064-3p	CLIP-seq
MIRT1941988	hsa-miR-3074-3p	CLIP-seq
MIRT1941989	hsa-miR-3074-5p	CLIP-seq
MIRT2484231	hsa-miR-3120-5p	CLIP-seq
MIRT1941990	hsa-miR-3127-5p	CLIP-seq
MIRT2180795	hsa-miR-3140-5p	CLIP-seq
MIRT2484232	hsa-miR-3155	CLIP-seq
MIRT2484233	hsa-miR-3155b	CLIP-seq
MIRT2484234	hsa-miR-3162-3p	CLIP-seq
MIRT818896	hsa-miR-3202	CLIP-seq
MIRT2484235	hsa-miR-328	CLIP-seq
MIRT2484236	hsa-miR-330-5p	CLIP-seq
MIRT2484237	hsa-miR-3619-5p	CLIP-seq
MIRT2484238	hsa-miR-3667-3p	CLIP-seq
MIRT2180796	hsa-miR-3667-5p	CLIP-seq
MIRT2484239	hsa-miR-3677-5p	CLIP-seq
MIRT2180802	hsa-miR-371-5p	CLIP-seq
MIRT2484241	hsa-miR-3918	CLIP-seq
MIRT1941998	hsa-miR-412	CLIP-seq
MIRT818936	hsa-miR-4270	CLIP-seq
MIRT818903	hsa-miR-4271	CLIP-seq
MIRT2484242	hsa-miR-4278	CLIP-seq
MIRT2484243	hsa-miR-4281	CLIP-seq
MIRT2484244	hsa-miR-4283	CLIP-seq
MIRT2484245	hsa-miR-4287	CLIP-seq
MIRT2180805	hsa-miR-4293	CLIP-seq
MIRT818937	hsa-miR-4300	CLIP-seq
MIRT2484246	hsa-miR-431	CLIP-seq
MIRT2444748	hsa-miR-4316	CLIP-seq
MIRT2484247	hsa-miR-4326	CLIP-seq
MIRT2484248	hsa-miR-4438	CLIP-seq
MIRT818938	hsa-miR-4441	CLIP-seq
MIRT2484249	hsa-miR-4446-3p	CLIP-seq
MIRT2180806	hsa-miR-4457	CLIP-seq
MIRT2180807	hsa-miR-4458	CLIP-seq
MIRT818939	hsa-miR-4475	CLIP-seq
MIRT2444749	hsa-miR-4476	CLIP-seq
MIRT2484250	hsa-miR-4489	CLIP-seq
MIRT2180808	hsa-miR-4500	CLIP-seq
MIRT2484251	hsa-miR-4518	CLIP-seq
MIRT818913	hsa-miR-4649-3p	CLIP-seq
MIRT2484252	hsa-miR-4656	CLIP-seq
MIRT818916	hsa-miR-4667-5p	CLIP-seq
MIRT2484253	hsa-miR-4685-3p	CLIP-seq
MIRT2180810	hsa-miR-4690-3p	CLIP-seq
MIRT2484254	hsa-miR-4690-5p	CLIP-seq
MIRT2484255	hsa-miR-4694-3p	CLIP-seq
MIRT818919	hsa-miR-4700-5p	CLIP-seq
MIRT2484256	hsa-miR-4716-3p	CLIP-seq
MIRT818920	hsa-miR-4725-3p	CLIP-seq
MIRT2180813	hsa-miR-4725-5p	CLIP-seq
MIRT818940	hsa-miR-4733-5p	CLIP-seq
MIRT818941	hsa-miR-4747-5p	CLIP-seq
MIRT2484257	hsa-miR-4796-3p	CLIP-seq
MIRT2484258	hsa-miR-4797-3p	CLIP-seq
MIRT1942007	hsa-miR-4804-3p	CLIP-seq
MIRT2484259	hsa-miR-486-3p	CLIP-seq
MIRT1942008	hsa-miR-495	CLIP-seq
MIRT2180815	hsa-miR-504	CLIP-seq
MIRT818925	hsa-miR-5096	CLIP-seq
MIRT2180816	hsa-miR-513b	CLIP-seq
MIRT2484260	hsa-miR-522	CLIP-seq
MIRT2180822	hsa-miR-544b	CLIP-seq
MIRT2180823	hsa-miR-548ac	CLIP-seq
MIRT2180824	hsa-miR-548ae	CLIP-seq
MIRT2180825	hsa-miR-548aj	CLIP-seq
MIRT2180826	hsa-miR-548am	CLIP-seq
MIRT2180827	hsa-miR-548d-3p	CLIP-seq
MIRT2484261	hsa-miR-548t	CLIP-seq
MIRT2180828	hsa-miR-548x	CLIP-seq
MIRT2180829	hsa-miR-548z	CLIP-seq
MIRT818926	hsa-miR-554	CLIP-seq
MIRT2484262	hsa-miR-635	CLIP-seq
MIRT818931	hsa-miR-637	CLIP-seq
MIRT2484263	hsa-miR-643	CLIP-seq
MIRT2180830	hsa-miR-7	CLIP-seq
MIRT2484264	hsa-miR-760	CLIP-seq
MIRT2484265	hsa-miR-761	CLIP-seq
MIRT818942	hsa-miR-920	CLIP-seq
MIRT2484266	hsa-miR-938	CLIP-seq
MIRT2180831	hsa-miR-98	CLIP-seq

23 Show/Hide all (23)

Transcription factor	Regulation	Reference
BCL6	Repression	11777915
CEBPB	Unknown	19043455
FOS	Unknown	16911523
JUN	Unknown	16911523
MTA1	Activation	11948399
NFKB1	Activation	12226754;14978135;15756023;15856023;15986355;16904634;18223231;20066113
NFKB1	Repression	15231833
NFKB1	Unknown	10733571;10925251;12176906;14739605;16453001;17673602;18222423
NR1I2	Activation	16085054
NUPR1	Activation	18690848
PAX3	Activation	10871843
PPARG	Repression	14960510
RELA	Activation	12226754;14978135;15756023;15856023;15986355;16904634;18223231;20066113;20585448
RELA	Repression	15231833
RELA	Unknown	10733571;10925251;14739605;16453001;17673602
SREBF1	Repression	16091421
STAT3	Activation	11369651;15184887;15805299;16651438;17880940;20069389;21435102
STAT3	Repression	20067773
STAT3	Unknown	15469392;16384639;18222423;18790750;20654581;21172343;21344490
STAT5A	Unknown	11756417
STAT5B	Activation	20585448
TP53	Activation	9000137
TP53	Repression	18172861

100 Show/Hide all (100)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001836	Process	Release of cytochrome c from mitochondria	IBA
GO:0001836	Process	Release of cytochrome c from mitochondria	IDA	9843949
GO:0001836	Process	Release of cytochrome c from mitochondria	IEA
GO:0005515	Function	Protein binding	IPI	9027312, 9388232, 9660918, 10837489, 11054413, 11060313, 11126360, 11278245, 11463391, 11714801, 11971963, 12011449, 12667443, 12815463, 14596824, 14739602, 14752512, 14963330, 15031724, 15110758, 15131699, 15694340, 15901672, 16151013, 16189514, 16509771, 16608847, 16697956, 171776
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	20673843
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	12011449
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	10365962
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005741	Component	Mitochondrial outer membrane	IDA	19767770
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	NAS	12667443
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005813	Component	Centrosome	IDA	21840391
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006897	Process	Endocytosis	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006950	Process	Response to stress	IEA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007281	Process	Germ cell development	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IBA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0008637	Process	Apoptotic mitochondrial changes	TAS	9393856
GO:0009314	Process	Response to radiation	IEA
GO:0009566	Process	Fertilization	IEA
GO:0009615	Process	Response to virus	IEA
GO:0010507	Process	Negative regulation of autophagy	TAS	18309324
GO:0015267	Function	Channel activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	21840391
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032465	Process	Regulation of cytokinesis	IMP	21840391
GO:0032946	Process	Positive regulation of mononuclear cell proliferation	IEA
GO:0034097	Process	Response to cytokine	IDA	9184696
GO:0035234	Process	Ectopic germ cell programmed cell death	IEA
GO:0040008	Process	Regulation of growth	IEA
GO:0042802	Function	Identical protein binding	IPI	15131699, 21856303
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	7650367
GO:0043066	Process	Negative regulation of apoptotic process	IDA	9388232, 12667443, 21567405
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	17289999
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0044565	Process	Dendritic cell proliferation	IEA
GO:0045202	Component	Synapse	IEA
GO:0046898	Process	Response to cycloheximide	IEA
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IDA	9843949
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0051093	Process	Negative regulation of developmental process	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051434	Function	BH3 domain binding	IPI	15901672, 21639858
GO:0051607	Process	Defense response to virus	IDA	17428862
GO:0051707	Process	Response to other organism	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IDA	9843949
GO:0055085	Process	Transmembrane transport	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071312	Process	Cellular response to alkaloid	IEA
GO:0071480	Process	Cellular response to gamma radiation	IEA
GO:0071839	Process	Apoptotic process in bone marrow cell	IEA
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	IC	21041309
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	IDA	9393856, 15901672
GO:0097048	Process	Dendritic cell apoptotic process	IEA
GO:0097136	Component	Bcl-2 family protein complex	IDA	21199865
GO:0097136	Component	Bcl-2 family protein complex	IEA
GO:0097136	Component	Bcl-2 family protein complex	IPI	21856303, 22515821
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IBA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0097284	Process	Hepatocyte apoptotic process	IEA
GO:1900118	Process	Negative regulation of execution phase of apoptosis	IDA	20673843
GO:1901029	Process	Negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IDA	9393856, 15901672
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	26582200
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IDA	16608847
GO:1902236	Process	Negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IDA	29507230
GO:1902531	Process	Regulation of intracellular signal transduction	IEA
GO:1903077	Process	Negative regulation of protein localization to plasma membrane	IDA	21041309
GO:2000242	Process	Negative regulation of reproductive process	IEA
GO:2000669	Process	Negative regulation of dendritic cell apoptotic process	IEA
GO:2000811	Process	Negative regulation of anoikis	IMP	15006356
GO:2001233	Process	Regulation of apoptotic signaling pathway	IEA
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	TAS	8358789
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IDA	12011449, 21567405

MIM	HGNC	e!Ensembl
600039	992	ENSG00000171552

Q07817

Protein name

Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)

Protein function

Potent inhibitor of cell death. Inhibits activation of caspases. Appears to regulate cell death by blocking the voltage-dependent anion channel (VDAC) by binding to it and preventing the release of the caspase activator, CYC1, from the mitochond

PDB

1BXL , 1G5J , 1LXL , 1MAZ , 1R2D , 1R2E , 1R2G , 1R2H , 1R2I , 1YSG , 1YSI , 1YSN , 2B48 , 2LP8 , 2LPC , 2M03 , 2M04 , 2ME8 , 2ME9 , 2MEJ , 2O1Y , 2O2M , 2O2N , 2P1L , 2PON , 2YJ1 , 2YQ6 , 2YQ7 , 2YXJ , 3CVA , 3FDL , 3FDM , 3INQ , 3IO8 , 3PL7 , 3QKD , 3R85 , 3SP7 , 3SPF , 3WIZ , 3ZK6 , 3ZLN , 3ZLO , 3ZLR , 4A1U , 4A1W , 4AQ3 , 4BPK , 4C52 , 4C5D , 4CIN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00452	Bcl-2	90 → 188	Apoptosis regulator proteins, Bcl-2 family	Family
PF02180	BH4	1 → 26	Bcl-2 homology region 4	Family

Tissue specificity

TISSUE SPECIFICITY: Bcl-X(S) is expressed at high levels in cells that undergo a high rate of turnover, such as developing lymphocytes. In contrast, Bcl-X(L) is found in tissues containing long-lived postmitotic cells, such as adult brain.

Sequence

MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK

Sequence length

233

Interactions

View interactions

KEGG Pathway	Reactome Pathway
EGFR tyrosine kinase inhibitor resistance	BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members
Platinum drug resistance	Interleukin-4 and Interleukin-13 signaling
Ras signaling pathway	The NLRP1 inflammasome
NF-kappa B signaling pathway
p53 signaling pathway
Mitophagy - animal
Autophagy - animal
PI3K-Akt signaling pathway
Apoptosis
Apoptosis - multiple species
NOD-like receptor signaling pathway
JAK-STAT signaling pathway
Parkinson disease
Amyotrophic lateral sclerosis
Pathways of neurodegeneration - multiple diseases
Shigellosis
Toxoplasmosis
Measles
Human T-cell leukemia virus 1 infection
Herpes simplex virus 1 infection
Human immunodeficiency virus 1 infection
Pathways in cancer
Transcriptional misregulation in cancer
Pancreatic cancer
Chronic myeloid leukemia
Small cell lung cancer
Hepatocellular carcinoma
Lipid and atherosclerosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (24)
ALZHEIMER DISEASE	—	GWAS catalog	39998322	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	11796754	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	10426811	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	10629087, 11509945	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL HEMORRHAGE	—	CTD	12721362	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRYPTORCHIDISM	—	CTD, Disgenet CTD, Disgenet	26050606	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	16959961	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERECTILE DYSFUNCTION	—	CTD, Disgenet CTD, Disgenet	12394778	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK NEOPLASMS	—	CTD	18566236	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING IMPAIRMENT	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	CTD	17697574	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	38965376	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	19784758	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	16007126	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD	12429644	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELOPROLIFERATIVE DISORDER	—	GWAS catalog	37684235	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	20079142	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	16904634	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	37945903	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	37945903	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	26401016	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (335)
Abdominal Cryptorchidism	Cryptorchidism	CTD_human_DG	26050606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	11801602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	8625322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	29596435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	CTD_human_DG	10426811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	26048755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	22009326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma, Basal Cell	Adenoma	CTD_human_DG	10426811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma, Microcystic	Adenoma	CTD_human_DG	10426811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma, Monomorphic	Adenoma	CTD_human_DG	10426811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma, Trabecular	Adenoma	CTD_human_DG	10426811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	8625322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	15827331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	12608434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17712163	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22072391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	33167591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	CTD_human_DG	11796754		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	CTD_human_DG	11796754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	CTD_human_DG	11796754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	10426811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	11380462	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Refractory	Refractory anemia	Pubtator	11090080, 12111784	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	31648320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	27398719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	11313274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	16042757	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	22978789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	7747803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	36243930, 40045304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	12204872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	16773221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	35977048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	11133771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	33706714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	12204872		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	16957768, 25139387, 25648321, 28643758, 29025092, 29102932, 29226557, 29693141, 29805688, 29849810, 30320356, 30343279, 30429221		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	21225866, 9459175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	16049281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	15986355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bilateral Cryptorchidism	Cryptorchidism	CTD_human_DG	26050606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	28463235	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	18751404, 30032449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	15089759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	21562047, 32388279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	32073752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	12937123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	37586773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18428028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10507761, 11278482, 12210599, 12381725, 12884026, 15100288, 16080463, 18428028, 20089431, 20164027, 20829044, 23934044, 24359639, 24745479, 24909179 View all (12 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12644829	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19047049	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	19136942, 22241218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Head	Neoplasm of head	CTD_human_DG	18566236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Neck	Neck Cancer	CTD_human_DG	18566236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18494061, 21647677, 26385919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	10426811		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	12893071, 16136583, 8625322		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	7747803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	26299454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11572758, 12439925, 15063116, 16750275, 17033717, 21829603, 22928777, 23392177, 24779770, 26194347, 26259250, 27579319, 28081730, 29425759, 33576217, 34258170 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16640784	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	18751404, 30032449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30497474, 31508368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	29949791, 31210304, 34071938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29409480, 35684936, 36422202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33850477, 35121737, 35776130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	12871776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15156398, 16188300, 19634140, 20939431, 22098591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	10426811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	32631246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28225026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	22357666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Cerebellar ataxia and hypogonadotropic hypogonadism	Pubtator	16794010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10194447, 20038611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	11729212, 30880771, 35983950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	15694358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	17343283	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	19445670, 20661931, 23415961, 34070455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	24621885	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	27398719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	21262580	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21225866, 9459175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11920608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	10965024	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	14520471, 15767554, 17534896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	18494061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	34126796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10965024, 11041112, 22009326, 26134786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10193519, 10965024, 11290547, 11896073, 14520471, 15314290, 15770735, 16127422, 16192633, 16608847, 18200666, 18494061, 18609706, 24098503, 25156145 View all (23 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12855666, 15770735, 17404017, 18494061, 18609706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15162527	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	26134786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	10844530, 26081581, 30464201, 32961586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital contractural arachnodactyly	Pubtator	35983950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital myasthenic syndrome ib	Congenital myasthenic syndrome	Pubtator	27821551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Continuous Muscle Fiber Activity Hereditary	Hereditary continuous muscle fiber activity	Pubtator	11570908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal dystrophy Avellino type	Corneal dystrophy	Pubtator	19497990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	33964876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	CTD_human_DG	26050606		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic fibrosis	Pubtator	23135964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	16572289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	12605696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22519592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	16959961		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	18755494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	21684326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25222269, 33633844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20178603, 28421904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	17094974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	20939431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	CTD_human_DG	12394778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11508622, 12439908, 17167836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	12439908, 17167836, 37500660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17167836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	18580065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25438156	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	21037114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	29425759	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	LHGDN	12637494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	29137483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	CTD_human_DG	10426811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	11788897, 27194951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingival Diseases	Gingival diseases	Pubtator	31743516, 33934404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	LHGDN	15638362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	12558990, 15611130, 17699103, 18786178, 20153921, 21880871, 23908595, 23965755, 25482938, 25633526, 25793261, 26775694, 31323961, 31751869, 34209035, 35167936, 35473984 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18786178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31751869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31751869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10408397, 15611130, 18662322, 18670645, 19289490, 19861406, 21279667, 22406992, 25674231, 27805285, 31319814, 34643804, 36273072, 9060818, 9576951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15389288, 19861406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	26460503, 29137483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	16109447	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	17911631	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	29137483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	26715915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease IIIA	Glycogen storage disease	Pubtator	30269021	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	21115909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	14735465		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Neoplasms	Head And Neck Neoplasms	CTD_human_DG	18566236		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	24019973, 32710568	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head Neoplasms	Head Neoplasms	CTD_human_DG	18566236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	LHGDN	14668940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	23535507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	10841223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	26537004, 27742710, 28038464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	15245439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	9840908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	29425759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	10520003, 36077449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	25648321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	26401016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12393683, 29693141, 7742524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	7742524, 9021697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	11520890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	21128858	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	14966904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28478796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	11880298, 18670645, 19161638, 19211554, 20164027, 22984526, 23289374, 27821551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23681233	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30949212, 34181359	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	30481203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	29137483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	19841866, 20038611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	14966904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	31838956	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	31838956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	11687955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	15858125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	35776130, 35984355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	15928664, 18427001, 23775802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	16962107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	27140314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10891462, 11840289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11369651, 11880365, 22016818, 23445492, 25088254, 29545342, 34824248, 37078252, 8611710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12204872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	10648417, 22898820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10845930, 22016818, 23798675, 24451410, 25308513, 25714024, 26188358, 26801919, 27283158, 32021103, 37078252, 37904054, 9562974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	12111784	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	25514379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	11911810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12139741, 12443885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	15827331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	31666070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	31666070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	10629087, 11509945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10873563, 17612932, 21052098, 31612394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12439925, 12810626, 15179366, 17923112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	27579319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	14614329, 15753661, 22675468, 23894143, 30497474, 31595832, 8630278	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	16007126		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	16959370, 17492131		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	23940081		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	37993903	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18494061, 25550772	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20430737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	12969962, 17938578, 25590803, 27742710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16983335, 22155272, 9613974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	12969962, 14767488, 18606651, 19242522, 21240256, 32898249, 37824846, 9414291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	7742524	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	LHGDN	12969962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	14767488, 17295647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	11835337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	11835337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	LHGDN	16048439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Malformation of cortical development	LHGDN	18594472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	CTD_human_DG	18566236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	21115909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18428028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17167836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	16007126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30497474, 31508368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15156398, 16188300, 19634140, 22098591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	16904634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11245486, 18413762, 31389670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26401016, 31571913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	26401016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	18751404, 30032449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11406560, 17483317, 18843207, 22311987, 28981872, 29498802, 30635584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11920608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12209955, 16192647, 16492678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	LHGDN	12937123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	12937123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis Cutaneous	Mastocytosis	Pubtator	12937123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	35315927, 37898609, 9060818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11874491, 15314285, 17384650, 18079751, 18222423, 19838163, 21637003, 22685558, 22705850, 26035829, 29183729, 31019203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	14572633		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16081848, 17384650, 18079751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	19626699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	17224645, 31786278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	12063468, 19815709, 22734486, 25408576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	11461904, 22354970	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	15494423, 20223826, 25268613, 26043078, 28038320, 29240261, 35977048, 37055388, 9354463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	24816239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	29652014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10583232, 10979940, 11175262, 11468182, 12707028, 15970928, 17332241, 18443271, 18544087, 21659544, 21826062, 21871133, 22177381, 24816239, 27465916 View all (10 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	CTD_human_DG	12429644		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	LHGDN	14656874		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	15199411, 17483317, 20177898, 24816239, 9664139		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	12020973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	15124764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	34922439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	12111784, 31838956, 9886323	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10727459, 15089759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	15477204, 16572323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelokathexis	Myelokathexis	BEFREE	12906773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	19109573, 26290261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	20079142		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis Inclusion Body	Myositis	Pubtator	11570908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	37468473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12893071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	31566021, 34064109, 37217794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	CTD_human_DG	18566236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10219790, 10620629, 11259472, 11687955, 12581249, 12885947, 15199411, 15725478, 18843207, 19634140, 20939431, 21450822, 22539591, 24735610, 26134786 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	27997540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	11796751, 21159604, 21878749, 32203216	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	15961228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	24346802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	10607719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25522273, 27264345		★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	LHGDN	16773221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	18474878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32255771, 33953899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	26273425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	10702275, 26416351, 26569226, 27735939, 28618955, 31799646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	19634140		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15156398, 16188300, 22098591, 22688594		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15156398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10679744, 17575110, 19517469, 22098591, 23277286, 23573264, 24523919, 24650799, 25299770, 25627260, 26063499, 27080533, 27415751, 31462500, 32424251, 36122664 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	16904634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	14583775, 16109447, 21174186, 21720559, 22471280, 22609401, 23426533, 23519249, 23954445, 27941651, 29596435, 31412018, 31467029, 35315913, 36422202, 9860477 View all (1 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary adenoma	Papillary Adenoma	CTD_human_DG	10426811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	12079401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31710912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	21674599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	10079254	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	LHGDN	15477204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	27821551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	LHGDN	15477204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	16684963, 19060244, 19109573, 20625010, 9475763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	19060244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	32790151	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymorphous corneal dystrophy	Polymorphous corneal dystrophy	BEFREE	15725882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	21080944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	31659122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11245486, 18413762, 31389670		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11571633, 12381725, 12496481, 12633850, 12738789, 15314206, 16052512, 16794010, 19211554, 21310825, 22484941, 23047795, 27590631, 30141307, 30198376, 31389670, 32630281 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12738789, 15827323, 16794010, 18196538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	7747803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22686245	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22171132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	12025227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	26730174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	22648271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	16572289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	11687955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	35887198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	36443881	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	LHGDN	17428862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	30662920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	10935471	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16116477, 17283153, 20206622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	16810323, 21965726, 26722503, 32152266	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	8630278	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	12722834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11508622, 12893071, 9591537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18285708, 18342927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	11508622, 11579389, 12439908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	15917659, 17848273, 17971900, 18566236, 25139387, 25550772, 28877725, 29652014, 30614804, 30635792, 31575007, 31894587, 32710568, 35078428, 35887198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	22513214, 25139387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26401016, 31571913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12944556, 16077903, 21777278, 24838641, 37271936, 37794689	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	26401016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	22300941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	32790151	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	LHGDN	15477204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	22184378, 25333252, 35058488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	27080533	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymus Neoplasms	Thymus Neoplasms	LHGDN	14631373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	16452205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	25550772	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26045046, 30482844, 34903710, 36077449, 36381235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26045046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	10426811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unilateral Cryptorchidism	Cryptorchidism	CTD_human_DG	26050606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Upper Aerodigestive Tract Neoplasms	Upper Aerodigestive Tract Neoplasms	CTD_human_DG	18566236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18751404, 21408190, 22797576, 23749114, 24459064, 34868059, 37511611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21593790, 27886335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	22653968	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	24217227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	21450822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	33790887, 36890149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	25893290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
WHIM syndrome	Whim syndrome	Pubtator	10607719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	11720445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
BCL2	6	["Carcinoma","Cerebral hemorrhage","Erectile dysfunction","Head and neck neoplasms","Multiple myeloma","Myeloproliferative disorder"]	19	["EGFR tyrosine kinase inhibitor resistance","Platinum drug resistance","NF-kappa B signaling pathway","p53 signaling pathway","Autophagy - animal","Apoptosis","Apoptosis - multiple species","NOD-like receptor signaling pathway","JAK-STAT signaling pathway","Shigellosis","Toxoplasmosis","Measles"]	11	["CTD (Carcinoma)","CTD (Cerebral hemorrhage)","Disgenet (Diabetes mellitus type 2)","CTD (Diabetes mellitus type 2)","CTD (Erectile dysfunction)","Disgenet (Erectile dysfunction)","CTD (Head and neck neoplasms)","CTD (Multiple myeloma)","GWAS catalog (Myeloproliferative disorder)","CTD (Myocardial infarction)","Disgenet (Myocardial infarction)"]
KIF3C	2	["Motor neuron disease","Multiple myeloma"]	0	[]	3	["Disgenet (Amyotrophic lateral sclerosis)","CTD (Amyotrophic lateral sclerosis)","Disgenet (Motor neuron disease)"]
BSG	2	["Motor neuron disease","Pancreatic neoplasms"]	0	[]	4	["Disgenet (Amyotrophic lateral sclerosis)","CTD (Amyotrophic lateral sclerosis)","Disgenet (Motor neuron disease)","CTD (Pancreatic neoplasms)"]
CNTF	2	["Motor neuron disease","Cerebral hemorrhage"]	1	["JAK-STAT signaling pathway"]	4	["Disgenet (Amyotrophic lateral sclerosis)","CTD (Amyotrophic lateral sclerosis)","CTD (Cerebral hemorrhage)","Disgenet (Motor neuron disease)"]
GGT1	2	["Carcinoma","Liver disease"]	0	[]	5	["CTD (Carcinoma)","Disgenet (Liver disease)","CTD (Liver disease)","CTD (Myocardial infarction)","Disgenet (Myocardial infarction)"]

BCL2L1 (BCL2 like 1)

Save This Analysis