BCL2 (BCL2 apoptosis regulator)

Gene

• Entrez ID: 596
• Gene name: BCL2 apoptosis regulator
• Gene symbol: BCL2
• Synonyms (NCBI Gene): Bcl-2, PPP1R50
• Chromosome: 18
• Chromosome location: 18q21.33
• Summary: This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003014	hsa-miR-17-5p	Luciferase reporter assay	19666108
MIRT003014	hsa-miR-17-5p	Luciferase reporter assay	19666108
MIRT003011	hsa-miR-20a-5p	Luciferase reporter assay	19666108
MIRT003011	hsa-miR-20a-5p	Luciferase reporter assay	19666108
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay	17877811
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay	17877811
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay	17877811
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay	17877811
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay	18803879
MIRT000065	hsa-miR-34b-5p	Luciferase reporter assay	18803879
MIRT003979	hsa-miR-34c-5p	Luciferase reporter assay	18803879
MIRT002298	hsa-miR-34a-5p	qRT-PCR, Western blot	18803879
MIRT003980	hsa-miR-33b-5p	qRT-PCR, Western blot	18803879
MIRT003979	hsa-miR-34c-5p	qRT-PCR, Western blot	18803879
MIRT000978	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot	18449891
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	18449891
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	18449891
MIRT000815	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	18449891
MIRT002298	hsa-miR-34a-5p	qRT-PCR, Western blot	18505919
MIRT002298	hsa-miR-34a-5p	qRT-PCR, Luciferase reporter assay, Western blot	18803879
MIRT000065	hsa-miR-34b-5p	qRT-PCR, Luciferase reporter assay, Western blot	18803879
MIRT003979	hsa-miR-34c-5p	qRT-PCR, Luciferase reporter assay, Western blot	18803879
MIRT000815	hsa-miR-15a-5p	qRT-PCR	18362358
MIRT001800	hsa-miR-16-5p	qRT-PCR, proteomics analysis	18362358
MIRT000815	hsa-miR-15a-5p	proteomics analysis	18362358
MIRT002298	hsa-miR-34a-5p	Review, Luciferase reporter assay	19461653
MIRT002298	hsa-miR-34a-5p	Review, Luciferase reporter assay, Western blot, Microarray	17914404
MIRT000815	hsa-miR-15a-5p	Luciferase reporter assay	17707831
MIRT000978	hsa-miR-15b-5p	Luciferase reporter assay	18449891
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay	18449891
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay	17351108
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay	17707831
MIRT000192	hsa-miR-204-5p	Luciferase reporter assay	19074899
MIRT000159	hsa-miR-21-5p	Luciferase reporter assay	17072344
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay	18505919
MIRT000815	hsa-miR-15a-5p	Review	19815577
MIRT000392	hsa-miR-1-3p	Review	19815577
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20162574
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20162574
MIRT003500	hsa-miR-181b-5p	Luciferase reporter assay, qRT-PCR, Western blot	20162574
MIRT003500	hsa-miR-181b-5p	Luciferase reporter assay, qRT-PCR, Western blot	20162574
MIRT003499	hsa-miR-181c-5p	Luciferase reporter assay, qRT-PCR, Western blot	20162574
MIRT003499	hsa-miR-181c-5p	Luciferase reporter assay, qRT-PCR, Western blot	20162574
MIRT003498	hsa-miR-181d-5p	Luciferase reporter assay, qRT-PCR, Western blot	20162574
MIRT003498	hsa-miR-181d-5p	Luciferase reporter assay, qRT-PCR, Western blot	20162574
MIRT002298	hsa-miR-34a-5p	Review	20130964
MIRT003449	hsa-miR-34b-3p	Review	20130964
MIRT003979	hsa-miR-34c-5p	Review	20130964
MIRT001800	hsa-miR-16-5p	Review	20130964
MIRT001800	hsa-miR-16-5p	Review	20029422
MIRT003291	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	20041405
MIRT003291	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	20041405
MIRT003290	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	20041405
MIRT003290	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	20041405
MIRT003289	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	20041405
MIRT003289	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	20041405
MIRT000815	hsa-miR-15a-5p	Luciferase reporter assay	19478946
MIRT001800	hsa-miR-16-5p	Immunohistochemistry, Microarray, Western blot	20643754
MIRT000815	hsa-miR-15a-5p	Western blot	20876285
MIRT001800	hsa-miR-16-5p	Western blot	20876285
MIRT000815	hsa-miR-15a-5p	Microarray, qRT-PCR	17260024
MIRT000418	hsa-let-7a-5p	Microarray, qRT-PCR	17260024
MIRT000418	hsa-let-7a-5p	Microarray, qRT-PCR	17260024
MIRT000418	hsa-let-7a-5p	Microarray, qRT-PCR	17260024
MIRT004844	hsa-miR-192-5p	Luciferase reporter assay, qRT-PCR	19074876
MIRT005362	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	20727858
MIRT000815	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	16166262
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	16166262
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay, Western blot	19269153
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay, Microarray, Western blot	17656095
MIRT000290	hsa-miR-153-3p	Luciferase reporter assay, Western blot	19676043
MIRT000290	hsa-miR-153-3p	Luciferase reporter assay, Western blot	19676043
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	19683563
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	19683563
MIRT000815	hsa-miR-15a-5p	Western blot	19903841
MIRT001800	hsa-miR-16-5p	Western blot	19903841
MIRT002298	hsa-miR-34a-5p	Flow, Immunoblot, Luciferase reporter assay	20598588
MIRT005578	hsa-miR-630	Immunoblot, Luciferase reporter assay, qRT-PCR	21274007
MIRT005744	hsa-miR-451a	qRT-PCR, Western blot	20816946
MIRT005744	hsa-miR-451a	qRT-PCR, Western blot	20816946
MIRT000159	hsa-miR-21-5p	Luciferase reporter assay, Western blot	21376256
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay	22285729
MIRT006243	hsa-miR-365a-3p	Luciferase reporter assay, Western blot	22072615
MIRT006243	hsa-miR-365a-3p	Luciferase reporter assay, Western blot	22072615
MIRT006253	hsa-miR-125b-5p	Luciferase reporter assay, Western blot	22293115
MIRT006253	hsa-miR-125b-5p	Luciferase reporter assay, Western blot	22293115
MIRT006243	hsa-miR-365a-3p	Western blot	21640710
MIRT006243	hsa-miR-365a-3p	Western blot	21640710
MIRT006445	hsa-miR-449a	ChIP-seq, Luciferase reporter assay	21569010
MIRT000159	hsa-miR-21-5p	Luciferase reporter assay, Western blot	21376256
MIRT006243	hsa-miR-365a-3p	Western blot	21640710
MIRT006243	hsa-miR-365a-3p	Western blot	21640710
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay	22285729
MIRT006243	hsa-miR-365a-3p	Luciferase reporter assay, Western blot	22072615
MIRT006243	hsa-miR-365a-3p	Luciferase reporter assay, Western blot	22072615
MIRT006253	hsa-miR-125b-5p	Luciferase reporter assay, Western blot	22293115
MIRT006253	hsa-miR-125b-5p	Luciferase reporter assay, Western blot	22293115
MIRT000159	hsa-miR-21-5p	qRT-PCR, Western blot	22528454
MIRT000159	hsa-miR-21-5p	Luciferase reporter assay, Western blot	21376256
MIRT006243	hsa-miR-365a-3p	Western blot	21640710
MIRT006243	hsa-miR-365a-3p	Western blot	21640710
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay	22285729
MIRT006243	hsa-miR-365a-3p	Luciferase reporter assay, Western blot	22072615
MIRT006243	hsa-miR-365a-3p	Luciferase reporter assay, Western blot	22072615
MIRT006253	hsa-miR-125b-5p	Luciferase reporter assay, Western blot	22293115
MIRT006253	hsa-miR-125b-5p	Luciferase reporter assay, Western blot	22293115
MIRT000159	hsa-miR-21-5p	qRT-PCR, Western blot	22528454
MIRT003498	hsa-miR-181d-5p	FACS, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22207524
MIRT003498	hsa-miR-181d-5p	FACS, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22207524
MIRT003498	hsa-miR-181d-5p	FACS, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22207524
MIRT003498	hsa-miR-181d-5p	FACS, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22207524
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22209977
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22209977
MIRT006670	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	21993663
MIRT006673	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21993663
MIRT006674	hsa-miR-429	Luciferase reporter assay, qRT-PCR, Western blot	21993663
MIRT003501	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	21958558
MIRT003501	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	21958558
MIRT000159	hsa-miR-21-5p	Luciferase reporter assay	22710123
MIRT000159	hsa-miR-21-5p	Luciferase reporter assay	22710123
MIRT006868	hsa-miR-136-5p	Luciferase reporter assay	22967897
MIRT006868	hsa-miR-136-5p	Luciferase reporter assay	22967897
MIRT006904	hsa-miR-7-5p	GFP reporter assay, Luciferase reporter assay, qRT-PCR, Western blot	21750649
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay	22610076
MIRT003500	hsa-miR-181b-5p	Luciferase reporter assay	22610076
MIRT006975	hsa-miR-148a-3p	Luciferase reporter assay	21455217
MIRT006975	hsa-miR-148a-3p	Luciferase reporter assay	21455217
MIRT006977	hsa-miR-24-2-5p	Luciferase reporter assay	21463514
MIRT007063	hsa-miR-182-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	22848417
MIRT007063	hsa-miR-182-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	22848417
MIRT007063	hsa-miR-182-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	22848417
MIRT007146	hsa-miR-196b-5p	Immunocytochemistry	23293219
MIRT007348	hsa-miR-143-3p	Western blot	23276710
MIRT003498	hsa-miR-181d-5p	Reporter assay;Western blot;Other	20162574
MIRT019975	hsa-miR-375	qRT-PCR;Microarray	20584986
MIRT000290	hsa-miR-153-3p	Reporter assay	19676043
MIRT007348	hsa-miR-143-3p	Western blot	19843160
MIRT000978	hsa-miR-15b-5p	Reporter assay	18449891
MIRT000978	hsa-miR-15b-5p	Reporter assay;Other	18449891
MIRT024494	hsa-miR-215-5p	Microarray	19074876
MIRT003499	hsa-miR-181c-5p	Reporter assay;Western blot;Other	20162574
MIRT003500	hsa-miR-181b-5p	Reporter assay;Western blot;Other	20162574
MIRT003501	hsa-miR-181a-5p	Reporter assay;Western blot;Other	20162574
MIRT002298	hsa-miR-34a-5p	Reporter assay;Other	21399894
MIRT002298	hsa-miR-34a-5p	Proteomics	21566225
MIRT002298	hsa-miR-34a-5p	Reporter assay;Western blot;qRT-PCR;Other	19683563
MIRT002298	hsa-miR-34a-5p	Reporter assay	20598588
MIRT006904	hsa-miR-7-5p	Reporter assay;Western blot;qRT-PCR;Other	21750649
MIRT004844	hsa-miR-192-5p	Reporter assay;Microarray;Other	19074876
MIRT027158	hsa-miR-103a-3p	Sequencing	20371350
MIRT027929	hsa-miR-96-5p	Sequencing	20371350
MIRT000159	hsa-miR-21-5p	Western blot	21468550
MIRT000159	hsa-miR-21-5p	Western blot;Other	20048743
MIRT001800	hsa-miR-16-5p	Reporter assay	18449891
MIRT001800	hsa-miR-16-5p	Sequencing	20371350
MIRT001800	hsa-miR-16-5p	Western blot	16166262
MIRT001800	hsa-miR-16-5p	Reporter assay	18449891
MIRT000815	hsa-miR-15a-5p	Western blot	16166262
MIRT052936	hsa-miR-205-5p	Immunohistochemistry, qRT-PCR, Western blot	24297308
MIRT007348	hsa-miR-143-3p	5.0	22160209
MIRT007348	hsa-miR-143-3p	5.0	22160209
MIRT007348	hsa-miR-143-3p	Luciferase reporter assay, qRT-PCR, Western blot	22160209
MIRT000192	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	22892391
MIRT053253	hsa-miR-126-3p	In situ hybridization, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23603512
MIRT005362	hsa-miR-195-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23451060
MIRT003014	hsa-miR-17-5p	Luciferase reporter assay, qRT-PCR, Western blot	24280866
MIRT053297	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24280866
MIRT053471	hsa-miR-497-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21258880
MIRT000192	hsa-miR-204-5p	Immunohistochemistry, Microarray, qRT-PCR, Western blot	23152059
MIRT000978	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot	23907579
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	23907579
MIRT006445	hsa-miR-449a	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24248414
MIRT006445	hsa-miR-449a	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24248414
MIRT006445	hsa-miR-449a	Luciferase reporter assay, qRT-PCR, Western blot	24260067
MIRT007348	hsa-miR-143-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25492481
MIRT002298	hsa-miR-34a-5p	qRT-PCR, Western blot	24565525
MIRT000159	hsa-miR-21-5p	ChIP-seq, Immunofluorescence, Western blot	24606718
MIRT437391	hsa-miR-708-5p	Flow, qRT-PCR, Western blot	23754151
MIRT052936	hsa-miR-205-5p	Luciferase reporter assay, Western blot	23612742
MIRT003500	hsa-miR-181b-5p	ELISA, GFP reporter assay, Luciferase reporter assay, qRT-PCR, Western blot	23440261
MIRT003500	hsa-miR-181b-5p	ELISA, GFP reporter assay, Luciferase reporter assay, qRT-PCR, Western blot	23440261
MIRT003500	hsa-miR-181b-5p	ELISA, GFP reporter assay, Luciferase reporter assay, qRT-PCR, Western blot	23440261
MIRT003500	hsa-miR-181b-5p	ELISA, GFP reporter assay, Luciferase reporter assay, qRT-PCR, Western blot	23440261
MIRT002298	hsa-miR-34a-5p	qRT-PCR	23292172
MIRT000192	hsa-miR-204-5p	qRT-PCR, Western blot	24960059
MIRT000192	hsa-miR-204-5p	qRT-PCR, Western blot	24960059
MIRT438781	hsa-miR-211-5p	qRT-PCR, Western blot	24960059
MIRT438781	hsa-miR-211-5p	qRT-PCR, Western blot	24960059
MIRT369727	hsa-miR-448	qRT-PCR, Western blot	24960059
MIRT369727	hsa-miR-448	qRT-PCR, Western blot	24960059
MIRT006445	hsa-miR-449a	qRT-PCR, Western blot	24960059
MIRT006445	hsa-miR-449a	qRT-PCR, Western blot	24960059
MIRT003449	hsa-miR-34b-3p	qRT-PCR, Western blot	24960059
MIRT003449	hsa-miR-34b-3p	qRT-PCR, Western blot	24960059
MIRT003979	hsa-miR-34c-5p	qRT-PCR, Western blot	24960059
MIRT003979	hsa-miR-34c-5p	qRT-PCR, Western blot	24960059
MIRT438772	hsa-miR-494-3p	qRT-PCR, Western blot	24960059
MIRT438772	hsa-miR-494-3p	qRT-PCR, Western blot	24960059
MIRT003501	hsa-miR-181a-5p	Immunoblot, qRT-PCR, Western blot	24002437
MIRT438662	hsa-miR-503-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	23856992
MIRT438662	hsa-miR-503-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	23856992
MIRT438617	hsa-miR-224-5p	Microarray, qRT-PCR, Western blot	22989374
MIRT003291	hsa-miR-29a-3p	qRT-PCR	25006537
MIRT003290	hsa-miR-29b-3p	qRT-PCR	25006537
MIRT001800	hsa-miR-16-5p	Western blot	24148817
MIRT199194	hsa-miR-206	Flow, qRT-PCR	24855559
MIRT438304	hsa-miR-135a-5p	Luciferase reporter assay, qRT-PCR	25230140
MIRT438196	hsa-miR-30b-5p	Luciferase reporter assay	24178239
MIRT438196	hsa-miR-30b-5p	Luciferase reporter assay	24178239
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24335172
MIRT438155	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438155	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438155	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438155	hsa-miR-184	Luciferase reporter assay	24157866
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay	23862748
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay	23862748
MIRT003289	hsa-miR-29c-3p	Luciferase reporter assay	23894561
MIRT003290	hsa-miR-29b-3p	Luciferase reporter assay	23894561
MIRT007063	hsa-miR-182-5p	qRT-PCR	23936432
MIRT003500	hsa-miR-181b-5p	ELISA, GFP reporter assay, Luciferase reporter assay, qRT-PCR, Western blot	23440261
MIRT003500	hsa-miR-181b-5p	ELISA, GFP reporter assay, Luciferase reporter assay, qRT-PCR, Western blot	23440261
MIRT003500	hsa-miR-181b-5p	ELISA, GFP reporter assay, Luciferase reporter assay, qRT-PCR, Western blot	23440261
MIRT003500	hsa-miR-181b-5p	ELISA, GFP reporter assay, Luciferase reporter assay, qRT-PCR, Western blot	23440261
MIRT002298	hsa-miR-34a-5p	qRT-PCR	23292172
MIRT000192	hsa-miR-204-5p	qRT-PCR, Western blot	24960059
MIRT000192	hsa-miR-204-5p	qRT-PCR, Western blot	24960059
MIRT438781	hsa-miR-211-5p	qRT-PCR, Western blot	24960059
MIRT438781	hsa-miR-211-5p	qRT-PCR, Western blot	24960059
MIRT369727	hsa-miR-448	qRT-PCR, Western blot	24960059
MIRT369727	hsa-miR-448	qRT-PCR, Western blot	24960059
MIRT006445	hsa-miR-449a	qRT-PCR, Western blot	24960059
MIRT006445	hsa-miR-449a	qRT-PCR, Western blot	24960059
MIRT003449	hsa-miR-34b-3p	qRT-PCR, Western blot	24960059
MIRT003449	hsa-miR-34b-3p	qRT-PCR, Western blot	24960059
MIRT003979	hsa-miR-34c-5p	qRT-PCR, Western blot	24960059
MIRT003979	hsa-miR-34c-5p	qRT-PCR, Western blot	24960059
MIRT438772	hsa-miR-494-3p	qRT-PCR, Western blot	24960059
MIRT438772	hsa-miR-494-3p	qRT-PCR, Western blot	24960059
MIRT003501	hsa-miR-181a-5p	Immunoblot, qRT-PCR, Western blot	24002437
MIRT438662	hsa-miR-503-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	23856992
MIRT438662	hsa-miR-503-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	23856992
MIRT438617	hsa-miR-224-5p	Microarray, qRT-PCR, Western blot	22989374
MIRT003291	hsa-miR-29a-3p	qRT-PCR	25006537
MIRT003290	hsa-miR-29b-3p	qRT-PCR	25006537
MIRT001800	hsa-miR-16-5p	Western blot	24148817
MIRT199194	hsa-miR-206	Flow, qRT-PCR	24855559
MIRT438304	hsa-miR-135a-5p	Luciferase reporter assay, qRT-PCR	25230140
MIRT438196	hsa-miR-30b-5p	Luciferase reporter assay	24178239
MIRT438196	hsa-miR-30b-5p	Luciferase reporter assay	24178239
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24335172
MIRT438155	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438155	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438155	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438155	hsa-miR-184	Luciferase reporter assay	24157866
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay	23862748
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay	23862748
MIRT003289	hsa-miR-29c-3p	Luciferase reporter assay	23894561
MIRT003290	hsa-miR-29b-3p	Luciferase reporter assay	23894561
MIRT007063	hsa-miR-182-5p	qRT-PCR	23936432
MIRT000815	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT000978	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT001800	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT005362	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT000159	hsa-miR-21-5p	Luciferase reporter assay, Western blot	25327529
MIRT001800	hsa-miR-16-5p	Immunoprecipitaion, qRT-PCR, Immunoblot, Western blot	25435430
MIRT002298	hsa-miR-34a-5p	5.0	26802970
MIRT002298	hsa-miR-34a-5p	5.0	26802970
MIRT002298	hsa-miR-34a-5p	qRT-PCR, Western blot	27939626
MIRT003499	hsa-miR-181c-5p	GFP reporter assay, qRT-PCR, Western blot	25898913
MIRT000978	hsa-miR-15b-5p	qRT-PCR, Western blot	26884837
MIRT002298	hsa-miR-34a-5p	Flow, QRTPCR, Western blot	26406332
MIRT438662	hsa-miR-503-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24931256
MIRT438662	hsa-miR-503-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24931256
MIRT387672	hsa-miR-125a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26297542
MIRT387672	hsa-miR-125a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26297542
MIRT006674	hsa-miR-429	Luciferase reporter assay, qRT-PCR, Western blot	26513239
MIRT006674	hsa-miR-429	Luciferase reporter assay, qRT-PCR, Western blot	26513239
MIRT438753	hsa-miR-9-5p	Luciferase reporter assay, Western blot	26660116
MIRT732216	hsa-miR-9-5p	Luciferase reporter assay, Western blot	26660116
MIRT732232	hsa-miR-139-5p	Luciferase reporter assay, qRT-PCR, Western blot	27244080
MIRT732232	hsa-miR-139-5p	Luciferase reporter assay, qRT-PCR, Western blot	27244080
MIRT199222	hsa-miR-34a-3p	Luciferase reporter assay	28340489
MIRT199222	hsa-miR-34a-3p	Luciferase reporter assay	28340489
MIRT199222	hsa-miR-34a-3p	Luciferase reporter assay	28340489
MIRT199222	hsa-miR-34a-3p	Luciferase reporter assay	28340489
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27802900
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27802900
MIRT005362	hsa-miR-195-5p	qRT-PCR, Western blot	26064276
MIRT006445	hsa-miR-449a	Western blot	27351886
MIRT006445	hsa-miR-449a	Western blot	27351886
MIRT006445	hsa-miR-449a	Western blot	27351886
MIRT006445	hsa-miR-449a	Western blot	27351886
MIRT006445	hsa-miR-449a	Western blot	27351886
MIRT006445	hsa-miR-449a	Western blot	27351886
MIRT006445	hsa-miR-449a	Western blot	27351886
MIRT006445	hsa-miR-449a	Western blot	27351886
MIRT004844	hsa-miR-192-5p	qRT-PCR, Western blot	26550150
MIRT004844	hsa-miR-192-5p	qRT-PCR, Western blot	26550150
MIRT004844	hsa-miR-192-5p	qRT-PCR, Western blot	26550150
MIRT004844	hsa-miR-192-5p	qRT-PCR, Western blot	26550150
MIRT004844	hsa-miR-192-5p	qRT-PCR, Western blot	26550150
MIRT004844	hsa-miR-192-5p	qRT-PCR, Western blot	26550150
MIRT004844	hsa-miR-192-5p	qRT-PCR, Western blot	26550150
MIRT003979	hsa-miR-34c-5p	Next Generation Sequencing (NGS), qRT-PCR, Western blot	26795575
MIRT000192	hsa-miR-204-5p	Luciferase reporter assay, Western blot	28280358
MIRT000192	hsa-miR-204-5p	Luciferase reporter assay, Western blot	28280358
MIRT006253	hsa-miR-125b-5p	ELISA, qRT-PCR	26057745
MIRT053471	hsa-miR-497-5p	Luciferase reporter assay, qRT-PCR, Western blot	26339338
MIRT053471	hsa-miR-497-5p	Luciferase reporter assay, qRT-PCR, Western blot	26339338
MIRT000815	hsa-miR-15a-5p	Western blot	26397135
MIRT001800	hsa-miR-16-5p	Western blot	26397135
MIRT000192	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	27519795
MIRT000192	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	27519795
MIRT006904	hsa-miR-7-5p	qRT-PCR, Western blot	26464649
MIRT006904	hsa-miR-7-5p	qRT-PCR, Western blot	26464649
MIRT006904	hsa-miR-7-5p	qRT-PCR, Western blot	26464649
MIRT006904	hsa-miR-7-5p	qRT-PCR, Western blot	26464649
MIRT438662	hsa-miR-503-5p	Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	28343379
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	25910896
MIRT002298	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	25910896
MIRT001800	hsa-miR-16-5p	Microarray, qRT-PCR, Western blot	26722459
MIRT735442	hsa-miR-15a-3p	qRT-PCR, Western blot	27596960
MIRT735443	hsa-miR-16-1-3p	qRT-PCR, Western blot	27596960
MIRT732589	hsa-miR-133a-3p	Immunofluorescence, qRT-PCR, Western blotting	33639970
MIRT000815	hsa-miR-15a-5p	RNA-seq, qRT-PCR	32266559
MIRT002298	hsa-miR-34a-5p	qRT-PCR	33773546
MIRT438662	hsa-miR-503-5p	qRT-PCR, Western blotting	33262626
MIRT000159	hsa-miR-21-5p	RNA-seq, qRT-PCR	34209741
MIRT005362	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blotting	31807149
MIRT005362	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blotting	31807149
MIRT001800	hsa-miR-16-5p	Immunohistochemistry (IHC), qRT-PCR, Western blotting	33122919
MIRT733640	hsa-miR-140-3p	Immunofluorescence, Luciferase reporter assay, Western blotting	33953572
MIRT733816	hsa-miR-451b	qRT-PCR, Western blotting	33725258
MIRT199222	hsa-miR-34a-3p	qRT-PCR	33718673
MIRT003014	hsa-miR-17-5p	qRT-PCR	31797280
MIRT733640	hsa-miR-140-3p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blotting	33838016
MIRT734377	hsa-miR-155-5p	qRT-PCR	32507875
MIRT734524	hsa-miR-1183	ELISA, Immunocytochemistry (ICC), Luciferase reporter assay, qRT-PCR	33073840
MIRT002298	hsa-miR-34a-5p	Western blotting, Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR, Flow cytometry	32161722
MIRT734923	hsa-miR-145-3p	qRT-PCR	33250681
MIRT734930	hsa-miR-214-3p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	33280526
MIRT735069	hsa-miR-27a-5p	Luciferase reporter assay, Western blotting, Microarray, Immunofluorescence, qRT-PCR, Flow cytometry	32790210
MIRT438781	hsa-miR-211-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	31637455
MIRT735317	hsa-miR-15b-3p	Western blotting, Microarray, qRT-PCR, Flow cytometry	32355808
MIRT735442	hsa-miR-15a-3p	Western blotting, qRT-PCR	32190086
MIRT735443	hsa-miR-16-1-3p	Western blotting, qRT-PCR	32190086
MIRT000192	hsa-miR-204-5p	Western blotting, qRT-PCR	32178301
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	31497196
MIRT001800	hsa-miR-16-5p	Luciferase reporter assay, Western blotting	31801064
MIRT387672	hsa-miR-125a-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	31541355
MIRT003501	hsa-miR-181a-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	31541355
MIRT736349	hsa-miR-5008-5p	Luciferase reporter assay, qRT-PCR	33233721
MIRT736463	hsa-miR-23a-3p	qRT-PCR, Flow cytometry	33197036
MIRT737173	hsa-miR-188-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33902604
MIRT737264	hsa-miR-98-3p	qRT-PCR	32647414
MIRT000290	hsa-miR-153-3p	Luciferase reporter assay	37232358
MIRT003499	hsa-miR-181c-5p	Western blotting, qRT-PCR	36676955
MIRT755569	miR-153	Luciferase reporter assay, Western blotting, qRT-PCR	37381058
MIRT755575	hsa-miR-625-5p	qRT-PCR	36671913
MIRT002298	hsa-miR-34a-5p	qRT-PCR, Flow cytometry	34655330
MIRT755831	hsa-miR-646	Western blotting, qRT-PCR, in vitro cullelar assays, Flow cytometry	37155307
MIRT755892	hsa-miR-432-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34532813
MIRT004844	hsa-miR-192-5p	Luciferase reporter assay	36803590
MIRT756191	hsa-miR-223-3p	Western blotting, qRT-PCR	38155264
MIRT756200	hsa-miR-107	Immunoprecipitaion (IP)	36816358
MIRT756243	hsa-miR-3188	Luciferase reporter assay, Western blotting	38565755
MIRT756317	hsa-miR-29b-1-5p	Western blotting, Immunofluorescence	38934067
MIRT732232	hsa-miR-139-5p	Western blotting	37794118
MIRT818359	hsa-miR-1	CLIP-seq
MIRT818360	hsa-miR-1207-5p	CLIP-seq
MIRT818361	hsa-miR-1229	CLIP-seq
MIRT818362	hsa-miR-1237	CLIP-seq
MIRT818363	hsa-miR-1243	CLIP-seq
MIRT818364	hsa-miR-1246	CLIP-seq
MIRT818365	hsa-miR-1248	CLIP-seq
MIRT818366	hsa-miR-1250	CLIP-seq
MIRT818367	hsa-miR-1255a	CLIP-seq
MIRT818368	hsa-miR-1255b	CLIP-seq
MIRT818369	hsa-miR-1257	CLIP-seq
MIRT818370	hsa-miR-1261	CLIP-seq
MIRT818371	hsa-miR-1271	CLIP-seq
MIRT818372	hsa-miR-1273f	CLIP-seq
MIRT818373	hsa-miR-1275	CLIP-seq
MIRT818374	hsa-miR-1290	CLIP-seq
MIRT818375	hsa-miR-1307	CLIP-seq
MIRT818376	hsa-miR-1321	CLIP-seq
MIRT818377	hsa-miR-136	CLIP-seq
MIRT818378	hsa-miR-143	CLIP-seq
MIRT818379	hsa-miR-147	CLIP-seq
MIRT818380	hsa-miR-15a	CLIP-seq
MIRT818381	hsa-miR-15b	CLIP-seq
MIRT818382	hsa-miR-16	CLIP-seq
MIRT818383	hsa-miR-181a	CLIP-seq
MIRT818384	hsa-miR-181b	CLIP-seq
MIRT818385	hsa-miR-181c	CLIP-seq
MIRT818386	hsa-miR-181d	CLIP-seq
MIRT818387	hsa-miR-182	CLIP-seq
MIRT818388	hsa-miR-185	CLIP-seq
MIRT818389	hsa-miR-1915	CLIP-seq
MIRT818390	hsa-miR-195	CLIP-seq
MIRT818391	hsa-miR-197	CLIP-seq
MIRT818392	hsa-miR-203	CLIP-seq
MIRT818393	hsa-miR-204	CLIP-seq
MIRT818394	hsa-miR-2052	CLIP-seq
MIRT818395	hsa-miR-2053	CLIP-seq
MIRT818396	hsa-miR-211	CLIP-seq
MIRT818397	hsa-miR-219-2-3p	CLIP-seq
MIRT818398	hsa-miR-2278	CLIP-seq
MIRT818399	hsa-miR-23a	CLIP-seq
MIRT818400	hsa-miR-23b	CLIP-seq
MIRT818401	hsa-miR-23c	CLIP-seq
MIRT818402	hsa-miR-25	CLIP-seq
MIRT818403	hsa-miR-2964a-5p	CLIP-seq
MIRT818404	hsa-miR-298	CLIP-seq
MIRT818405	hsa-miR-302f	CLIP-seq
MIRT818406	hsa-miR-3064-3p	CLIP-seq
MIRT818407	hsa-miR-3074-3p	CLIP-seq
MIRT818408	hsa-miR-3120-5p	CLIP-seq
MIRT818409	hsa-miR-3121-3p	CLIP-seq
MIRT818410	hsa-miR-3123	CLIP-seq
MIRT818411	hsa-miR-3140-3p	CLIP-seq
MIRT818412	hsa-miR-3144-3p	CLIP-seq
MIRT818413	hsa-miR-3145-3p	CLIP-seq
MIRT818414	hsa-miR-3150b-3p	CLIP-seq
MIRT818415	hsa-miR-3152-5p	CLIP-seq
MIRT818416	hsa-miR-3157-5p	CLIP-seq
MIRT818417	hsa-miR-3158-3p	CLIP-seq
MIRT818418	hsa-miR-3160-3p	CLIP-seq
MIRT818419	hsa-miR-3162-3p	CLIP-seq
MIRT818420	hsa-miR-3163	CLIP-seq
MIRT818421	hsa-miR-3164	CLIP-seq
MIRT818422	hsa-miR-3167	CLIP-seq
MIRT818423	hsa-miR-3185	CLIP-seq
MIRT818424	hsa-miR-32	CLIP-seq
MIRT818425	hsa-miR-3201	CLIP-seq
MIRT818426	hsa-miR-3202	CLIP-seq
MIRT818427	hsa-miR-323b-5p	CLIP-seq
MIRT818428	hsa-miR-340	CLIP-seq
MIRT818429	hsa-miR-342-5p	CLIP-seq
MIRT818430	hsa-miR-34a	CLIP-seq
MIRT818431	hsa-miR-34c-3p	CLIP-seq
MIRT818432	hsa-miR-3545-3p	CLIP-seq
MIRT818433	hsa-miR-3612	CLIP-seq
MIRT818434	hsa-miR-3613-3p	CLIP-seq
MIRT818435	hsa-miR-361-3p	CLIP-seq
MIRT818436	hsa-miR-3614-3p	CLIP-seq
MIRT818437	hsa-miR-3622b-5p	CLIP-seq
MIRT818438	hsa-miR-363	CLIP-seq
MIRT818439	hsa-miR-365	CLIP-seq
MIRT818440	hsa-miR-3654	CLIP-seq
MIRT818441	hsa-miR-3662	CLIP-seq
MIRT818442	hsa-miR-367	CLIP-seq
MIRT818443	hsa-miR-3678-3p	CLIP-seq
MIRT818444	hsa-miR-3679-3p	CLIP-seq
MIRT818445	hsa-miR-3682-3p	CLIP-seq
MIRT818446	hsa-miR-3682-5p	CLIP-seq
MIRT818447	hsa-miR-3686	CLIP-seq
MIRT818448	hsa-miR-3689a-3p	CLIP-seq
MIRT818449	hsa-miR-3689c	CLIP-seq
MIRT818450	hsa-miR-374c	CLIP-seq
MIRT818451	hsa-miR-377	CLIP-seq
MIRT818452	hsa-miR-3914	CLIP-seq
MIRT818453	hsa-miR-3918	CLIP-seq
MIRT818454	hsa-miR-3922-5p	CLIP-seq
MIRT818455	hsa-miR-3929	CLIP-seq
MIRT818456	hsa-miR-3943	CLIP-seq
MIRT818457	hsa-miR-409-3p	CLIP-seq
MIRT818458	hsa-miR-410	CLIP-seq
MIRT818459	hsa-miR-412	CLIP-seq
MIRT818460	hsa-miR-424	CLIP-seq
MIRT818461	hsa-miR-4259	CLIP-seq
MIRT818462	hsa-miR-4262	CLIP-seq
MIRT818463	hsa-miR-4267	CLIP-seq
MIRT818464	hsa-miR-4269	CLIP-seq
MIRT818465	hsa-miR-4270	CLIP-seq
MIRT818466	hsa-miR-4275	CLIP-seq
MIRT818467	hsa-miR-4279	CLIP-seq
MIRT818468	hsa-miR-4282	CLIP-seq
MIRT818469	hsa-miR-4289	CLIP-seq
MIRT818470	hsa-miR-4306	CLIP-seq
MIRT818471	hsa-miR-4307	CLIP-seq
MIRT818472	hsa-miR-4310	CLIP-seq
MIRT818473	hsa-miR-4317	CLIP-seq
MIRT818474	hsa-miR-432	CLIP-seq
MIRT818475	hsa-miR-4325	CLIP-seq
MIRT818476	hsa-miR-4328	CLIP-seq
MIRT818477	hsa-miR-4330	CLIP-seq
MIRT818478	hsa-miR-4419b	CLIP-seq
MIRT818479	hsa-miR-4422	CLIP-seq
MIRT818480	hsa-miR-4433	CLIP-seq
MIRT818481	hsa-miR-4438	CLIP-seq
MIRT818482	hsa-miR-4441	CLIP-seq
MIRT818483	hsa-miR-4443	CLIP-seq
MIRT818484	hsa-miR-4446-5p	CLIP-seq
MIRT818485	hsa-miR-4453	CLIP-seq
MIRT818486	hsa-miR-4457	CLIP-seq
MIRT818487	hsa-miR-4460	CLIP-seq
MIRT818488	hsa-miR-4469	CLIP-seq
MIRT818489	hsa-miR-4474-5p	CLIP-seq
MIRT818490	hsa-miR-4476	CLIP-seq
MIRT818491	hsa-miR-4478	CLIP-seq
MIRT818492	hsa-miR-4487	CLIP-seq
MIRT818493	hsa-miR-449b	CLIP-seq
MIRT818494	hsa-miR-4509	CLIP-seq
MIRT818495	hsa-miR-4512	CLIP-seq
MIRT818496	hsa-miR-4524	CLIP-seq
MIRT818497	hsa-miR-4538	CLIP-seq
MIRT818498	hsa-miR-4539	CLIP-seq
MIRT818499	hsa-miR-4638-5p	CLIP-seq
MIRT818500	hsa-miR-4639-3p	CLIP-seq
MIRT818501	hsa-miR-4639-5p	CLIP-seq
MIRT818502	hsa-miR-4644	CLIP-seq
MIRT818503	hsa-miR-4652-3p	CLIP-seq
MIRT818504	hsa-miR-4664-5p	CLIP-seq
MIRT818505	hsa-miR-4665-5p	CLIP-seq
MIRT818506	hsa-miR-4684-3p	CLIP-seq
MIRT818507	hsa-miR-4685-5p	CLIP-seq
MIRT818508	hsa-miR-4691-3p	CLIP-seq
MIRT818509	hsa-miR-4694-3p	CLIP-seq
MIRT818510	hsa-miR-4699-3p	CLIP-seq
MIRT818511	hsa-miR-4708-5p	CLIP-seq
MIRT818512	hsa-miR-4709-3p	CLIP-seq
MIRT818513	hsa-miR-4711-3p	CLIP-seq
MIRT818514	hsa-miR-4720-3p	CLIP-seq
MIRT818515	hsa-miR-4727-3p	CLIP-seq
MIRT818516	hsa-miR-4731-3p	CLIP-seq
MIRT818517	hsa-miR-4736	CLIP-seq
MIRT818518	hsa-miR-4739	CLIP-seq
MIRT818519	hsa-miR-4742-3p	CLIP-seq
MIRT818520	hsa-miR-4744	CLIP-seq
MIRT818521	hsa-miR-4746-3p	CLIP-seq
MIRT818522	hsa-miR-4755-5p	CLIP-seq
MIRT818523	hsa-miR-4756-5p	CLIP-seq
MIRT818524	hsa-miR-4762-3p	CLIP-seq
MIRT818525	hsa-miR-4763-3p	CLIP-seq
MIRT818526	hsa-miR-4770	CLIP-seq
MIRT818527	hsa-miR-4775	CLIP-seq
MIRT818528	hsa-miR-4781-3p	CLIP-seq
MIRT818529	hsa-miR-4784	CLIP-seq
MIRT818530	hsa-miR-4791	CLIP-seq
MIRT818531	hsa-miR-4797-3p	CLIP-seq
MIRT818532	hsa-miR-4797-5p	CLIP-seq
MIRT818533	hsa-miR-4799-5p	CLIP-seq
MIRT818534	hsa-miR-4801	CLIP-seq
MIRT818535	hsa-miR-4804-3p	CLIP-seq
MIRT818536	hsa-miR-490-5p	CLIP-seq
MIRT818537	hsa-miR-497	CLIP-seq
MIRT818538	hsa-miR-498	CLIP-seq
MIRT818539	hsa-miR-503	CLIP-seq
MIRT818540	hsa-miR-5095	CLIP-seq
MIRT818541	hsa-miR-510	CLIP-seq
MIRT818542	hsa-miR-512-5p	CLIP-seq
MIRT818543	hsa-miR-515-5p	CLIP-seq
MIRT818544	hsa-miR-522	CLIP-seq
MIRT818545	hsa-miR-526b	CLIP-seq
MIRT818546	hsa-miR-548a-3p	CLIP-seq
MIRT818547	hsa-miR-548ac	CLIP-seq
MIRT818548	hsa-miR-548ae	CLIP-seq
MIRT818549	hsa-miR-548ag	CLIP-seq
MIRT818550	hsa-miR-548ai	CLIP-seq
MIRT818551	hsa-miR-548aj	CLIP-seq
MIRT818552	hsa-miR-548am	CLIP-seq
MIRT818553	hsa-miR-548c-3p	CLIP-seq
MIRT818554	hsa-miR-548d-3p	CLIP-seq
MIRT818555	hsa-miR-548e	CLIP-seq
MIRT818556	hsa-miR-548f	CLIP-seq
MIRT818557	hsa-miR-548t	CLIP-seq
MIRT818558	hsa-miR-548x	CLIP-seq
MIRT818559	hsa-miR-548z	CLIP-seq
MIRT818560	hsa-miR-558	CLIP-seq
MIRT818561	hsa-miR-568	CLIP-seq
MIRT818562	hsa-miR-569	CLIP-seq
MIRT818563	hsa-miR-571	CLIP-seq
MIRT818564	hsa-miR-577	CLIP-seq
MIRT818565	hsa-miR-578	CLIP-seq
MIRT818566	hsa-miR-579	CLIP-seq
MIRT818567	hsa-miR-587	CLIP-seq
MIRT818568	hsa-miR-590-3p	CLIP-seq
MIRT818569	hsa-miR-595	CLIP-seq
MIRT818570	hsa-miR-606	CLIP-seq
MIRT818571	hsa-miR-613	CLIP-seq
MIRT818572	hsa-miR-616	CLIP-seq
MIRT818573	hsa-miR-617	CLIP-seq
MIRT818574	hsa-miR-623	CLIP-seq
MIRT818575	hsa-miR-624	CLIP-seq
MIRT818576	hsa-miR-636	CLIP-seq
MIRT818577	hsa-miR-642a	CLIP-seq
MIRT818578	hsa-miR-643	CLIP-seq
MIRT755831	hsa-miR-646	CLIP-seq
MIRT818579	hsa-miR-650	CLIP-seq
MIRT818580	hsa-miR-655	CLIP-seq
MIRT818581	hsa-miR-656	CLIP-seq
MIRT818582	hsa-miR-664	CLIP-seq
MIRT818583	hsa-miR-765	CLIP-seq
MIRT818584	hsa-miR-873	CLIP-seq
MIRT818585	hsa-miR-876-5p	CLIP-seq
MIRT818586	hsa-miR-885-5p	CLIP-seq
MIRT818587	hsa-miR-889	CLIP-seq
MIRT818588	hsa-miR-92a	CLIP-seq
MIRT818589	hsa-miR-92b	CLIP-seq
MIRT818590	hsa-miR-96	CLIP-seq
MIRT1941869	hsa-miR-1178	CLIP-seq
MIRT1941870	hsa-miR-1200	CLIP-seq
MIRT1941871	hsa-miR-1234	CLIP-seq
MIRT818363	hsa-miR-1243	CLIP-seq
MIRT818364	hsa-miR-1246	CLIP-seq
MIRT818366	hsa-miR-1250	CLIP-seq
MIRT1941872	hsa-miR-1251	CLIP-seq
MIRT1941873	hsa-miR-1267	CLIP-seq
MIRT818371	hsa-miR-1271	CLIP-seq
MIRT818373	hsa-miR-1275	CLIP-seq
MIRT818374	hsa-miR-1290	CLIP-seq
MIRT1941874	hsa-miR-1305	CLIP-seq
MIRT1941875	hsa-miR-1324	CLIP-seq
MIRT1941876	hsa-miR-140-5p	CLIP-seq
MIRT1941877	hsa-miR-146b-3p	CLIP-seq
MIRT818383	hsa-miR-181a	CLIP-seq
MIRT818384	hsa-miR-181b	CLIP-seq
MIRT818385	hsa-miR-181c	CLIP-seq
MIRT818386	hsa-miR-181d	CLIP-seq
MIRT818387	hsa-miR-182	CLIP-seq
MIRT818388	hsa-miR-185	CLIP-seq
MIRT818389	hsa-miR-1915	CLIP-seq
MIRT1941878	hsa-miR-2115	CLIP-seq
MIRT1941879	hsa-miR-216a	CLIP-seq
MIRT1941880	hsa-miR-217	CLIP-seq
MIRT1941881	hsa-miR-224	CLIP-seq
MIRT818406	hsa-miR-3064-3p	CLIP-seq
MIRT1941882	hsa-miR-3121-5p	CLIP-seq
MIRT818410	hsa-miR-3123	CLIP-seq
MIRT1941883	hsa-miR-3127-5p	CLIP-seq
MIRT818413	hsa-miR-3145-3p	CLIP-seq
MIRT818417	hsa-miR-3158-3p	CLIP-seq
MIRT1941884	hsa-miR-3159	CLIP-seq
MIRT818418	hsa-miR-3160-3p	CLIP-seq
MIRT818422	hsa-miR-3167	CLIP-seq
MIRT1941885	hsa-miR-3173-5p	CLIP-seq
MIRT1941886	hsa-miR-3180-5p	CLIP-seq
MIRT1941887	hsa-miR-3194-3p	CLIP-seq
MIRT818427	hsa-miR-323b-5p	CLIP-seq
MIRT1941888	hsa-miR-326	CLIP-seq
MIRT1941889	hsa-miR-330-5p	CLIP-seq
MIRT818429	hsa-miR-342-5p	CLIP-seq
MIRT1941890	hsa-miR-3545-5p	CLIP-seq
MIRT818436	hsa-miR-3614-3p	CLIP-seq
MIRT818439	hsa-miR-365	CLIP-seq
MIRT818440	hsa-miR-3654	CLIP-seq
MIRT818441	hsa-miR-3662	CLIP-seq
MIRT1941891	hsa-miR-3667-3p	CLIP-seq
MIRT1941892	hsa-miR-3670	CLIP-seq
MIRT1941893	hsa-miR-3671	CLIP-seq
MIRT818446	hsa-miR-3682-5p	CLIP-seq
MIRT818448	hsa-miR-3689a-3p	CLIP-seq
MIRT818449	hsa-miR-3689c	CLIP-seq
MIRT818450	hsa-miR-374c	CLIP-seq
MIRT818453	hsa-miR-3918	CLIP-seq
MIRT818454	hsa-miR-3922-5p	CLIP-seq
MIRT818455	hsa-miR-3929	CLIP-seq
MIRT818457	hsa-miR-409-3p	CLIP-seq
MIRT818458	hsa-miR-410	CLIP-seq
MIRT818461	hsa-miR-4259	CLIP-seq
MIRT818462	hsa-miR-4262	CLIP-seq
MIRT818464	hsa-miR-4269	CLIP-seq
MIRT1941894	hsa-miR-4280	CLIP-seq
MIRT1941895	hsa-miR-4297	CLIP-seq
MIRT1941896	hsa-miR-4303	CLIP-seq
MIRT818470	hsa-miR-4306	CLIP-seq
MIRT818471	hsa-miR-4307	CLIP-seq
MIRT818472	hsa-miR-4310	CLIP-seq
MIRT818474	hsa-miR-432	CLIP-seq
MIRT818477	hsa-miR-4330	CLIP-seq
MIRT818478	hsa-miR-4419b	CLIP-seq
MIRT818479	hsa-miR-4422	CLIP-seq
MIRT818483	hsa-miR-4443	CLIP-seq
MIRT818484	hsa-miR-4446-5p	CLIP-seq
MIRT818487	hsa-miR-4460	CLIP-seq
MIRT1941897	hsa-miR-4467	CLIP-seq
MIRT1941898	hsa-miR-4474-3p	CLIP-seq
MIRT818489	hsa-miR-4474-5p	CLIP-seq
MIRT1941899	hsa-miR-4477a	CLIP-seq
MIRT818491	hsa-miR-4478	CLIP-seq
MIRT818492	hsa-miR-4487	CLIP-seq
MIRT818494	hsa-miR-4509	CLIP-seq
MIRT818502	hsa-miR-4644	CLIP-seq
MIRT818503	hsa-miR-4652-3p	CLIP-seq
MIRT818504	hsa-miR-4664-5p	CLIP-seq
MIRT818505	hsa-miR-4665-5p	CLIP-seq
MIRT1941900	hsa-miR-4676-5p	CLIP-seq
MIRT818507	hsa-miR-4685-5p	CLIP-seq
MIRT1941901	hsa-miR-4690-5p	CLIP-seq
MIRT818508	hsa-miR-4691-3p	CLIP-seq
MIRT818509	hsa-miR-4694-3p	CLIP-seq
MIRT818510	hsa-miR-4699-3p	CLIP-seq
MIRT1941902	hsa-miR-4704-5p	CLIP-seq
MIRT1941903	hsa-miR-4717-5p	CLIP-seq
MIRT1941904	hsa-miR-4719	CLIP-seq
MIRT818514	hsa-miR-4720-3p	CLIP-seq
MIRT1941905	hsa-miR-4725-5p	CLIP-seq
MIRT818515	hsa-miR-4727-3p	CLIP-seq
MIRT1941906	hsa-miR-4729	CLIP-seq
MIRT818516	hsa-miR-4731-3p	CLIP-seq
MIRT818521	hsa-miR-4746-3p	CLIP-seq
MIRT1941907	hsa-miR-4778-5p	CLIP-seq
MIRT1941908	hsa-miR-4786-5p	CLIP-seq
MIRT818531	hsa-miR-4797-3p	CLIP-seq
MIRT818532	hsa-miR-4797-5p	CLIP-seq
MIRT818533	hsa-miR-4799-5p	CLIP-seq
MIRT818534	hsa-miR-4801	CLIP-seq
MIRT1941909	hsa-miR-485-3p	CLIP-seq
MIRT1941910	hsa-miR-485-5p	CLIP-seq
MIRT818536	hsa-miR-490-5p	CLIP-seq
MIRT818538	hsa-miR-498	CLIP-seq
MIRT1941911	hsa-miR-504	CLIP-seq
MIRT818541	hsa-miR-510	CLIP-seq
MIRT818542	hsa-miR-512-5p	CLIP-seq
MIRT1941912	hsa-miR-514	CLIP-seq
MIRT1941913	hsa-miR-514b-3p	CLIP-seq
MIRT818543	hsa-miR-515-5p	CLIP-seq
MIRT1941914	hsa-miR-518a-5p	CLIP-seq
MIRT1941915	hsa-miR-520a-5p	CLIP-seq
MIRT818544	hsa-miR-522	CLIP-seq
MIRT1941916	hsa-miR-525-5p	CLIP-seq
MIRT1941917	hsa-miR-527	CLIP-seq
MIRT818546	hsa-miR-548a-3p	CLIP-seq
MIRT1941918	hsa-miR-548ad	CLIP-seq
MIRT818548	hsa-miR-548ae	CLIP-seq
MIRT818549	hsa-miR-548ag	CLIP-seq
MIRT818550	hsa-miR-548ai	CLIP-seq
MIRT818551	hsa-miR-548aj	CLIP-seq
MIRT818552	hsa-miR-548am	CLIP-seq
MIRT818553	hsa-miR-548c-3p	CLIP-seq
MIRT818555	hsa-miR-548e	CLIP-seq
MIRT818556	hsa-miR-548f	CLIP-seq
MIRT818558	hsa-miR-548x	CLIP-seq
MIRT1941919	hsa-miR-550b	CLIP-seq
MIRT1941920	hsa-miR-555	CLIP-seq
MIRT818560	hsa-miR-558	CLIP-seq
MIRT1941921	hsa-miR-561	CLIP-seq
MIRT818563	hsa-miR-571	CLIP-seq
MIRT1941922	hsa-miR-575	CLIP-seq
MIRT818564	hsa-miR-577	CLIP-seq
MIRT818567	hsa-miR-587	CLIP-seq
MIRT1941923	hsa-miR-607	CLIP-seq
MIRT1941924	hsa-miR-618	CLIP-seq
MIRT1941925	hsa-miR-633	CLIP-seq
MIRT818576	hsa-miR-636	CLIP-seq
MIRT1941926	hsa-miR-651	CLIP-seq
MIRT818580	hsa-miR-655	CLIP-seq
MIRT1941927	hsa-miR-660	CLIP-seq
MIRT818582	hsa-miR-664	CLIP-seq
MIRT1941928	hsa-miR-668	CLIP-seq
MIRT1941929	hsa-miR-758	CLIP-seq
MIRT1941930	hsa-miR-874	CLIP-seq
MIRT818585	hsa-miR-876-5p	CLIP-seq
MIRT818590	hsa-miR-96	CLIP-seq
MIRT1941869	hsa-miR-1178	CLIP-seq
MIRT818360	hsa-miR-1207-5p	CLIP-seq
MIRT2180722	hsa-miR-1224-3p	CLIP-seq
MIRT2180723	hsa-miR-1236	CLIP-seq
MIRT2180724	hsa-miR-1245b-3p	CLIP-seq
MIRT2180725	hsa-miR-1260	CLIP-seq
MIRT2180726	hsa-miR-1260b	CLIP-seq
MIRT818370	hsa-miR-1261	CLIP-seq
MIRT818371	hsa-miR-1271	CLIP-seq
MIRT2180727	hsa-miR-1280	CLIP-seq
MIRT2180728	hsa-miR-1285	CLIP-seq
MIRT2180729	hsa-miR-1302	CLIP-seq
MIRT1941874	hsa-miR-1305	CLIP-seq
MIRT818376	hsa-miR-1321	CLIP-seq
MIRT818380	hsa-miR-15a	CLIP-seq
MIRT818381	hsa-miR-15b	CLIP-seq
MIRT818382	hsa-miR-16	CLIP-seq
MIRT818383	hsa-miR-181a	CLIP-seq
MIRT818384	hsa-miR-181b	CLIP-seq
MIRT818385	hsa-miR-181c	CLIP-seq
MIRT818386	hsa-miR-181d	CLIP-seq
MIRT818387	hsa-miR-182	CLIP-seq
MIRT818388	hsa-miR-185	CLIP-seq
MIRT818390	hsa-miR-195	CLIP-seq
MIRT2180730	hsa-miR-1972	CLIP-seq
MIRT2180731	hsa-miR-200b	CLIP-seq
MIRT2180732	hsa-miR-200c	CLIP-seq
MIRT818392	hsa-miR-203	CLIP-seq
MIRT818393	hsa-miR-204	CLIP-seq
MIRT818395	hsa-miR-2053	CLIP-seq
MIRT818396	hsa-miR-211	CLIP-seq
MIRT2180733	hsa-miR-2355-5p	CLIP-seq
MIRT818399	hsa-miR-23a	CLIP-seq
MIRT818400	hsa-miR-23b	CLIP-seq
MIRT818401	hsa-miR-23c	CLIP-seq
MIRT2180734	hsa-miR-30a	CLIP-seq
MIRT2180735	hsa-miR-30b	CLIP-seq
MIRT2180736	hsa-miR-30c	CLIP-seq
MIRT2180737	hsa-miR-30d	CLIP-seq
MIRT2180738	hsa-miR-30e	CLIP-seq
MIRT818409	hsa-miR-3121-3p	CLIP-seq
MIRT1941882	hsa-miR-3121-5p	CLIP-seq
MIRT1941883	hsa-miR-3127-5p	CLIP-seq
MIRT818411	hsa-miR-3140-3p	CLIP-seq
MIRT818413	hsa-miR-3145-3p	CLIP-seq
MIRT818417	hsa-miR-3158-3p	CLIP-seq
MIRT818418	hsa-miR-3160-3p	CLIP-seq
MIRT818420	hsa-miR-3163	CLIP-seq
MIRT2180739	hsa-miR-3177-5p	CLIP-seq
MIRT818423	hsa-miR-3185	CLIP-seq
MIRT2180740	hsa-miR-3187-5p	CLIP-seq
MIRT818425	hsa-miR-3201	CLIP-seq
MIRT2180741	hsa-miR-320e	CLIP-seq
MIRT2180742	hsa-miR-323-3p	CLIP-seq
MIRT818430	hsa-miR-34a	CLIP-seq
MIRT818433	hsa-miR-3612	CLIP-seq
MIRT818437	hsa-miR-3622b-5p	CLIP-seq
MIRT818441	hsa-miR-3662	CLIP-seq
MIRT1941893	hsa-miR-3671	CLIP-seq
MIRT818446	hsa-miR-3682-5p	CLIP-seq
MIRT2180743	hsa-miR-3689d	CLIP-seq
MIRT2180744	hsa-miR-3690	CLIP-seq
MIRT818450	hsa-miR-374c	CLIP-seq
MIRT2180745	hsa-miR-380	CLIP-seq
MIRT2180746	hsa-miR-383	CLIP-seq
MIRT818453	hsa-miR-3918	CLIP-seq
MIRT818456	hsa-miR-3943	CLIP-seq
MIRT2180747	hsa-miR-3944-5p	CLIP-seq
MIRT818457	hsa-miR-409-3p	CLIP-seq
MIRT818458	hsa-miR-410	CLIP-seq
MIRT818460	hsa-miR-424	CLIP-seq
MIRT2180748	hsa-miR-4254	CLIP-seq
MIRT818462	hsa-miR-4262	CLIP-seq
MIRT818465	hsa-miR-4270	CLIP-seq
MIRT2180749	hsa-miR-4277	CLIP-seq
MIRT1941894	hsa-miR-4280	CLIP-seq
MIRT2180750	hsa-miR-4298	CLIP-seq
MIRT2180751	hsa-miR-4305	CLIP-seq
MIRT818470	hsa-miR-4306	CLIP-seq
MIRT818471	hsa-miR-4307	CLIP-seq
MIRT818474	hsa-miR-432	CLIP-seq
MIRT818479	hsa-miR-4422	CLIP-seq
MIRT818482	hsa-miR-4441	CLIP-seq
MIRT818483	hsa-miR-4443	CLIP-seq
MIRT818484	hsa-miR-4446-5p	CLIP-seq
MIRT818485	hsa-miR-4453	CLIP-seq
MIRT818488	hsa-miR-4469	CLIP-seq
MIRT1941899	hsa-miR-4477a	CLIP-seq
MIRT818492	hsa-miR-4487	CLIP-seq
MIRT2180752	hsa-miR-4495	CLIP-seq
MIRT818493	hsa-miR-449b	CLIP-seq
MIRT2180753	hsa-miR-4505	CLIP-seq
MIRT818494	hsa-miR-4509	CLIP-seq
MIRT2180754	hsa-miR-4514	CLIP-seq
MIRT818496	hsa-miR-4524	CLIP-seq
MIRT818497	hsa-miR-4538	CLIP-seq
MIRT818498	hsa-miR-4539	CLIP-seq
MIRT818502	hsa-miR-4644	CLIP-seq
MIRT2180755	hsa-miR-4650-5p	CLIP-seq
MIRT2180756	hsa-miR-4666-5p	CLIP-seq
MIRT818508	hsa-miR-4691-3p	CLIP-seq
MIRT2180757	hsa-miR-4692	CLIP-seq
MIRT818509	hsa-miR-4694-3p	CLIP-seq
MIRT818510	hsa-miR-4699-3p	CLIP-seq
MIRT818512	hsa-miR-4709-3p	CLIP-seq
MIRT1941903	hsa-miR-4717-5p	CLIP-seq
MIRT1941904	hsa-miR-4719	CLIP-seq
MIRT818514	hsa-miR-4720-3p	CLIP-seq
MIRT818516	hsa-miR-4731-3p	CLIP-seq
MIRT2180758	hsa-miR-4734	CLIP-seq
MIRT818517	hsa-miR-4736	CLIP-seq
MIRT818518	hsa-miR-4739	CLIP-seq
MIRT818520	hsa-miR-4744	CLIP-seq
MIRT2180759	hsa-miR-4753-5p	CLIP-seq
MIRT2180760	hsa-miR-4754	CLIP-seq
MIRT818522	hsa-miR-4755-5p	CLIP-seq
MIRT818523	hsa-miR-4756-5p	CLIP-seq
MIRT818525	hsa-miR-4763-3p	CLIP-seq
MIRT2180761	hsa-miR-4772-5p	CLIP-seq
MIRT2180762	hsa-miR-4778-3p	CLIP-seq
MIRT1941907	hsa-miR-4778-5p	CLIP-seq
MIRT2180763	hsa-miR-4789-5p	CLIP-seq
MIRT818530	hsa-miR-4791	CLIP-seq
MIRT818532	hsa-miR-4797-5p	CLIP-seq
MIRT818533	hsa-miR-4799-5p	CLIP-seq
MIRT818534	hsa-miR-4801	CLIP-seq
MIRT1941910	hsa-miR-485-5p	CLIP-seq
MIRT818537	hsa-miR-497	CLIP-seq
MIRT818539	hsa-miR-503	CLIP-seq
MIRT818541	hsa-miR-510	CLIP-seq
MIRT818542	hsa-miR-512-5p	CLIP-seq
MIRT1941912	hsa-miR-514	CLIP-seq
MIRT1941913	hsa-miR-514b-3p	CLIP-seq
MIRT1941914	hsa-miR-518a-5p	CLIP-seq
MIRT2180764	hsa-miR-519a	CLIP-seq
MIRT2180765	hsa-miR-519b-3p	CLIP-seq
MIRT2180766	hsa-miR-519c-3p	CLIP-seq
MIRT818544	hsa-miR-522	CLIP-seq
MIRT1941917	hsa-miR-527	CLIP-seq
MIRT2180767	hsa-miR-532-3p	CLIP-seq
MIRT2180768	hsa-miR-548aa	CLIP-seq
MIRT818549	hsa-miR-548ag	CLIP-seq
MIRT818550	hsa-miR-548ai	CLIP-seq
MIRT818560	hsa-miR-558	CLIP-seq
MIRT818562	hsa-miR-569	CLIP-seq
MIRT818564	hsa-miR-577	CLIP-seq
MIRT2180769	hsa-miR-582-5p	CLIP-seq
MIRT818567	hsa-miR-587	CLIP-seq
MIRT1941923	hsa-miR-607	CLIP-seq
MIRT2180770	hsa-miR-612	CLIP-seq
MIRT818573	hsa-miR-617	CLIP-seq
MIRT818574	hsa-miR-623	CLIP-seq
MIRT1941925	hsa-miR-633	CLIP-seq
MIRT818577	hsa-miR-642a	CLIP-seq
MIRT755831	hsa-miR-646	CLIP-seq
MIRT818579	hsa-miR-650	CLIP-seq
MIRT818580	hsa-miR-655	CLIP-seq
MIRT2180771	hsa-miR-657	CLIP-seq
MIRT818582	hsa-miR-664	CLIP-seq
MIRT818583	hsa-miR-765	CLIP-seq
MIRT818587	hsa-miR-889	CLIP-seq
MIRT2180772	hsa-miR-940	CLIP-seq
MIRT818590	hsa-miR-96	CLIP-seq
MIRT818369	hsa-miR-1257	CLIP-seq
MIRT2180751	hsa-miR-4305	CLIP-seq
MIRT2384753	hsa-miR-486-3p	CLIP-seq
MIRT2444733	hsa-miR-125b	CLIP-seq
MIRT2444734	hsa-miR-3120-3p	CLIP-seq
MIRT2444735	hsa-miR-3714	CLIP-seq
MIRT2444736	hsa-miR-4319	CLIP-seq
MIRT2444737	hsa-miR-4668-3p	CLIP-seq
MIRT2444738	hsa-miR-4732-3p	CLIP-seq
MIRT2444739	hsa-miR-4766-5p	CLIP-seq
MIRT2444740	hsa-miR-545	CLIP-seq
MIRT2444741	hsa-miR-548an	CLIP-seq
MIRT818553	hsa-miR-548c-3p	CLIP-seq
MIRT2444742	hsa-miR-548p	CLIP-seq
MIRT2444743	hsa-miR-605	CLIP-seq
MIRT2444744	hsa-miR-670	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ABL1	Repression	11753601
ATF1	Unknown	10542244
ATF5	Activation	21212266
ATM	Repression	16214353
BACH2	Unknown	18929412
CEBPA	Repression	12970736
CREB1	Activation	17290286
CREB1	Unknown	10542244;19626458
DDB2	Repression	20013802
DEK	Activation	17685435
E2F1	Activation	11559537;12679318
ERCC2	Repression	22387547
ESR1	Activation	19148464
ESR1	Unknown	10542244;11261829;9306964
FOXA1	Repression	19127412
GLI1	Activation	19074837;21135115
GLI1	Repression	14555646
GLI1	Unknown	15520176;24739390
GLI2	Activation	16880536;21135115
HOXA1	Activation	12482855;15665309
ING2	Repression	15748897
ING4	Repression	19895734;20707719
IRF1	Repression	10918594
MSX2	Repression	21730974
MYB	Activation	11675351
MYB	Repression	20659323
MYB	Unknown	16088151
MYC	Unknown	18809243
NCOA3	Activation	22213475
NFKB1	Activation	14978135;18158998;19259124;20446017;21503108
NFKB1	Repression	12032828;15120608;18031796;18566231
NFKB1	Unknown	14739605;16022909;16453001;17673602;18761399;19233129;20103608;20332461
NR1I2	Activation	16085054
PARP1	Repression	20564216
PAWR	Repression	11912153;9989812
PAX5	Repression	22105368
PER1	Activation	19675098
PGR	Activation	17785366
PGR	Unknown	9306964
PPARG	Activation	15067355
PPARG	Repression	14960510
RELA	Activation	14978135;18158998;19259124;20446017;21503108
RELA	Repression	15120608;18031796;18566231
RELA	Unknown	14739605;16022909;16453001;17673602;18761399;19233129;20103608;20332461
SATB1	Activation	20564216
SATB1	Unknown	21310710
SIM2	Repression	21729534
SMAD2	Unknown	24739390
SMAD4	Unknown	24739390
SP1	Unknown	10542244
STAT3	Activation	15184887;15805299;18839277;19926637;21435102;22504301
STAT3	Repression	22313388
STAT3	Unknown	18320073;20043094;20446017;21172343;21344490;21385902
TBP	Repression	11313951
TCF4	Unknown	23671559
TFAP2A	Repression	16533807
TP53	Repression	11313951;17693666;19411072;20428827;9000137
TP53	Unknown	21859835
TWIST1	Unknown	23095743
WT1	Unknown	12644474
ZBTB16	Repression	14769944
ZNRD1	Activation	16373708;16609701

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000209	Process	Protein polyubiquitination	IDA	16717086
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001503	Process	Ossification	IEA
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001656	Process	Metanephros development	IEA
GO:0001657	Process	Ureteric bud development	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001662	Process	Behavioral fear response	IEA
GO:0001776	Process	Leukocyte homeostasis	IEA
GO:0001782	Process	B cell homeostasis	IEA
GO:0001783	Process	B cell apoptotic process	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001836	Process	Release of cytochrome c from mitochondria	IBA
GO:0001836	Process	Release of cytochrome c from mitochondria	IEA
GO:0001836	Process	Release of cytochrome c from mitochondria	ISS	9843949
GO:0001836	Process	Release of cytochrome c from mitochondria	NAS	9027314
GO:0001952	Process	Regulation of cell-matrix adhesion	IEA
GO:0002020	Function	Protease binding	IDA	10620603
GO:0002260	Process	Lymphocyte homeostasis	IEA
GO:0002320	Process	Lymphoid progenitor cell differentiation	IEA
GO:0002326	Process	B cell lineage commitment	IEA
GO:0002360	Process	T cell lineage commitment	IEA
GO:0002520	Process	Immune system development	IEA
GO:0002903	Process	Negative regulation of B cell apoptotic process	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0003014	Process	Renal system process	IEA
GO:0005515	Function	Protein binding	IPI	7954800, 9305631, 9334338, 9388232, 9463381, 9660918, 9973195, 10837489, 11054413, 11060313, 11126360, 11278245, 11463391, 12624108, 12667443, 12901880, 14739602, 15694340, 15733859, 16697956, 16790527, 17074758, 17289999, 17418785, 17428862, 17446862, 17525735, 17692808, 18719108, 1
GO:0005634	Component	Nucleus	IDA	7546744, 7896880
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	7546744, 11530860
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	7896880, 9027314
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005741	Component	Mitochondrial outer membrane	IDA	21358617
GO:0005741	Component	Mitochondrial outer membrane	IDA	8402648, 9027314
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005783	Component	Endoplasmic reticulum	IDA	8402648
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	21358617
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IEA
GO:0006582	Process	Melanin metabolic process	IEA
GO:0006808	Process	Regulation of nitrogen utilization	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0006914	Process	Autophagy	IEA
GO:0006915	Process	Apoptotic process	IDA	36599, 8022822
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006959	Process	Humoral immune response	TAS	1908951
GO:0006974	Process	DNA damage response	IMP	17875758
GO:0006979	Process	Response to oxidative stress	IEA
GO:0007015	Process	Actin filament organization	IEA
GO:0007409	Process	Axonogenesis	IEA
GO:0007565	Process	Female pregnancy	NAS	11530860
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	28280358
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	10597216
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IBA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IEA
GO:0008637	Process	Apoptotic mitochondrial changes	IEA
GO:0009314	Process	Response to radiation	NAS	15799693
GO:0009410	Process	Response to xenobiotic stimulus	IDA	36599
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IMP	17875758
GO:0009636	Process	Response to toxic substance	IDA	16717086
GO:0009636	Process	Response to toxic substance	IDA	16307838
GO:0009636	Process	Response to toxic substance	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0010039	Process	Response to iron ion	IDA	11264898
GO:0010224	Process	Response to UV-B	IEA
GO:0010332	Process	Response to gamma radiation	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010506	Process	Regulation of autophagy	IEA
GO:0010507	Process	Negative regulation of autophagy	IDA	21358617
GO:0010507	Process	Negative regulation of autophagy	IEA
GO:0010507	Process	Negative regulation of autophagy	TAS	18309324
GO:0010523	Process	Negative regulation of calcium ion transport into cytosol	IEA
GO:0010559	Process	Regulation of glycoprotein biosynthetic process	IEA
GO:0014031	Process	Mesenchymal cell development	IEA
GO:0014042	Process	Positive regulation of neuron maturation	IEA
GO:0014909	Process	Smooth muscle cell migration	IEA
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IEA
GO:0015267	Function	Channel activity	IBA
GO:0015267	Function	Channel activity	IDA	9219694
GO:0016020	Component	Membrane	IDA	7896880
GO:0016020	Component	Membrane	IEA
GO:0016248	Function	Channel inhibitor activity	IDA	9219694
GO:0016477	Process	Cell migration	IEA
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0021747	Process	Cochlear nucleus development	IEA
GO:0022612	Process	Gland morphogenesis	IEA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0030217	Process	T cell differentiation	IEA
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0030307	Process	Positive regulation of cell growth	IDA	8022822
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0030318	Process	Melanocyte differentiation	IEA
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0030890	Process	Positive regulation of B cell proliferation	IMP	17875758
GO:0031069	Process	Hair follicle morphogenesis	IEA
GO:0031103	Process	Axon regeneration	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	20889974
GO:0031647	Process	Regulation of protein stability	IEA
GO:0031965	Component	Nuclear membrane	IDA	1502141, 8402648
GO:0031965	Component	Nuclear membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	IEA
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	TAS	18309324
GO:0032835	Process	Glomerulus development	IEA
GO:0032848	Process	Negative regulation of cellular pH reduction	IDA	10506221
GO:0032880	Process	Regulation of protein localization	IEA
GO:0032991	Component	Protein-containing complex	IMP	15733859
GO:0033028	Process	Myeloid cell apoptotic process	IEA
GO:0033033	Process	Negative regulation of myeloid cell apoptotic process	IEA
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0033687	Process	Osteoblast proliferation	IEA
GO:0033689	Process	Negative regulation of osteoblast proliferation	IEA
GO:0034097	Process	Response to cytokine	IDA	9184696
GO:0034097	Process	Response to cytokine	IEA
GO:0035094	Process	Response to nicotine	IDA	12421819
GO:0035265	Process	Organ growth	IEA
GO:0040008	Process	Regulation of growth	IEA
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042100	Process	B cell proliferation	IDA	1373874
GO:0042149	Process	Cellular response to glucose starvation	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042551	Process	Neuron maturation	IEA
GO:0042802	Function	Identical protein binding	IPI	9111042, 9463381, 18835031
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	NAS	14634621
GO:0043066	Process	Negative regulation of apoptotic process	IDA	1373874, 7650367, 7772249, 8050499, 8080725, 15776018
GO:0043066	Process	Negative regulation of apoptotic process	IDA	9027314, 9219694, 10506221, 10620603, 20041405
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IGI	9660918, 28280358
GO:0043066	Process	Negative regulation of apoptotic process	IMP	7772249
GO:0043066	Process	Negative regulation of apoptotic process	IMP	17289999, 21212266
GO:0043067	Process	Regulation of programmed cell death	IEA
GO:0043209	Component	Myelin sheath	IEA
GO:0043375	Process	CD8-positive, alpha-beta T cell lineage commitment	IEA
GO:0043473	Process	Pigmentation	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	7546744
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	12086670
GO:0043583	Process	Ear development	IEA
GO:0045069	Process	Regulation of viral genome replication	IEA
GO:0045636	Process	Positive regulation of melanocyte differentiation	IEA
GO:0045930	Process	Negative regulation of mitotic cell cycle	IEA
GO:0046666	Process	Retinal cell programmed cell death	IEA
GO:0046671	Process	Negative regulation of retinal cell programmed cell death	IEA
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IEA
GO:0046902	Process	Regulation of mitochondrial membrane permeability	ISS	9843949
GO:0046930	Component	Pore complex	IDA	9219694
GO:0046982	Function	Protein heterodimerization activity	IPI	9111042
GO:0048041	Process	Focal adhesion assembly	IEA
GO:0048066	Process	Developmental pigmentation	IEA
GO:0048070	Process	Regulation of developmental pigmentation	IEA
GO:0048087	Process	Positive regulation of developmental pigmentation	IEA
GO:0048536	Process	Spleen development	IEA
GO:0048538	Process	Thymus development	IEA
GO:0048545	Process	Response to steroid hormone	IEA
GO:0048546	Process	Digestive tract morphogenesis	IEA
GO:0048589	Process	Developmental growth	IEA
GO:0048599	Process	Oocyte development	IEA
GO:0048741	Process	Skeletal muscle fiber development	IEA
GO:0048743	Process	Positive regulation of skeletal muscle fiber development	IEA
GO:0048753	Process	Pigment granule organization	IEA
GO:0048864	Process	Stem cell development	IEA
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0050853	Process	B cell receptor signaling pathway	IMP	17875758
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051402	Process	Neuron apoptotic process	TAS	16167175
GO:0051434	Function	BH3 domain binding	IPI	9111042
GO:0051607	Process	Defense response to virus	IDA	10620603
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051721	Function	Protein phosphatase 2A binding	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	ISS	9843949
GO:0051902	Process	Negative regulation of mitochondrial depolarization	TAS	9027314
GO:0051924	Process	Regulation of calcium ion transport	IDA	8022822
GO:0060090	Function	Molecular adaptor activity	EXP	26858413
GO:0060090	Function	Molecular adaptor activity	IEA
GO:0060218	Process	Hematopoietic stem cell differentiation	IEA
GO:0060402	Process	Calcium ion transport into cytosol	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IDA	15776018
GO:0070227	Process	Lymphocyte apoptotic process	IEA
GO:0070229	Process	Negative regulation of lymphocyte apoptotic process	IEA
GO:0070231	Process	T cell apoptotic process	IEA
GO:0070233	Process	Negative regulation of T cell apoptotic process	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:0097048	Process	Dendritic cell apoptotic process	IEA
GO:0097049	Process	Motor neuron apoptotic process	IEA
GO:0097136	Component	Bcl-2 family protein complex	IEA
GO:0097138	Component	BAD-BCL-2 complex	IPI	9463381
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IBA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	16443602
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	TAS	1286168
GO:1902531	Process	Regulation of intracellular signal transduction	IEA
GO:1904019	Process	Epithelial cell apoptotic process	IEA
GO:1904036	Process	Negative regulation of epithelial cell apoptotic process	IEA
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IEA
GO:2000669	Process	Negative regulation of dendritic cell apoptotic process	IEA
GO:2000672	Process	Negative regulation of motor neuron apoptotic process	IEA
GO:2000811	Process	Negative regulation of anoikis	IMP	15006356
GO:2001233	Process	Regulation of apoptotic signaling pathway	IEA
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IEA
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IMP	20097879
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IGI	8358790
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IDA	11684014

Other IDs

• MIM: 151430
• HGNC: 990
• e!Ensembl: ENSG00000171791

Protein

• UniProt ID: P10415
• Protein name: Apoptosis regulator Bcl-2
• Protein function: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells (PubMed:1508712, PubMed:8183370). Regulates cell death by controlling the mitochondrial membrane permeability (PubMed:11368354). Ap
• PDB: 1G5M, 1GJH, 1YSW, 2O21, 2O22, 2O2F, 2W3L, 2XA0, 4AQ3, 4IEH, 4LVT, 4LXD, 4MAN, 5AGW, 5AGX, 5FCG, 5JSN, 5VAU, 5VAX, 5VAY, 6GL8, 6IWB, 6O0K, 6O0L, 6O0M, 6O0O, 6O0P, 7LHB, 7Y90, 7YA5, 8FY1, 8FY2, 8HLL, 8HLM, 8HLN, 8HOG, 8HOH, 8HOI, 8HTR, 8HTS, 8IQL, 8U27, 8VWX, 8VWZ, 8VXM, 8VXN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02180	BH4	8 → 32	Bcl-2 homology region 4	Family
  PF00452	Bcl-2	97 → 195	Apoptosis regulator proteins, Bcl-2 family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in a variety of tissues.
• Sequence:

  MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
  ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
  LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
  LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

• Sequence length: 239

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AZOOSPERMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BCL2-related disorder	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHONDROSARCOMA, MESENCHYMAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ANOMALY OF CARTILAGE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERECTILE DYSFUNCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOLLICULAR LYMPHOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLBLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, MALE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTESTINAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACRANIAL ANEURYSM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISABILITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, ALCOHOLIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, FOLLICULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, LARGE B-CELL, DIFFUSE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELOPROLIFERATIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOCHONDRODYSPLASIAS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, FAMILIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINAL DEGENERATION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOMA, SYNOVIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Aarskog syndrome	Aarskog Syndrome	BEFREE	30391273		★☆☆☆☆ Found in Text Mining only
Achondroplasia	Achondroplasia	BEFREE	12929929		★☆☆☆☆ Found in Text Mining only
Achondroplasia	Achondroplasia	Pubtator	12929929	Associate	★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	17429338		★☆☆☆☆ Found in Text Mining only
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	11472434		★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	LHGDN	12756585		★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	28370377, 30222011, 30706457, 9335236		★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	18077176		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	23349247		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	11313951, 19282832		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	10086726, 10500792, 11245018, 11699413, 15203866, 16059649, 18092960, 19020783, 21869449, 22037714, 25754349, 27569395, 9264377, 9592841, 9645350		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10641752, 10848789, 12375054, 12780787, 12931228, 14508797, 15380515, 18024393, 18046449, 18056841, 18398104, 18575824, 20038611, 20103721, 2123067, 21606961, 22037714, 22591684, 23393050, 23511489, 24083449, 24088574, 24280866, 24703900, 26172269, 26711339, 27002764, 27008505, 27725691, 29233926, 29254309, 29680307, 29693417, 30141309, 30347215, 30390332, 30631148, 30862722, 30985716, 31358732, 31462891, 31808877, 7632955, 7654318, 8562940, 8602624, 9160683, 9592841, 9645350, 9823951		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	15800708, 24064771, 25957891, 28619982, 29232547, 29232553, 29559471, 30037885, 30623427, 31048320, 31203996, 31253168, 9592841		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	BEFREE	10602414		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	23906301		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	23906301		★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia, minimal differentiation	Myeloid Leukemia	BEFREE	31253168		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	26683606		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	15781666, 19520430, 21076048, 25088254, 26459180, 8704214		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	31628431		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10022131, 10217615, 10231418, 10481119, 10632348, 11303912, 11574518, 12047142, 12581249, 14716828, 15117979, 15484295, 15661804, 15958612, 16243795, 16550596, 18705409, 20146885, 21978692, 23826359, 25066397, 25108507, 26320497, 27520705, 30900377, 31494078, 7712429, 7856728, 8063611, 8380056, 8440743, 8620509, 8729985, 8729986, 8821955, 9196162, 9445135, 9490092, 9816161, 9863489		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12046064, 12581249, 16173075, 17464868, 18516322		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	12270138, 15955446, 28100091, 28714374, 31117840		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	21472143, 28488526		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	10452254, 21380782		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	10741743, 11155917, 17989874, 19034511, 21128858, 21851414, 21874222, 24283983, 24521149, 25066397, 25499851, 26022894, 26366732, 28285961, 28597042, 28606806, 30003731, 30815935, 31114230, 31450709		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	10481119, 21734077		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	10619965, 10667479, 11276013, 20464497, 30741252, 31579415, 8441470, 8821955, 9188634		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	10216477, 12240548		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	CTD_human_DG	9754764		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	BEFREE	11786411		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	18248353, 25769455, 30261190		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	CTD_human_DG	10223192, 10426811		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10359525, 10607921, 10767713, 10780525, 10944610, 11194193, 12605367, 12737446, 14610217, 15751053, 16243795, 17089045, 21184732, 7936663, 8207614, 8563932, 9651943, 9672345		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	10944610, 16243795, 17373735, 7936663		★☆☆☆☆ Found in Text Mining only
Adenoma, Basal Cell	Adenoma	CTD_human_DG	10223192, 10426811		★☆☆☆☆ Found in Text Mining only
Adenoma, Microcystic	Adenoma	CTD_human_DG	10223192, 10426811		★☆☆☆☆ Found in Text Mining only
Adenoma, Monomorphic	Adenoma	CTD_human_DG	10223192, 10426811		★☆☆☆☆ Found in Text Mining only
Adenoma, Trabecular	Adenoma	CTD_human_DG	10223192, 10426811		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	18160396, 28565805		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	11848471, 8625322		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	11196462, 9888605		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	12490850, 9888605		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	11752215, 28979675, 29393444, 30656694, 9177412		★☆☆☆☆ Found in Text Mining only
Adrenal hyperplasia	Adrenal hyperplasia	BEFREE	11196462		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	11791174, 16098628, 26429926		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18024393, 18046449, 18056841, 18398104, 21427708, 21606961, 22037714, 22591684, 23393050, 23511489, 24088574, 27002764, 27008505, 27725691, 29254309, 29680307, 29693417, 30390332, 30862722, 31462891, 31808877, 8562940, 8602624, 8642858, 9160683, 9823951		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	11986946, 31253168		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	10350331, 10414499, 11298531, 11830458, 12402391, 12430874, 16006802, 16670080, 16785131, 16796775, 17519619, 17577773, 17593082, 18096567, 18367485, 18645192, 18925695, 18925696, 18929412, 19144384, 19276283, 19537891, 19549844, 19783718, 20118770, 20512275, 20660332, 21394100, 22184285, 22189900, 22851565, 22929980, 23335369, 23370596, 23449635, 23681227, 24506200, 25090918, 25149548, 25284491, 25696841, 25741152, 25828389, 26158410, 26421520, 26460954, 26467384, 26515759, 26586460, 27027803, 27071312, 27739436, 28209136, 28212447, 28327893, 28605593, 28985492, 29037890, 29189488, 29250662, 29269870, 29666157, 29674626, 30542505, 30573511, 30872780, 31171907, 31229156, 31601689, 31644584, 31801186, 8547651, 9242549		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	25173640		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	12966346, 19557638, 21767511, 22827759, 30941572, 7475272, 7914127		★☆☆☆☆ Found in Text Mining only
Adult Learning Disorders	Learning Disorders	CTD_human_DG	17967740		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	10983696, 17545597, 21161674, 21181094, 21880625, 22766741, 25885794, 26394044, 29016820, 31465840, 8638218		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	10547558, 15332326, 21171016		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11042529, 15827331, 19737931, 25275021, 7874004, 7976115		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	29486466		★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	17967740		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	10522207, 29399171		★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	18199533		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	28426164		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	10751363		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	GWASCAT_DG	28196072		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29422088, 29851783	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	8922409	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	18077176		★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	10450921, 17641817		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	18077176		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	18077176		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	18077176		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	19473442, 24930892, 25866434, 28862228, 29476674, 30801855, 9379422		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	22207432, 22395508, 25866434	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	18057555, 21396424, 23134284, 28223223, 30946834, 31482248		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	10536919, 10582606, 11461956, 11682150, 15233914, 20460269, 21624464, 23843527, 24956542, 28386317, 8797527		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	33972534, 37612427	Associate	★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	9228005, 9728338		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	10582606, 21624464, 9228005		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	10652633, 9362445		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	16875495, 9042164		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	10426811		★☆☆☆☆ Found in Text Mining only
Anaplastic Large Cell Lymphoma, ALK-Positive	Anaplastic Lymphoma	BEFREE	30679328		★☆☆☆☆ Found in Text Mining only
Anaplastic Oligodendroglioma	Anaplastic Oligodendroglioma	BEFREE	10547558, 21171016		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	11838727, 12736725, 25471003		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	20589722	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	10383168, 21865658		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	16799206	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	11380462, 9580207	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	33586472	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia Refractory	Refractory anemia	Pubtator	12111784, 1536952	Associate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	8854645	Associate	★☆☆☆☆ Found in Text Mining only
Angioendotheliomatosis	Angioendotheliomatosis	ORPHANET_DG	19040469		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	22322190, 9630171		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	16042757	Stimulate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22024503, 26606261, 29344231, 30249893		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	29416696		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	19423430	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	9261803		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	20122683, 9261803		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	34265237	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	19935899, 30792063		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	29738368		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	10522207, 29399171		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	9580207		★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	Pubtator	33399099	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10479647, 11286645, 27460740, 27919735, 29232010, 29704100, 30413028, 30864721		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	20112357, 23341540, 29115552, 31267533		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	7747803	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10403282	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	14691302, 17328050, 23421940, 24920239, 30352835, 32584515, 33087158, 35904110, 8774162, 9022077	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	10704078, 10770817, 11866006, 17463414, 19610265, 23314903, 24152222, 24641294	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	11207646, 12952249, 26938720, 31020662, 9806739		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	18357729		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	11175638, 11508812, 15048678, 18327814, 9042164, 9341939		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	11175638, 16688362, 16875495, 18327814, 18670645, 21468591, 35977048, 9060818	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	10555759, 10606975, 11133771, 37363966	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	1850186		★☆☆☆☆ Found in Text Mining only
Atelosteogenesis type 2	Atelosteogenesis	Pubtator	34425224	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11286645, 27460740, 27919735, 29232010, 29704100, 30413028, 30864721		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	27460740	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	16043935	Inhibit	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	27141955, 28901395, 29501704		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	27141955, 34957910	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	15492912	Associate	★☆☆☆☆ Found in Text Mining only
Atypical Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	8729985		★☆☆☆☆ Found in Text Mining only
Atypical Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	23805250	Inhibit	★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	18509505		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	32245323	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28360521, 28803955, 31363911		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	11814262, 14964781, 20375269		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	11814262, 20375269		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	LHGDN	14964781		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	20375269	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	10209518	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11196685, 11704806, 17312121, 1924327, 19282307, 19596183, 20112357, 20554953, 20610805, 20691570, 23341540, 25618543, 26919255, 28596542, 31345729, 7589882, 7945466, 8670592, 9852253, 9856487		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	BEFREE	25174872		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	25174872	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	29250672		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	20610805		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Azoospermia	Azoospermia	CTD_human_DG	20610805		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	27582059, 30154155		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10197582, 10200002, 10419903, 10652595, 10766396, 10873104, 11113864, 11313951, 11597394, 11964306, 12040429, 12353944, 12580956, 12644474, 12730627, 12969979, 1419624, 14624621, 14758801, 1493447, 15060790, 15122313, 15135541, 15166666, 15258997, 15308561, 15545599, 1560313, 15716988, 15718423, 15764395, 1581586, 15852472, 15880597, 1632463, 1633729, 16646081, 16712476, 1692620, 17519619, 1757070, 17693666, 1774956, 18025305, 18096567, 18645262, 1868240, 18758060, 1899539, 1900270, 19196738, 19266598, 19289490, 19329714, 19407332, 1951637, 19537891, 19597184, 19666108, 19676043, 19717648, 19719835, 19758361, 19788418, 19968497, 20004446, 20204284, 20331331, 20397191, 20401760, 20540941, 20660329, 20886547, 20888662, 20921210, 20957341, 21033669, 21037114, 21148565, 21167476, 21213215, 21339285, 21364665, 21474673, 21606168, 21606958, 21606961, 21622563, 21640157, 2181381, 21912938, 21953021, 21975296, 22002575, 22075983, 2208029, 2208117, 22130369, 22156152, 22187149, 22194861, 22204000, 22231445, 22309646, 2247757, 22484426, 2249841, 2250704, 2250705, 22562364, 2263590, 22649144, 22666341, 22705850, 22771706, 22824293, 22891626, 22951829, 23059386, 23072837, 23076250, 23076380, 23083798, 23098454, 23134284, 23135964, 23175186, 23225311, 23225433, 23225437, 23287123, 23330001, 23348205, 23359069, 23422486, 23435631, 23455184, 23566222, 23651505, 23681227, 23689597, 23734725, 23744359, 23784204, 23788110, 23792460, 23792636, 23867991, 23931896, 23932423, 23933736, 23939148, 23949965, 24005536, 24009228, 24079479, 24222112, 24258714, 24267052, 24276280, 24287948, 24294388, 24319234, 24321200, 24393571, 24408972, 24481442, 24595931, 24603326, 24634186, 24676391, 24677543, 24679006, 24718383, 24738081, 24741074, 24767771, 24778012, 24786146, 24803527, 24832086, 24864240, 24913718, 24931256, 24943107, 25031780, 2503246, 25060748, 2506501, 25066397, 25076300, 25088254, 25103070, 25109624, 2511176, 25122609, 25124606, 25125624, 25139387, 25142231, 25179840, 25230790, 25292288, 25310109, 25311206, 25322856, 25323004, 25333670, 25384217, 25384346, 25405740, 25405848, 25411978, 25430556, 2543982, 25449296, 25458080, 25468484, 25559680, 25572145, 25604244, 25618543, 25625235, 25648135, 25656914, 25682076, 25738331, 25738368, 25738398, 25744244, 25781640, 25862909, 25885794, 25915824, 25915849, 25916698, 25937271, 25951128, 25957891, 25964563, 25993541, 26026079, 26035796, 26044952, 26081156, 26091803, 26132559, 26134786, 26166196, 26201988, 26239085, 26239512, 26295369, 26300063, 26311051, 26376998, 26390147, 26397135, 26398137, 26398902, 26408682, 26482649, 26500281, 26517511, 26558423, 26565895, 26573234, 26592196, 26634523, 26657288, 26676867, 26689790, 26703449, 26717963, 26722405, 26727417, 2672827, 26758192, 26780985, 26783238, 26794135, 26848042, 26881528, 26936314, 26977530, 26985864, 26986949, 27022730, 27159593, 27193257, 27225448, 27297958, 27322712, 27323021, 27394663, 27399772, 27402752, 27458102, 27484725, 27484919, 27498834, 27499136, 27509922, 27513891, 27534371, 27556459, 27578251, 27582059, 27601129, 27649657, 27694900, 27748813, 27771871, 27774879, 27776427, 27806433, 27821509, 27835579, 27841943, 27861461, 27864821, 27878984, 27906186, 27907195, 27921110, 27957827, 27995262, 28000873, 28007011, 28028215, 28032588, 28056525, 28057804, 28074072, 28079890, 28086220, 28093932, 28101579, 28104700, 28112863, 28123543, 28123545, 28138714, 28152566, 28163176, 28164440, 28166401, 28170185, 28192408, 28225864, 28229391, 28233171, 28233676, 28241425, 28241801, 28246354, 28252129, 28252652, 28255363, 28257831, 28259954, 28260077, 28273832, 28282916, 28288039, 28288979, 28290152, 28315370, 28331288, 28337226, 28340172, 28343296, 28343379, 28349834, 28352353, 28355296, 28358700, 28360521, 28371915, 28376129, 28391633, 28396252, 28400540, 28401933, 28402151, 28413418, 28413886, 28416308, 28418864, 28420416, 28423593, 28427190, 28429540, 28430743, 28439064, 28441474, 28446054, 28447714, 28447716, 28447761, 28449207, 28454260, 28454413, 28454440, 28467977, 28482291, 28498386, 28499237, 28511583, 28516063, 28529555, 28529565, 28535500, 28539722, 28543910, 28549475, 28550734, 28551635, 28560435, 28560462, 28565805, 28565827, 28565839, 28565875, 28566329, 28586031, 28586043, 28587170, 28587387, 28587395, 28588482, 28588714, 28599419, 28599443, 28599489, 28600336, 28606801, 28615991, 28617558, 28627637, 28627642, 28627691, 28627694, 28628119, 28640008, 28641223, 28643758, 28644106, 28656215, 28656237, 28662337, 28672809, 28672935, 28672952, 28673004, 28673008, 28676391, 28677789, 28678054, 28691866, 28693160, 28693230, 28693250, 28693259, 28693266, 28701032, 28711948, 28713907, 28713948, 28713965, 28713991, 28714023, 28716711, 28724540, 28731139, 28731147, 28739740, 28741496, 28749548, 28751770, 28767701, 28770967, 28780868, 28781641, 28789432, 28814571, 28824455, 28824871, 28837114, 28844114, 28849082, 28849107, 28855351, 28862228, 28866374, 28888575, 28899515, 28901386, 28901491, 28901509, 28912852, 28912867, 28912868, 28912871, 28916896, 28927092, 28928812, 28928838, 28928845, 28937043, 28943305, 28943529, 28944839, 28944882, 28944912, 28953224, 28962106, 28962108, 28962157, 28962186, 28963051, 28972014, 28972015, 28976960, 28983595, 28983622, 28983625, 28984304, 28984827, 28987383, 28990046, 28992684, 29016820, 29018405, 29027832, 29039526, 29042970, 29042987, 29061809, 29061824, 29062236, 29064407, 29070697, 29075126, 29075341, 29085442, 29085465, 29099482, 29099789, 29100606, 29102932, 29104621, 29104642, 29110485, 29113186, 29113197, 29115375, 29115386, 29115429, 29115490, 29115547, 29115552, 29115614, 29127491, 29131032, 29132010, 29138553, 29142607, 29151915, 29152647, 29166822, 29177642, 29179212, 29180187, 29185784, 29190957, 29197725, 29201192, 29201214, 29201227, 29207064, 29207077, 29207094, 29207118, 29207147, 29207200, 29221207, 29223124, 29227976, 29232945, 29238080, 29243771, 29243778, 29247598, 29257202, 29257269, 29257286, 29257340, 29260360, 29271988, 29272021, 29272530, 29275301, 29278535, 29285056, 29285062, 29285137, 29285195, 29286112, 29286113, 29297235, 29304561, 29328385, 29328448, 29328454, 29328470, 29333561, 29333604, 29344114, 29344122, 29344198, 29344220, 29344231, 29344237, 29344639, 29344647, 29351194, 29352235, 29361709, 29361881, 29363719, 29363721, 29363726, 29365089, 29374711, 29375685, 29375700, 29387241, 29389945, 29393342, 29393352, 29393425, 29394243, 29399062, 29399071, 29399094, 29399104, 29399171, 29403552, 29408764, 29414639, 29414782, 29422965, 29424907, 29432674, 29434715, 29434733, 29434780, 29434920, 29434952, 29434967, 29435079, 29436651, 29439531, 29441873, 29454324, 29456668, 29456707, 29457525, 29461617, 29464048, 29464986, 29467862, 29474123, 29482444, 29484432, 29485914, 29488156, 29488615, 29490300, 29491636, 29501042, 29510336, 29512768, 29520705, 29521234, 29522221, 29532863, 29538305, 29538328, 29540256, 29545835, 29545840, 29552116, 29552161, 29552219, 29556279, 29562785, 29568865, 29570632, 29570671, 29572119, 29576796, 29581544, 29599842, 29600563, 29607921, 29617412, 29620285, 29631569, 29635023, 29636888, 29641255, 29653556, 2965608, 29658590, 29666116, 29666304, 29669301, 29687848, 29693126, 29693134, 29693156, 29697268, 29710456, 29716528, 29717768, 29725398, 29725405, 29725421, 29725453, 29725459, 29731824, 29731848, 29731854, 29734677, 29738772, 29749492, 29749523, 29750299, 29750888, 29752696, 29753869, 29760958, 29762232, 29765412, 29767235, 29767237, 29767257, 29769286, 29769415, 29771410, 29771436, 29772677, 29774773, 29778937, 29786748, 29792955, 29794468, 29796658, 29802156, 29805515, 29805536, 29805557, 29805582, 29805590, 29805606, 29805607, 29805614, 29844816, 29844818, 29844823, 29845223, 29845288, 29856242, 29872948, 29891925, 29896263, 29899021, 29899165, 29899843, 29901098, 29901099, 29904934, 29916532, 29921821, 29925225, 29928330, 29928364, 29928398, 29930300, 29939407, 29943471, 29949147, 29949176, 29956761, 29956776, 29956784, 29956797, 29963140, 29964132, 29982865, 29990832, 30002690, 30008820, 30012635, 30013646, 30013647, 30015889, 30015916, 30015927, 30017933, 30021384, 30023826, 30024624, 30025915, 30029514, 30034795, 30037885, 30048231, 30049438, 30058688, 30058707, 30061179, 30061946, 30066940, 30068867, 30070339, 30078226, 30106096, 30106110, 30106126, 30106128, 30106448, 30116377, 30127597, 30127907, 30127911, 30127912, 30127920, 30127971, 30127994, 30138604, 30139826, 30144066, 30145832, 30152851, 30158833, 30168854, 30175514, 30175779, 30178850, 30178865, 30186407, 30186408, 30186462, 30193222, 30195499, 30196309, 30197667, 30197679, 30210588, 30211660, 30213285, 30214619, 30216289, 30216505, 30218747, 30221690, 30226569, 30232032, 30233705, 30233707, 30233716, 30250550, 30250566, 30250568, 30251772, 30252929, 30264333, 30268882, 30272252, 30272262, 30272266, 30277098, 30278824, 30280775, 30280789, 30282833, 30283340, 30297390, 30303384, 30304036, 30308516, 30320380, 30320399, 30321260, 30322870, 30324684, 30333888, 30335886, 30339249, 30343279, 30343310, 30344696, 30344709, 30344751, 30344756, 30361262, 30368882, 30370578, 30379806, 30381663, 30382763, 30384473, 30384491, 30387321, 30391993, 30393479, 30396948, 30402442, 30405796, 30417358, 30420752, 30426803, 30429414, 30431064, 30443961, 30446882, 30450663, 30450837, 30450855, 30456840, 30462731, 30463183, 30468473, 30468486, 30469054, 30472432, 30477146, 30481055, 30483788, 30485531, 30503550, 30515612, 30524947, 30529106, 30530525, 30535471, 30535477, 30536007, 30536304, 30536340, 30537571, 30538798, 30546398, 30546451, 30551465, 30552702, 30563041, 30569096, 30569122, 30571718, 30575919, 30575939, 30578377, 30583528, 30589838, 30594149, 30595182, 30599248, 30605698, 30606896, 30606990, 30628640, 30628689, 30638402, 30651849, 30655747, 30655755, 30655858, 30655881, 30657568, 30657580, 30659793, 30664150, 30664153, 30664155, 30664159, 30671383, 30675228, 30675310, 30679328, 30687320, 30693983, 30694908, 30699432, 30700637, 30707764, 30711173, 30711951, 30712312, 30716082, 30720190, 30721730, 30723634, 30733641, 30733666, 30735101, 30738023, 30739428, 30741252, 30747218, 30747227, 30778283, 30779087, 30780111, 30783435, 30783466, 30792387, 30801855, 30806286, 30809279, 30813354, 30815228, 30816437, 30816540, 30822224, 30823534, 30832267, 30842155, 30845773, 30854075, 30858867, 30859811, 30864677, 30864701, 30864721, 30867372, 30869573, 30874346, 30874970, 30874982, 30878547, 30880686, 30896824, 30896826, 30896875, 30909475, 30917711, 30923033, 30930218, 30935269, 30939721, 30940514, 30952729, 30953821, 30961650, 30988756, 30988759, 30988770, 30993644, 30995821, 31002169, 31003775, 31013842, 31020662, 31027104, 31032945, 31036603, 31042421, 31054488, 31059018, 31059095, 31063183, 31071336, 31081107, 31085176, 31090056, 31100273, 31105826, 31105855, 31106485, 31113339, 31114978, 31114980, 31114983, 31115021, 31115023, 31115027, 31115494, 31115571, 31115574, 31115576, 31115580, 31120770, 31127617, 31136293, 31141929, 31143550, 31146399, 31155753, 31161729, 31167801, 31173173, 31180523, 31181779, 31184101, 31186749, 31187116, 31187528, 31189740, 31209657, 31210110, 31210286, 31211886, 31212291, 31218746, 31219428, 31220671, 31222627, 31222746, 31229156, 31230218, 31231312, 31234277, 31239367, 31239698, 31248045, 31250159, 31251923, 31258632, 31262895, 31281315, 31298402, 31301310, 31306347, 31313099, 31322201, 31323016, 31337422, 31339741, 31351435, 31358732, 31362998, 31363375, 31364141, 31364183, 31364493, 31371221, 31373906, 31378747, 31378908, 31378910, 31383785, 31387192, 31387329, 31389568, 31389586, 31389591, 31389609, 31400930, 31410122, 31410148, 31410157, 31410172, 31411368, 31411791, 31412018, 31417030, 31430458, 31433112, 31433581, 31441362, 31442237, 31442950, 31442956, 31445935, 31446057, 31450679, 31461953, 31465766, 31474993, 31484706, 31485613, 31486508, 31501195, 31504911, 31522815, 31524253, 31524260, 31527075, 31536949, 31539107, 31546863, 31547366, 31552178, 31553997, 31554003, 31555365, 31561314, 31566022, 31566218, 31568849, 31572063, 31579427, 31579948, 31586690, 31590241, 31599399, 31599429, 31605603, 31609809, 31615842, 31618892, 31628431, 31632589, 31636641, 31637187, 31640181, 31642818, 31652453, 31652456, 31652963, 31654185, 31655619, 31658318, 31658771, 31662966, 31664016, 31666400, 31667861, 31692072, 31692474, 31692757, 31693087, 31694944, 31710906, 31717443, 31717470, 31717536, 31717784, 31722249, 31729992, 31733641, 31734345, 31736438, 31744202, 31749326, 31749592, 31752432, 31754348, 31758388, 31760170, 31766723, 31772601, 31772707, 31777595, 31778769, 31779213, 31782491, 31789392, 31789417, 31799646, 31799679, 31799680, 31801941, 31803052, 31810928, 31819366, 31825969, 31841174, 31841208, 31841211, 31841897, 31849486, 3186743, 7539757, 7599227, 7655018, 7675775, 7706514, 7772249, 7892160, 7949096, 8084613, 8106752, 8113673, 8142617, 8252486, 8297731, 8380056, 8426481, 8467805, 8492222, 8507880, 8599446, 8684002, 8757523, 8759715, 8826897, 8958800, 9223330, 9408956, 9546285, 9556424, 9626207, 9754175		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	12749011, 16690525, 17852408, 18367485, 18386458, 18426731, 18534064, 18752503, 19152170		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	10576505, 10583267, 11472347, 11699414, 12481899, 12584586, 14510944, 14975737, 15291360, 15802533, 15897243, 1632463, 16960146, 19074837, 21225866, 22692727, 25060588, 25171429, 26546525, 29422088, 8104532, 8203469, 8204892, 8639799, 8649796, 8943893, 8947590, 9009090, 9328155, 9459175, 9613987		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	12581249, 16550596, 18076737, 8552577		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	15563666, 20604962	Associate	★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal Cell Neoplasm	BEFREE	10403462, 19473442, 19719835		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	10704147, 15986355, 16164710, 26136352		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	10704147	Stimulate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	15986355	Associate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	15882169		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	10619965, 11019784, 12810561, 15287094, 16309180, 16827116, 28943529, 28953224, 29633291, 30124113, 30295140, 30508623, 31615010		★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	18179910, 37108591	Associate	★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Bile duct disease	Pubtator	23497522	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	14606101	Associate	★☆☆☆☆ Found in Text Mining only
Binge Drinking	Binge drinking	Pubtator	12603597	Inhibit	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	10826666, 21167476, 21320251, 23072837, 25843436		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	21167476, 21320251, 23072837		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	21167476, 23072837, 25726893	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	21320251, 23072837		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	PSYGENET_DG	21320251, 23072837		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11391617, 11490306, 12081782, 16009487, 18342927, 18751404, 19272801, 20401558, 20620593, 22797576, 23083854, 23621258, 23790536, 24595931, 26427661, 26653553, 26743236, 30806186, 31118765, 9484785, 9507882, 9625842, 9817315		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18342927		★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	18534064, 22033489, 23333150, 33836616	Associate	★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	1536952		★☆☆☆☆ Found in Text Mining only
Blindness	Blindness	Pubtator	15510606	Stimulate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	21562047	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	10072109, 12937123	Associate	★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	21167476		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	22198673	Associate	★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	32515262	Associate	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	7946326		★☆☆☆☆ Found in Text Mining only
Brain Injuries Diffuse	Brain injuries	Pubtator	9327733	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	20504155, 32515262	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	LHGDN	15261486		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	30539420	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	18338171, 21060833, 23152057, 23826359, 28035139, 29016820, 8638218		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	18338171, 26163602, 29110584, 37423059, 37586773	Associate	★☆☆☆☆ Found in Text Mining only
Brain Stem Glioma	Brain Stem Glioma	BEFREE	22562364		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	25661734, 28479725, 29552710		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10426394, 10472781, 10480445, 10481938, 10492630, 10496350, 10504548, 10519395, 10542244, 10567899, 10597263, 10732789, 10733592, 10738245, 10744622, 10754491, 10800077, 10807947, 10918285, 10926327, 11025483, 11029800, 11044356, 11051254, 11078910, 11108890, 11110054, 11110059, 11275791, 11289122, 11440404, 11469882, 11496308, 11712792, 11747334, 11803466, 11820644, 11855753, 11994759, 12115876, 12138400, 12140755, 12145573, 12168831, 12172977, 12174951, 12186376, 12209955, 12452453, 12460791, 12462383, 12543781, 12553494, 12607598, 12631622, 12632082, 12676065, 12680147, 12835724, 12929741, 14607338, 14613035, 14647416, 14660675, 14666386, 14981916, 15026618, 15152946, 15168338, 15177426, 15770521, 16168125, 16228292, 16280040, 16282987, 16331604, 16556548, 16636671, 16647810, 16818519, 16874058, 17203189, 17288732, 17352236, 17372162, 17430582, 17447168, 17612393, 17629615, 17666167, 17678531, 17786319, 17908970, 18381443, 18424910, 18427947, 18428028, 18454859, 18510726, 18661356, 18849663, 19031258, 19035283, 19148464, 19390941, 19440893, 19605509, 19711341, 19800779, 19863221, 20023705, 20062536, 20068093, 20119576, 20514538, 20530667, 20564196, 20679739, 20691103, 20841355, 21204604, 21233846, 21258408, 21383694, 21399894, 21457555, 21621926, 21622563, 21680733, 21861179, 21899728, 21953021, 22037783, 22109882, 22320961, 22362301, 22418857, 22553917, 22623155, 22703841, 22961366, 23054396, 23138847, 23174100, 23315866, 23317270, 23358890, 23415863, 23441615, 23621182, 23631820, 23705845, 23760062, 23861345, 23991978, 24075827, 24155182, 24190517, 24272202, 24272208, 24276280, 24335172, 24909179, 24971890, 25078617, 25179840, 25292288, 25374001, 25409124, 25416050, 25616695, 25648135, 25682076, 25784482, 26082034, 26099171, 26191195, 26257067, 26339338, 26359357, 26472348, 26530780, 26662799, 26812869, 26921175, 27390258, 27517917, 27596816, 27613092, 27771839, 27998789, 28025102, 28039357, 28123543, 28230534, 28301598, 28373418, 28378131, 28382095, 28396252, 28413418, 28430743, 28475922, 28479725, 28482576, 28701032, 28713975, 28739740, 28801774, 28939105, 28959140, 28993998, 29202620, 29254147, 29312798, 29339815, 29423411, 29496539, 29501042, 29844816, 29855616, 29876007, 29899841, 30021371, 30069746, 30246261, 30315250, 30374681, 30570350, 30625226, 30635657, 30728358, 30744593, 30776589, 30824486, 30962322, 30970626, 31109399, 31155753, 31236965, 31289309, 31404252, 31448050, 31454538, 31494078, 31583572, 31595181, 31603120, 31605603, 31649548, 31673827, 31698596, 31777591, 31825969, 7612493, 7640218, 7712429, 7814152, 7833141, 7896458, 7915536, 8174112, 8286195, 8520001, 8617450, 8621251, 8647960, 8690514, 8729986, 8777167, 8822113, 8895551, 8917421, 9092950, 9150188, 9253035, 9306577, 9362445, 9392332, 9413034, 9514059, 9583721, 9605757, 9695733, 9815631, 9815706, 9816145, 9886853, 9891509		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	12517783, 16954440, 23621182		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Diseases	Breast Diseases	LHGDN	15467428		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	15467428, 7915536	Associate	★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast Diseases	BEFREE	7915536		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10399627, 10496350, 10507761, 10542244, 10733592, 10918285, 10998426, 11025483, 11044356, 11153146, 11275791, 11323501, 11489892, 12210599, 12429812, 12548595, 12835724, 14660675, 14669273, 14688828, 15152946, 15310398, 15545228, 15578079, 15628988, 15781986, 15830342, 15908782, 16616141, 16638854, 16793559, 16839413, 16911782, 17352236, 17372162, 17430582, 17575115, 17612393, 18225547, 18270395, 18380893, 18428028, 18430249, 18454859, 18928543, 19000652, 19383332, 19385591, 19434314, 19582475, 19605509, 20062536, 20154269, 20447057, 20457620, 20495533, 20514538, 20664923, 20691103, 20829044, 20841355, 21131755, 21139586, 21233846, 21377101, 21457555, 21622563, 21716903, 21826535, 21841772, 21861179, 22035021, 22320961, 22395515, 23098454, 23098483, 23159854, 23244222, 23315866, 23317270, 23364795, 23368093, 23417836, 23538216, 23573235, 23576806, 23621182, 23648477, 23705845, 23991978, 24023670, 24335172, 24359639, 24377598, 24606718, 24768477, 24896091, 24909179, 24965402, 24971890, 25005788, 25019346, 25124606, 25169499, 25179840, 25190016, 25374178, 25548920, 25739083, 25791820, 25966904, 26191195, 26235741, 26246283, 26339338, 26464626, 26472348, 26618552, 26662799, 26823806, 26963620, 27221871, 27379929, 27462784, 27538498, 27771839, 28701032, 28852738, 29423411, 29618179, 29750305, 30583683, 30631150, 30744593, 31158261, 31289309, 31578772, 31605603, 31825969, 31881805, 31983109, 32155880, 32366289, 32419250, 32634469, 32746451, 32986661, 33239070, 33357134, 33369440, 33369470, 33495824, 33878879, 34099764, 34214511, 34221232, 34452574, 34470980, 34636027, 34828282, 34884765, 36284943, 36510982, 36531115, 36615253, 37049702, 37294601, 37573657, 37863936, 37917911, 38019251, 38051378, 39285666, 40252335, 7612493, 7640218, 7915536, 7977649, 8080038, 8286195, 8679463, 8725660, 8750153, 8777167, 9252201, 9313824, 9339128, 9497101, 9514059, 9815673	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	34360714	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	39732179	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	23573235	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	21167476		★☆☆☆☆ Found in Text Mining only
Brooke-Spiegler syndrome	Brooke-Spiegler Syndrome	BEFREE	21986618		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	16388717		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	11389007	Inhibit	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	12118116, 1378321, 14508797, 1459737, 16006805, 16104877, 17875505, 18923440, 1899478, 19283066, 19597184, 19816150, 19886912, 20118770, 20817505, 21473291, 21560252, 21740296, 2196779, 2250191, 23076380, 23348205, 23939148, 24679006, 2506501, 25125624, 25696841, 25732831, 26182827, 26218299, 28094768, 28288039, 28855351, 30104685, 31039827, 8280621, 8847894, 9378470		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	1378321, 19018532, 19363496, 20118770, 22241218, 25612555, 26218299, 26763367, 31127617, 35077634, 35794096, 38468555	Associate	★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of the kidney and urinary tract	Pubtator	34502088	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Head	Neoplasm of head	CTD_human_DG	18566236		★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	16299246, 17020977		★☆☆☆☆ Found in Text Mining only
Cancer of Neck	Neck Cancer	CTD_human_DG	18566236		★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	16827116	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10362119, 10607921, 10794603, 11044356, 11194193, 11349216, 12941126, 15467428, 15858118, 15976908, 16475721, 16875495, 17632454, 17694953, 17989874, 18263880, 19351775, 21556123, 23059827, 23119114, 23563182, 23637776, 24203629, 24741635, 26268226, 26662799, 26960459, 29270778, 29281558, 29307797, 31825969, 33402109, 33840043, 35058488, 8203460, 8630278, 9626044	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	18172265, 30941978	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	26008974	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10193519, 10223243, 10607921, 10619965, 10652586, 10718401, 10780525, 10782880, 10884916, 10926327, 10937049, 10944610, 10964337, 11044356, 11194193, 11207824, 11275791, 11482579, 11724359, 11786411, 12605367, 12766581, 12810637, 12893071, 14610217, 14647471, 14654538, 16675913, 17352240, 17908970, 18063429, 18382371, 18620728, 19027288, 19035317, 19318573, 19729672, 20025478, 20877573, 21207420, 21618512, 21621926, 23216071, 23321005, 23479508, 25012986, 29330143, 29565181, 7478561, 7490679, 7695015, 7777475, 7814152, 7936663, 8063611, 8207614, 8546897, 8617450, 8625322, 8690754, 8721444, 8729986, 8797876, 8888274, 9292705, 9306964, 9366376, 9413034, 9465813, 9521507, 9522214, 9591537, 9669816, 9815631, 9815900, 9815973, 9891543, 9891551		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	10426811		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	Pubtator	17431014, 24718460, 31977320, 7734290, 7856728, 8546897, 9804855	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	Pubtator	19683979	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	21552290	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	29328455	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	12575847, 14669293, 21424069, 23599161, 26429176, 35636508, 36253891, 7747803	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	24322021, 9865831	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	10793072, 11173657, 11994759, 15467428, 22420628, 26464626, 30583683	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	16839413, 17372162, 36510982	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	12060448	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	16619475, 33416213	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10567879, 11749866, 11854904, 12439925, 15052673, 16627984, 18023099, 18203291, 19360919, 19447220, 20647330, 21040406, 21771706, 21829603, 22292626, 22928777, 23015317, 23392177, 23862748, 23918568, 24223706, 24287949, 24289588, 24708487, 24779770, 24885292, 25032846, 25173640, 25261655, 25492486, 25851347, 25855960, 26044564, 26575170, 26707143, 26718026, 26884837, 26884845, 27043783, 27579319, 27699664, 28246474, 28333141, 28638890, 28655132, 29298665, 29854577, 30070317, 30539830, 31128017, 32197467, 32236628, 33090723, 33576217, 33576897, 33902004, 34257542, 34436030, 34732665, 35032618, 35127170, 35572840, 35970393, 36011369, 37087978, 39256453, 7502684, 9637556	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	15467428, 21956856	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	10392638, 15361203, 19475528, 20647402, 8635035		★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	11173657, 21139586	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	38086335, 8952529	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	11153146	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	8546897	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	19307957, 22814318, 34896889	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	21804218, 22828373, 24256941	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11391617, 11490306, 12081782, 16009487, 16484005, 18342927, 18751404, 20620593, 22797576, 23083854, 23621258, 23790536, 24595931, 24870742, 26427661, 26653553, 26743236, 27002765, 30806186, 31118765, 8608975, 9484785, 9507882, 9625842, 9817315		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	10456279, 11520092, 12656410, 15036664, 15243561, 17557568, 19729336, 27959448, 29085504		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10219898, 10873111, 11123426, 12414660, 12768189, 12838300, 15210690, 15217967, 15503311, 15527763, 15753661, 16231322, 16311913, 18172305, 18852117, 18927282, 19097992, 19372563, 19654003, 20498076, 21258880, 21660060, 22666341, 23108890, 23276293, 23339680, 23358890, 23496232, 23588221, 23867991, 23894143, 23959540, 23977251, 24521149, 24952874, 25066397, 25424357, 26216446, 26325180, 27083050, 27088439, 27268917, 27744185, 27896589, 28270083, 28432456, 28454469, 28514759, 28606806, 29045843, 29459573, 29788725, 30195756, 30249026, 30378152, 30725416, 31083279, 31150457, 31221478, 31485626, 31572459, 7763030, 8630278, 9508209		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	10666369, 12445249, 17465257, 20082279, 30178832, 30178833	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	22024503, 22384141, 25120759, 25184537, 26606261, 37477952, 37700464	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	12941126, 14710230, 17541305, 19305426, 20208132, 24236538, 24743574, 26821530, 29899382, 31081053, 31259714, 32009115, 33022894, 33932757, 34490473, 34781823, 35266008, 35818918, 35955582, 36374334, 36933996	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	12657131, 7977636, 8774138, 8938949	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	20004174	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10514383, 10646898, 17694953, 20631638, 21068757, 22124045, 24322021, 24774218, 25084400, 26960457, 27356570, 28679648, 32188965, 35024732, 39333222, 8393963, 8763257, 8774138	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17632454, 25593302	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma testes	Testicular carcinoma	BEFREE	9669816		★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	15448751, 28417194, 8707954	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	10193941, 11298546, 12150137, 12575847, 12925225, 15520176, 18264131, 19719835, 26437300, 7632062, 8617478, 9158413, 9256917		★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	14559989, 9987671		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	22251937, 26434631		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10480447, 10646901, 10666369, 10785478, 11094305, 11295035, 11328414, 11720475, 12445249, 15156398, 15505422, 16166319, 16785787, 17603707, 18056200, 18334006, 19148468, 20082279, 20939431, 22294191, 22688594, 23455184, 23579097, 23962558, 24190693, 25672608, 25862909, 27044825, 27095571, 27277143, 27571744, 27748803, 27935869, 28188387, 28628188, 29062236, 29952351, 30178833, 30548372, 30718431, 30896826, 30987661, 7478541, 8616869		★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	15841044		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	10426811		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	28193280	Associate	★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	29565181		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	12907417	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	23497522	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	16405608	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	27922664		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	10767354, 12037031, 27922664, 30140897, 31353329		★☆☆☆☆ Found in Text Mining only
Cartilaginous exostosis	Osteochondroma	BEFREE	11140704, 12271817, 12645631, 15744499		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	11803481, 12118239, 27061232		★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	9232607		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	11908704		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	23991739	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	18556402, 26834242	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	12391455	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	8638218, 9341939		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	10406019, 11063051, 15181376, 24373752, 29961232, 30481625, 30822224, 30906474, 31611791		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	24025186		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	10406019, 28488007, 31063183		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	10999751, 11198267, 15361203, 15832769, 17098279, 19940548, 20213048, 20213509, 21704150, 22160209, 23588620, 24634186, 24782650, 26474854, 26681053, 27177038, 27261616, 27677077, 28246354, 28615991, 29318915, 29336659, 30509141, 30552693, 30599894, 31093891, 31579427, 9162297		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	10392638, 15581953, 15832769, 19940548, 26272263, 26681053		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	10999751, 11198267, 15361203, 15832769, 17098279, 19940548, 20213048, 20213509, 21704150, 22160209, 23588620, 24469707, 24634186, 24782650, 26474854, 26681053, 27177038, 27261616, 27677077, 28128400, 28246354, 28615991, 29318915, 29336659, 30509141, 30552693, 30599894, 31093891, 31579427, 7768985, 9162297, 9465813		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10194447, 10500808, 11378579, 18024393, 18046449, 18056841, 18398104, 20038611, 20232432, 21606961, 22037714, 22591684, 23393050, 23511489, 24088574, 25982455, 27002764, 27008505, 27343252, 27725691, 29254309, 29680307, 29693417, 30016275, 30390332, 30862722, 31462891, 31808877, 8562940, 8602624, 9108419, 9160683, 9823951		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	18228020		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	24152222		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	17574594, 25173640		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	10983696, 17545597, 21161674, 21181094, 21880625, 22766741, 25885794, 26394044, 29016820, 31465840, 8638218		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	10547558, 15332326, 21171016		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	10617275, 12201864, 12438243, 15484294, 19070389, 25936772, 26427701, 28176146, 28652654, 29408314, 30652346, 30949409, 31399555		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	15484294		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	15484294, 28652654, 33962620, 35307646, 35790790, 8129031	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	31773435		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	11140704, 15744499, 17343283, 19445670, 20127255, 22109662, 22112972, 27835579, 30242253, 30824188		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	11140704, 15685701, 19445670, 20127255, 22112972, 23415961, 34070455	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	17343283	Stimulate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma Mesenchymal	Chondrosarcoma	Pubtator	27617402, 40301759	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	23065465, 30400387		★☆☆☆☆ Found in Text Mining only
Choroideremia	Choroideremia	Pubtator	37216303	Associate	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	30968846		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	23364519		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	23364519, 28078995		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	11023531, 11167830		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10561025, 10576505, 10583267, 11249036, 11468180, 11472347, 11699414, 11713720, 11753607, 12040429, 12099337, 12148885, 12481899, 12584586, 12737946, 12960340, 14510944, 14636414, 14654935, 14689061, 14975737, 14996703, 15032666, 15289859, 15291360, 1549371, 15503311, 15545599, 15621786, 15700138, 15802533, 15880597, 15897243, 15982345, 16166262, 16166456, 16186597, 16249459, 1632463, 16338422, 1638028, 16498393, 16526947, 16616063, 16960146, 16983347, 17179226, 17200714, 17296974, 17463171, 17525724, 1757070, 17760804, 17959858, 18046447, 18163880, 18575824, 18596739, 18599795, 18633450, 1868035, 1868240, 18779747, 19074837, 19187275, 1923524, 19320642, 19452318, 19883311, 20061561, 2031977, 20354122, 20529838, 20687796, 20863894, 20884628, 2106002, 21130495, 21156227, 21225866, 21358717, 21372840, 21427708, 21457555, 21521129, 21737576, 2176281, 21772052, 21846680, 21947285, 22184378, 22580984, 22686190, 22692727, 22711886, 22858545, 22898870, 23172082, 23201402, 23482887, 23551855, 23613627, 23674504, 23689597, 23723123, 23837491, 23936412, 24072590, 24095849, 24346116, 24648050, 24768714, 24971479, 25040181, 25060588, 2506501, 25088254, 25171429, 25590803, 25641428, 25713363, 25829398, 25887155, 2642578, 26488112, 26493374, 26546525, 26662799, 26701089, 26775694, 26897372, 27040706, 2704746, 27069256, 27095788, 27177607, 27297795, 27343252, 27357816, 27430517, 27488117, 27499136, 27521330, 27524613, 27558232, 27572051, 27689871, 27742072, 27806433, 27808579, 27813533, 28089635, 28095146, 28100580, 28111464, 28116634, 28140720, 28155013, 28185174, 28209992, 28213497, 28331288, 28442922, 28449207, 28482721, 28492339, 28498799, 28504646, 28578655, 28586007, 28724540, 28843007, 28923920, 28942659, 28950661, 28972395, 28978315, 28983606, 29061914, 29099483, 29115462, 29246803, 29302721, 29333561, 29407973, 29422088, 29463802, 29561706, 29595064, 29747654, 29777163, 29895707, 29899382, 29899864, 29982866, 30012635, 30041155, 30134797, 30135489, 30260837, 30282833, 30317639, 30406027, 30514704, 30516079, 30556269, 30575108, 30601084, 30608887, 30704457, 30768675, 30824485, 30858962, 30935269, 30969139, 30975914, 31166681, 31205643, 31209657, 31239767, 31293422, 31313099, 31494171, 31601689, 31637186, 31645677, 31650140, 31764118, 31764121, 31774349, 31821686, 3657890, 7680220, 7680614, 7775580, 7945466, 8011526, 8090743, 8104532, 8136263, 8203469, 8204892, 8260892, 8374905, 8608978, 8616030, 8639799, 8649796, 8667654, 8850247, 8943893, 8947590, 9009090, 9049970, 9057657, 9090492, 9107076, 9328155, 9459175, 9613987, 9626361, 9864930		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	17118768, 18156504, 18633450		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CTD_human_DG	21750559, 23770605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASDB_DG	23770605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASCAT_DG	23770605, 26956414		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic mountain sickness	Mountain sickness	BEFREE	30683541		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	17043146		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15748212, 17207023, 22686245, 31219199, 31270147		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	24025186	Associate	★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	24203629		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	20627094, 9934751		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	12810203		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	24025186	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	11948143		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	33447019	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29745420, 30210688, 30923033		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	23599650, 31159239, 39252247	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10612539, 10785598, 11052631, 11355956, 11920608, 12149448, 12269390, 12423325, 15314290, 15955446, 16773715, 17182178, 17278191, 17426704, 18807035, 19027288, 20409521, 22570942, 24743574, 25385144, 25548100, 26697569, 27845068, 28782841, 29394130, 29416778, 29656061, 29669301, 30535479, 30806395, 31011292, 31497237, 8690754, 9815900		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	10223192, 17404573, 19147571		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	BEFREE	11848471, 17404573, 9672345		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15303767, 15314290, 16227396		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	15955446, 16186958, 16773715, 17192048, 18071066, 20721457, 28714374, 31040202, 8063611, 9020491	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Polyps	Colonic polyps	Pubtator	7856728	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10022131, 10193519, 10452254, 10564391, 10607921, 10652634, 10767713, 10797335, 11041112, 11150376, 11151060, 11687726, 11724359, 11802199, 11848471, 11865380, 12244568, 12670866, 14663636, 16401477, 16407826, 16799636, 17273826, 17332927, 17373735, 18852136, 18949393, 19124064, 20716165, 21128871, 21455217, 22050790, 22990545, 23364257, 23867993, 24293274, 24384683, 24451945, 24895601, 24957706, 25192188, 25208882, 25209181, 25282590, 25323586, 25738398, 25840688, 25977444, 26078354, 26482433, 27046651, 27220399, 27244080, 27461218, 27537525, 27663504, 28032859, 28106544, 28468511, 28499854, 28785155, 28803443, 28928161, 28950657, 29065135, 29190919, 29288563, 29372687, 29636622, 29844818, 29958837, 30417787, 30420612, 30443961, 30515612, 30557404, 30588113, 30677442, 30681073, 30713822, 31043791, 31141929, 31243264, 31296963, 8063611, 8625322, 9054611, 9164212, 9221853, 9823803, 9849490, 9881495		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	18949393		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10193519, 11237386, 11349216, 12033956, 12149448, 12670866, 15314290, 15627889, 15955446, 16127422, 16308474, 16358373, 16830272, 17192048, 17278192, 17373735, 17406756, 17426704, 18320073, 18985814, 19088028, 19290007, 19661314, 20237898, 21403907, 21455217, 21927014, 22990545, 23194063, 23441183, 23700428, 23893182, 24098503, 24720439, 24895601, 25192188, 25323586, 25542230, 25548100, 25782664, 25840688, 25864810, 26416353, 26482433, 26585594, 26697569, 27151692, 27461218, 27520705, 28035994, 28075415, 28106544, 28270869, 28902367, 28968471, 30468657, 30681073, 31116002, 31173223, 31718693, 32000660, 32277680, 32495637, 32669835, 32685496, 33070156, 33277833, 33345633, 33557648, 33666815, 33723275, 34512817, 34994989, 35462114, 35563442, 35611809, 36013602, 36135759, 36573458, 36793496, 37148838, 37151875, 37373155, 37516866, 37530327, 37586118, 39336420, 39940328, 40075273, 40523762, 7547253, 8063611, 8611422, 8909260, 9667660, 9792140, 9863484	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12670866, 14627346, 16243795, 16308474, 16358373, 17360176, 18949393		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	16243795, 23060299, 30557404, 8625322, 9143411		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	18949393		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Comedone	Comedone	BEFREE	10652623		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	10844530, 11472434, 30464201	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	11472434, 28925897, 30464201, 30843876		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	32961586	Inhibit	★☆☆☆☆ Found in Text Mining only
Complement Component 6 Deficiency	Complement component deficiency	Pubtator	23907460	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	27262945		★☆☆☆☆ Found in Text Mining only
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	19348791, 21808961, 9699956		★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	BEFREE	27367032		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	BEFREE	11196462		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10086726, 10334544, 10430080, 11602464, 15143340, 1884022, 1909295, 20817505, 20976632, 22849573, 22984125, 23939148, 24222112, 26182827, 26517511, 27810071, 27966264, 27995457, 28594133, 8204892, 8535216, 8616030		★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	BEFREE	29805506		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	19968497, 20458760, 20724592, 28670110, 28895407, 29408314, 31399555		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital contractural arachnodactyly	Pubtator	35983950	Associate	★☆☆☆☆ Found in Text Mining only
Congenital neutropenia	Congenital Neutropenia	BEFREE	26193632		★☆☆☆☆ Found in Text Mining only
Congenital Nonbullous Ichthyosiform Erythroderma	Congenital Nonbullous Ichthyosiform Erythroderma	BEFREE	19278426		★☆☆☆☆ Found in Text Mining only
Congenital torticollis	Congenital Torticollis	BEFREE	30390390		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28849082, 29574918, 29746994, 30968846		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Continuous Muscle Fiber Activity Hereditary	Hereditary continuous muscle fiber activity	Pubtator	11570908	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10101681, 10964337, 11351249, 12025227, 12796377, 12810203, 12941126, 14519627, 14710230, 15188008, 15756350, 15826766, 15985079, 16643620, 17541305, 19380190, 19539330, 20037166, 22591748, 23469687, 26575290, 27483435, 27710896, 27779645, 28449664, 28464919, 29251173, 29731840, 30058688, 31031856, 9042262		★☆☆☆☆ Found in Text Mining only
Corneal dystrophy Avellino type	Corneal dystrophy	Pubtator	19497990	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12883197, 15280201, 18701048, 20307495, 29399062, 29412156		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	12883197, 15280201, 23160801, 26823859, 29399062		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	26823859	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	12883197, 15280201, 29399062		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	30068867		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	10029614, 23643741, 24203631, 29796658, 30515402		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31159239	Associate	★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	Pubtator	11877309	Associate	★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	BEFREE	12353944		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	36555435	Stimulate	★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	29140156, 29254147, 29765412, 31107947		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	12449722, 14598887, 24461648, 28050764, 31535400, 7695015		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	22684875		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	12099633, 15618464, 19201925, 23135964		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19201925	Associate	★☆☆☆☆ Found in Text Mining only
Cytochrome c Oxidase Deficiency	Cytochrome c oxidase deficiency	Pubtator	33245769	Inhibit	★☆☆☆☆ Found in Text Mining only
De Lange Syndrome	De lange syndrome	Pubtator	29088292	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	31807149		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10685814, 10799883, 19103633, 26081683, 27590063, 27845876, 28548679, 28586000, 29207056, 29755657, 30430645, 31405216		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	21590770, 28290606		★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	BEFREE	18289046		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	16186627		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	17124644, 22198673, 29414391		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	24455679, 29885845, 30178865, 30280789		★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	29928398		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	16098144	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	16714000, 17700647, 18799817, 20045935, 24004471		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	20010695, 25726893	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	28293733, 28716632, 31160908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Atopic	Atopic dermatitis	Pubtator	11091268, 12605696	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	11207646	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	16388717	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	16033404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	17121585		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	11325830		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	16850099	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	30068766		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28944839, 29399092, 29754274		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	16388709, 20200776, 21521253, 22828168, 26782377, 31615341, 33490239, 34512554	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21519150, 28944839, 29399092, 29427460, 29754274, 30317639, 30477146, 9576088		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	27141571	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	16388709, 39464889	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20200776, 30593206, 38027164	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11704806, 11899074, 16388709, 27737950, 28185128, 29969317, 30138895, 31290273, 31398260, 31639864, 7589882, 9856487		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	16959961		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22325160, 28573460, 29115422, 30453650, 30593206, 31411368, 31691259		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	22325160		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	28869590, 30718926		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	30454704		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	34293021	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	16388709	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	16388709, 29751837, 31755322		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	40214234	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29104476, 31599399		★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	16254104, 26960459	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	BEFREE	11508812		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	10102615, 10350331, 10414499, 10784396, 11050805, 11106080, 11298531, 11567225, 11830458, 11850073, 11949845, 12118091, 12118116, 12169673, 12402391, 12406188, 12406872, 12430874, 12742158, 12796378, 12967475, 15242877, 15277222, 15714059, 15770300, 15832092, 16006802, 16424389, 16670080, 16785131, 16796775, 17519619, 17577773, 17593082, 18024371, 18096567, 18165800, 18367485, 18445693, 18628087, 18645192, 1868240, 18752503, 18769131, 18925695, 18925696, 18929412, 19144384, 19276283, 19307668, 19537891, 19549844, 19597184, 19706817, 19783718, 19816150, 20016842, 20093241, 20118770, 20200556, 20352431, 20512275, 20660332, 20817505, 21394100, 21625222, 21640157, 21740296, 21832150, 22035756, 22184285, 22189900, 22194861, 22510149, 22665537, 22851565, 22929980, 23149705, 23335369, 23348205, 23370596, 23449635, 23681227, 23892979, 23939148, 24222112, 24232982, 24258714, 24496723, 24506200, 24679006, 24768714, 25090026, 25090918, 25103070, 25124685, 25125624, 25149548, 25284491, 25458080, 25529575, 25696841, 25696842, 25704881, 25741152, 25805589, 25828389, 25882699, 25907897, 26010683, 26158410, 26218299, 26307073, 26319027, 26324762, 26373676, 26421520, 26460954, 26467384, 26515759, 26541272, 26545844, 26586460, 26657288, 26717387, 26773040, 26850490, 27027803, 27048211, 27071312, 27419806, 27543313, 27739436, 27822610, 27825111, 27864689, 27867103, 27907212, 28038709, 28086220, 28153771, 28209136, 28212447, 28278726, 28288039, 28327893, 28522442, 28605593, 28749548, 28750570, 28855351, 28927145, 28949959, 28952038, 28985492, 29037890, 29067124, 29088292, 29189488, 29198442, 29250662, 29269870, 29500147, 29541561, 29567771, 29623179, 29666157, 29666304, 29674626, 29899382, 29931583, 29983382, 30055346, 30113335, 30213389, 30252929, 30287880, 30322870, 30404918, 30496802, 30523053, 30523716, 30542505, 30553470, 30573511, 30666200, 30809101, 30872780, 30874346, 30985716, 31039827, 31109360, 31169238, 31171907, 31205561, 31229156, 31285189, 31288832, 31468517, 31518494, 31527075, 31601689, 31615842, 31644584, 31728727, 31734190, 31801186, 7515657, 8270971, 8274734, 8435363, 8508412, 8547651, 8916960, 9037360, 9207459, 9209654, 9242549, 9422982, 9573674, 9626207		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	16081686		★☆☆☆☆ Found in Text Mining only
Diffuse Mixed-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	26239085, 3287162		★☆☆☆☆ Found in Text Mining only
Diffuse panbronchiolitis	Diffuse panbronchiolitis	Pubtator	16574390	Associate	★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	9697985		★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	9697985	Associate	★☆☆☆☆ Found in Text Mining only
Dissection Ascending Aorta	Dissection of aorta	Pubtator	22978789	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10381557, 11417611, 9379849		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25222269	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	31257361		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	10767354, 7814152, 8900371, 8917421		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	11994759, 17372162, 21987236		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	LHGDN	16839413		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	10365897		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	12929929		★☆☆☆☆ Found in Text Mining only
Dyschondroplasias	Dyschondroplasias	CTD_human_DG	17954590		★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	7632063		★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	27711077		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	17121585		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	32515262	Associate	★☆☆☆☆ Found in Text Mining only
Embryonal Neoplasm	Embryonal Neoplasm	BEFREE	8638218		★☆☆☆☆ Found in Text Mining only
Empyema Pleural	Emphysema	Pubtator	11322168	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	31353670	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	9765397		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	21622563	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	11330947, 17590421, 28222424, 8920794, 9427771		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10705244, 10831353, 11198267, 11330947, 11420706, 11603220, 12193924, 12217750, 12237915, 12469199, 12866376, 15721399, 16012738, 17590421, 19160418, 21618512, 21627862, 22343305, 23637776, 28123521, 28222438, 29653556, 30168854, 30537101, 30971627, 8729980, 8729985, 9292705, 9306964, 9781657		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	12217750, 12237915, 29179590, 30168854		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	40256590	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	12237915, 16123814, 16250278, 16619475, 18398703, 19846939, 20686376, 21888833, 22032837, 22252757, 23167388, 23637776, 28421904, 29264761, 29560769, 29653556, 30610803, 31136293, 31790621, 40243611, 40243844, 40256590, 8203460, 9292705	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	15149157, 18386458, 18398703		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	10027623, 19729941, 22309646, 25996258, 26914112, 30468519, 31262977		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	11020520, 19501353, 24127964, 26743275, 33817715, 34746304, 40243611	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Enterocolitis Necrotizing	Enterocolitis	Pubtator	27164337	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	10086726		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	34654952	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis bullosa simplex Ogna type	Epidermolysis bullosa	Pubtator	28675510	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsies Myoclonic	Myoclonic epilepsy	Pubtator	22152093	Inhibit	★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	37563306	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	10908900, 31173166		★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	22365585	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	10908900, 28079889		★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	16620920, 28185403, 28973148		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	10480447, 12445249, 20082279, 20939431, 22688594, 23455184, 24190693, 27044825, 27095571, 27571744, 27935869, 28628188, 30178833, 30896826, 30987661		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	10780525, 22825469, 8752171, 9367385		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	CTD_human_DG	12394778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Erectile dysfunction	Erectile Dysfunction	BEFREE	30477146		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Erectile Dysfunction	Erectile dysfunction	Pubtator	39809170	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10778992, 11299823, 17561354, 20378992, 20676910, 22187149, 22502669, 23999873, 24606472, 25816175, 28441715, 28760343, 30197671, 30213293, 31452796, 31789385, 8797876		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	10778992, 11299823, 17561354, 20378992, 20676910, 22187149, 22502669, 24606472, 25816175, 28441715, 28760343, 30197671, 30213293, 31452796, 31789385, 8797876		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	16011306, 24606472, 28487599, 28653878, 28713162, 31171890, 32258099, 32360515, 32426838	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	17561354, 17912028		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	21472143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	10514383, 10601836, 20193114, 22477709, 23955799, 25438156, 26132559, 28488526, 32071920, 34257544, 36474162	Associate	★☆☆☆☆ Found in Text Mining only
ESTROGEN RESISTANCE	Estrogen Resistance	BEFREE	25848915		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	30078226, 30123424, 30348635, 9307264		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	30348635		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	19968497		★☆☆☆☆ Found in Text Mining only
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	BEFREE	11023531		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	18077176		★☆☆☆☆ Found in Text Mining only
Familial benign hypercalcemia	Hypocalciuric hypercalcemia	BEFREE	29200739		★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	32901872	Stimulate	★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	18369381, 29526801		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	25888009, 30217293		★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	21037114, 31336611, 34722766	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	34954697	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	17036395	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	20888662, 28264426, 28446627, 29991872		★☆☆☆☆ Found in Text Mining only
Fibrillary Astrocytoma	Fibrillary Astrocytoma	BEFREE	11820596, 7494604		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	LHGDN	15763593		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	11867266, 17785366, 25851703, 29075126, 8834522		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	11867266, 14698203, 15051039, 15572421, 17785366		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	11306504		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	11306504, 9714058		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	14681329, 28190086, 29169724, 31003150, 31213776		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	29137483		★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	16611376, 28639913, 30447272		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	CTD_human_DG	10223192, 10426811		★☆☆☆☆ Found in Text Mining only
Follicular Cyst	Follicular cyst	Pubtator	2704746, 8449825	Associate	★☆☆☆☆ Found in Text Mining only
Follicular lymphoma	Follicular lymphoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	32727073	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	16904648, 23134201, 23784204, 24329682, 24756644, 28256505, 28766687		★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	CTD_human_DG	16904648		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	29513793, 34118139	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ganglioneuroblastoma	Ganglioneuroblastoma	BEFREE	23816987, 8195931		★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	7666311		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	23684481, 29403555, 7712429		★☆☆☆☆ Found in Text Mining only
Gastric lymphoma	Gastric lymphoma	BEFREE	10079376		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	15492912	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	10219822, 28662697		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	20931420	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	22568453	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	15961081, 32883271, 8063611	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	12375034, 16518826, 16733203, 19509155, 19860642, 20043176, 23613627, 27649657		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	16518826, 17552015, 25898773, 26617858, 27649657	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	11472349	Associate	★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	23083798		★☆☆☆☆ Found in Text Mining only
Genitourinary Neoplasms	Genitourinary Neoplasms	BEFREE	23083798		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	17603707		★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	10574599		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	10574599		★☆☆☆☆ Found in Text Mining only
Gingival Diseases	Gingival diseases	Pubtator	31743516, 33934404	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10567494, 10628370, 10764042, 10825522, 11083075, 11519857, 12218266, 12558990, 15332326, 15493013, 1742726, 18357521, 18568776, 18615633, 18663354, 19267218, 19473291, 20483178, 21212266, 21213215, 21250804, 21419810, 21743969, 21880871, 22002102, 23076250, 23152057, 23551751, 24213561, 24287948, 24706805, 24757258, 24866280, 25449296, 26008975, 26467103, 26775694, 26887050, 27533080, 27558109, 27921110, 28035139, 28577058, 29236891, 29279995, 29508061, 29520102, 29698587, 29743557, 29940755, 29949238, 30144594, 30337641, 30389373, 30625226, 30834619, 30859392, 31222722, 31648104, 31658771, 7494604, 9042164, 9576258, 9858877		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	10567494, 12558990, 16688362, 18357521, 20730317, 21880871, 23152057, 24287948, 24757258, 26775694, 27533080, 29236891, 29520102, 30248541, 30385739, 31870319, 35473984, 35730472, 38016363, 38385470	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	12754350, 18357521, 18568776		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10567494, 10628370, 10764042, 10825522, 11083075, 11508812, 11519857, 12218266, 12558990, 15332326, 15493013, 15805299, 1742726, 18327814, 18357521, 18568776, 18615633, 18663354, 18669646, 19267218, 19473291, 20483178, 21212266, 21213215, 21250804, 21419810, 21743969, 21846680, 21880871, 23076250, 23152057, 23551751, 23579274, 23826359, 24213561, 24287948, 24706805, 24757258, 24811082, 24866280, 25449296, 26008975, 26467103, 26775694, 26887050, 27533080, 27558109, 27921110, 28035139, 28577058, 29236891, 29279995, 29508061, 29520102, 29698587, 29940755, 29949238, 30144594, 30248541, 30337641, 30389373, 30625226, 30834619, 30859392, 31222722, 31611741, 31648104, 31658771, 9042164, 9576258, 9858877		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10029807, 10764042, 10825522, 10873619, 10930016, 11593384, 13130506, 15584904, 16254573, 18640498, 19451193, 20033782, 20352345, 20514445, 21364647, 22207524, 22238507, 22562364, 24287948, 24418124, 24741074, 25048475, 25139025, 25405848, 25449296, 26601952, 26722459, 27255231, 27430517, 27589728, 27777286, 28035139, 28232157, 28233371, 28373118, 28493025, 28656255, 28677777, 29152149, 29942129, 30481055, 30537994, 31129471, 31534865, 31737190, 31810928, 7490615, 7539458, 8621251, 8649811, 9409814, 9484802, 9506361, 9872414		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10361224, 11175638, 12085183, 15584904, 16319070, 16688362, 16875495, 18327814, 18670645, 19208740, 19289490, 20511184, 21122152, 21279667, 21364627, 21364665, 21964739, 22895663, 22967897, 23684856, 24287948, 24325785, 24741074, 25048475, 25556484, 25674231, 26439036, 26722459, 26743778, 26748401, 28032310, 29333957, 29866060, 30225541, 30296359, 30548945, 30927504, 31319814, 32446712, 32851798, 33173023, 34268963, 36273072, 36795994, 37918583, 38067099, 9060818, 9409814, 9472635	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15584904, 18327814		★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	28193280	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	15048718, 19107326, 26919255, 31404120, 8587248		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	8587248	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	26460503	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	23382857	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	14694160		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	22898870, 31462891		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	35605642	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	11877266	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	30548945	Stimulate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	BEFREE	9022077		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	32247860	Stimulate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	30420758, 31688198		★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	18653721, 23235765		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	10443697, 11327614, 24364474, 28187375		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	LHGDN	15351796, 18162459		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	15351796, 16219172, 19008632, 7627264	Associate	★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	11128872, 1638028, 8204892, 9049970, 9613987		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	30967588		★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	24089674		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	11327614, 28187375, 29250672		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	16219172, 7730485	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	10567901, 10628333, 10766395, 11751518, 19724896, 21110823, 23479508, 23734725, 25604244, 27670669		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	CTD_human_DG	18566236		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22160615, 22393978, 23479508, 23719266, 23734725, 24019973, 24554038, 30961650	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head Neoplasms	Head Neoplasms	CTD_human_DG	18566236		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	35230891, 9099657	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	10091822, 10841223, 25961010, 38241555, 9099657	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29574918, 29746994		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	30968846	Inhibit	★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	25872592, 28529555		★☆☆☆☆ Found in Text Mining only
Hemangioma, Cavernous	Hemangioma, Cavernous	BEFREE	16859256		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	22568453, 25333252	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	12138400, 15503311, 17041564, 17349740, 18163880, 1868240, 21737576, 22728012, 23257783, 24095849, 24603326, 24706805, 25599133, 26257067, 26567361, 26797417, 27043233, 27582059, 28838268, 28972014, 29061914, 29520705, 29595064, 29707107, 29732004, 29747654, 30012635, 30021909, 30185782, 30185825, 30309889, 30406027, 30428277, 30560933, 30626241, 31313099, 31645677, 31688198, 31801941, 31801952, 8856092, 9408956, 9673385		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	1391959, 1868240, 24516200, 25082878, 25599133, 30185782, 33376097, 33853293, 35058488, 36099249	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	19329714, 30666297, 9156576		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	10498615, 1391959, 15626746, 15690071, 1868240, 21560252		★☆☆☆☆ Found in Text Mining only
Hemorrhoids	Hemorrhoids	BEFREE	17373735		★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	24641288		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	31351363		★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	10209518	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	1375120, 28701032, 29209623, 31158261	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	11167830, 11877309, 16627984, 21281815, 27315061, 30351860	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22951829	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	11023531, 24130824, 32050950	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	10398166, 10874473, 16603448, 17574594, 22275372		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	22202031	Associate	★☆☆☆☆ Found in Text Mining only
Hepatomegaly	Hepatomegaly	Pubtator	17364991	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	19074837, 31465840		★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	27157620, 28035065, 30791947		★☆☆☆☆ Found in Text Mining only
Hereditary Melanoma	Hereditary cutaneous melanoma	BEFREE	11254110		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	15668900		★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	31465739		★☆☆☆☆ Found in Text Mining only
High grade B-cell lymphoma with MYC and/ or BCL2 and/or BCL6 rearrangement	High Grade B-Cell Lymphoma With MYC And/ Or BCL2 And/Or BCL6 Rearrangement	Orphanet			★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	BEFREE	10197582, 11113864, 12217802, 1638027, 29793519, 7599227, 8142617, 8297731, 8432445		★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	CTD_human_DG	26239085, 3287162		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	10583933	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	10463280		★☆☆☆☆ Found in Text Mining only
HMN (Hereditary Motor Neuropathy) Proximal Type I	Hereditary Motor Neuropathy	BEFREE	12722834, 8887956		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10440059, 10564590, 10766396, 10809363, 11150598, 11376869, 11380403, 12966346, 1333273, 1339299, 1342969, 1391959, 1427749, 1433367, 15377339, 15651174, 1602814, 16193090, 1632463, 1656757, 17074584, 1742487, 1742726, 1750500, 18289046, 18628087, 1868240, 1899539, 1916688, 19557638, 2039999, 21767511, 2185367, 2223650, 22827759, 24496723, 24761809, 26182827, 2672827, 28855351, 29644450, 30941572, 31004002, 3287162, 3657890, 7474920, 7475272, 7665145, 7675775, 7691240, 7695015, 7704322, 7742524, 7790991, 7819053, 7827147, 7852186, 7874004, 7914127, 8057670, 8104532, 8148417, 8150454, 8209865, 8218489, 8220113, 8220159, 8238244, 8274737, 8385158, 8388163, 8417786, 8418370, 8434638, 8616030, 9002964, 9021697, 9130623, 9260592, 9276187, 9349231, 9454770, 9665466		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12433696, 1632463, 1750500, 17510532, 17918256, 18758641, 19623262, 30941572, 7531953, 7852186, 8238244, 8274737, 8385158, 8434638	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	16949642, 18940474		★☆☆☆☆ Found in Text Mining only
Holt-Oram syndrome	Holt-Oram Syndrome	BEFREE	21717192		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	10411943, 25311206		★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	12766581, 23887161		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	10574599, 19348791, 23065465, 30558966		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	21808961	Inhibit	★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	23065465, 37216303	Associate	★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole, Partial	Hydatidiform Mole	BEFREE	19348791		★☆☆☆☆ Found in Text Mining only
Hydrocephalus, Normal Pressure	Hydrocephalus	BEFREE	10528654		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	12085205	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	22273152, 24584116		★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	23341540		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	16388709, 29195627, 29516429, 31468244		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	16388709, 23985558	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	31439521		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	9484776		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	Pubtator	10652020	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	14767488, 15188026, 1871110, 30521861, 9626044	Associate	★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperproinsulinemia	Pubtator	22420628	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	33973418	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	35306999	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	10075388		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	10224225, 28176371, 9576088		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	BEFREE	24364474, 26398137		★☆☆☆☆ Found in Text Mining only
HYPERTRICHOSIS, CONGENITAL GENERALIZED	HYPERTRICHOSIS	BEFREE	11095483, 31850162		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	11327614, 26398137		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12173346, 17763440, 23403511, 29484432, 38285930, 40539846	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12663450, 14660675, 15790403, 15987743, 17352240, 18059169, 18670645, 19161638, 19211554, 20668552, 20829524, 21984181, 23289374, 23291726, 24119370, 26914112, 28000962, 30355438, 30739528, 33456577, 33692394, 34435647, 36939902, 37078361, 40500522	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23139748, 23681233	Inhibit	★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Junctional epidermolysis bullosa	Pubtator	34859100	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	12168836, 28386289		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	17596340, 28974252, 29358461		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	17219718	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31407409, 31463128		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	21037114		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	10391670, 14694160, 24621205		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	17474894		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	11034070, 11948143, 15625106, 16916556, 17942898, 20038611, 2543982, 31468517		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30284105, 30607903, 8811935		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	11982494		★☆☆☆☆ Found in Text Mining only
Infantile malignant osteopetrosis	Malignant Osteopetrosis	BEFREE	12086670		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	23218678	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	25437815, 28120341, 29745420, 30515402		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31159239	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	16951220		★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	27209071		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	28482861		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	27593829, 33090383, 37525208	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	28716711		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	18302283	Inhibit	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30138895, 31290273		★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	CTD_human_DG	10223192		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	15492912, 17589896, 22104313	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	24746558		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	CTD_human_DG	10223192		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	15655830	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	34895131, 36248807	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intracranial Hypertension	Intracranial hypertension	Pubtator	32515262	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	16550596		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	15484294, 29434920		★☆☆☆☆ Found in Text Mining only
Intravascular large B-cell lymphoma	Intravascular Large B-Cell Lymphoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	10767354, 12037031		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	31236816		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30230140		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	23225311, 28365474, 31461803		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	32576868	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	30068766		★☆☆☆☆ Found in Text Mining only
Juvenile hemochromatosis	Hemochromatosis	BEFREE	11019838, 8619747		★☆☆☆☆ Found in Text Mining only
Juvenile Neuronal Ceroid Lipofuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	9151319		★☆☆☆☆ Found in Text Mining only
Juvenile Pilocytic Astrocytoma	Astrocytoma	BEFREE	7490615		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10079372, 10662620, 10738139, 11114713, 11687955, 11836434, 17951202, 19117014, 25740993, 28053098, 9012846, 9811747		★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	29948913		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	28926773		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	34478492	Associate	★☆☆☆☆ Found in Text Mining only
Keratocystic Odontogenic Tumor	Keratocystic Odontogenic Tumor	BEFREE	19473442, 22684875, 28489259, 28862228		★☆☆☆☆ Found in Text Mining only
Keratosis	Keratosis	LHGDN	15811121		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	11485911, 14656879, 15858125, 24486291, 8204884, 9414185		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	LHGDN	12036886		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	16388709, 29476712, 30074185, 31474993, 8587248		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	16388709, 17034587, 33551436, 8587248, 8755656	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases Cystic	Kidney disease	Pubtator	14699151	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	10361261, 16620920		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	10361261, 22710204, 28270177, 28688148, 30047127, 30526689, 30976980, 31599006, 31801607		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	23364519, 30643536		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	15357873, 17508219, 17541305, 31187116, 36933996	Associate	★☆☆☆☆ Found in Text Mining only
Laron Syndrome	Laron Syndrome	BEFREE	29208357		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	15928664, 16675913, 18519232, 28455995, 34268937, 35756421	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	10448265, 10942137, 12740649, 12883724, 24297308, 25588854, 27129795, 28770960, 30842155, 31104007		★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	CTD_human_DG	17967740		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disorders	Learning Disorders	CTD_human_DG	17967740		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disturbance	Learning Disorders	CTD_human_DG	17967740		★☆☆☆☆ Found in Text Mining only
Leber Congenital Amaurosis	Leber Congenital Amaurosis	BEFREE	18274907		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	17652152, 25607395, 28483502, 29523174	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma, Epithelioid	Leiomyoma	BEFREE	8834522		★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	10408415, 18382364, 27140314, 29075126, 8834522		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	10408415, 23334251, 27140314	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	LHGDN	15051039		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	25607395, 29653556	Inhibit	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	BEFREE	10408415		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	20964723, 29593724	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10023011, 10233902, 10500813, 10554162, 10652595, 10692673, 11895790, 12142393, 12375054, 12536201, 12631622, 12931228, 1391959, 1427749, 14642526, 14689061, 15060790, 15380515, 15545599, 15716988, 15868938, 15869733, 16166262, 16670263, 16740716, 16966277, 17015828, 17234790, 17252014, 17349740, 18422996, 18633450, 19298593, 19351371, 19684859, 19796711, 20103721, 20367277, 20571027, 21072044, 21151158, 21227398, 21364647, 21427708, 21442307, 21569010, 21593192, 21784872, 21887682, 21940819, 2208117, 22233804, 23092557, 23118966, 23333149, 23393050, 23445492, 23480852, 23880928, 23881917, 24880064, 24952874, 25281403, 26297434, 26338961, 27040706, 27757735, 28074072, 28119366, 28449207, 28578655, 28594323, 28653191, 28717011, 28751770, 28797519, 29431743, 29496539, 29515335, 29698587, 29730189, 29732004, 29899021, 29930300, 30154155, 30185437, 30347215, 30569090, 30601084, 31046873, 31123034, 31293422, 31467227, 31688198, 31764118, 31789392, 7669664, 7811993, 8204892, 8220113, 8611710, 8647513, 8943060, 9160683, 9242431, 9338618, 9408956, 9685703, 9722299, 9989821		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10090946, 10194436, 10552958, 10554162, 11877295, 11895790, 12393493, 12423683, 15868938, 17352239, 17364991, 17603173, 18575824, 19447221, 19535347, 19737931, 20103721, 20401760, 20563668, 20571027, 21364647, 21562047, 21728742, 22016818, 22031455, 22139839, 22184378, 22285729, 23037627, 23333150, 23666368, 23744431, 24099795, 24705122, 25867342, 26238202, 27317766, 28071969, 28209136, 28923920, 28972015, 30934922, 31123034, 3186743, 32782381, 32862612, 33402171, 33924032, 34548471, 34824248, 34861096, 35078224, 35938317, 36585521, 37078252, 37726279, 38201234, 39506897, 40141366, 7684624, 8204892, 8417786, 8427984, 8562940, 8635587, 8943060, 9446661	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	11949843, 12533044, 14689061, 15203866, 18059532		★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	11128872, 1638028, 38440808, 8686741	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Mast Cell	Mast cell leukemia	Pubtator	10072109	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	10648417, 12170773, 15642706, 1638028, 33439746, 34463267, 8025271, 8161792, 8943060	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10233386, 10845930, 12393493, 12417757, 15203866, 15367432, 1536952, 17105820, 17498302, 18160664, 18715689, 20557671, 21595920, 21998731, 23798675, 23955073, 24451410, 24739393, 25308513, 25461257, 25599133, 25714024, 25957891, 26459180, 26801919, 27002764, 27013583, 27166183, 27760321, 29208365, 29218851, 29232547, 30725494, 30773463, 31123034, 31253168, 32392896, 33123685, 33402171, 33596632, 33853293, 33926484, 34024909, 34172833, 34216723, 34244611, 34601571, 35078224, 35185150, 35245447, 35390134, 35634845, 35797463, 35873796, 36099249, 36226498, 36232694, 36455198, 36477735, 36585521, 36892565, 37078252, 37078709, 37726279, 38019903, 38085150, 39570105, 7684624, 8025285, 8916965, 8978298, 9562974, 9716007	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24615181	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	12111784, 15808401	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	25088254, 36098742, 8611710, 9129041	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	10072109, 27157620, 28035065, 30791947		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10023011, 10430080, 10435586, 10482985, 10602414, 10648421, 10692673, 11245018, 11410409, 11726321, 11964319, 11986946, 12139741, 12423683, 14628086, 15339676, 15359646, 1536952, 15642669, 15800708, 15837754, 15972450, 16178036, 16254192, 16730060, 17105820, 17498302, 18160664, 19520430, 20141429, 20484815, 21340723, 21360576, 21595920, 22037714, 22279045, 22728012, 22893484, 23153525, 23359069, 23775716, 23906301, 23955073, 2406517, 24083449, 24346116, 24435446, 24596202, 25461257, 25599133, 25957891, 26045051, 26186940, 26459180, 26552712, 26817437, 27002764, 27013583, 27034925, 27092880, 27283158, 27353420, 27499136, 27797294, 28362701, 28416490, 28619982, 28659338, 28710745, 28751770, 28799432, 28810561, 29136958, 29218851, 29232547, 29232553, 29263915, 29264938, 29291023, 29535553, 29559471, 29927999, 29982865, 30037885, 30185627, 30214012, 30347215, 30361682, 30420752, 30499168, 30572618, 30596398, 30623427, 30626126, 30701031, 30725494, 30773463, 30813354, 30815228, 30959078, 31017486, 31048320, 31048321, 31064851, 31115744, 31118772, 31123034, 31203996, 31222627, 31253168, 31300747, 31301319, 31320594, 31378673, 31593878, 31612056, 31612739, 31628431, 31645677, 31666400, 31688198, 31692757, 31717784, 31756944, 31801941, 31808888, 7628759, 7769841, 8182935, 8642855, 8656695, 8916965, 8943864, 8978298, 9156652, 9168435, 9338618, 9562974, 9592841, 9697835, 9808049, 9865920		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	11964319, 11986946, 15339676		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	23906301		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11042529, 15827331		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	31545280	Associate	★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	12963840		★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	10972347, 26403071, 8697436		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	12953781		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	17641817		★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	12695689		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	12632080, 16254104, 18248353, 20658736, 23060540, 26403071, 31744202		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	23786924	Associate	★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	28045748		★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	28045748		★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple Symmetrical	Lipomatosis	BEFREE	31448050		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	21693658	Associate	★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	8834522		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10453946, 10567879, 10585263, 10617275, 10873563, 11274632, 11431734, 12168872, 12244568, 12404288, 12439925, 12925958, 15289866, 15566504, 15586245, 16332177, 16452234, 16807152, 16926629, 17303011, 17440069, 17516030, 17574594, 17589894, 17934815, 18842498, 19026166, 19054267, 20014456, 20347499, 20502916, 20515870, 20647330, 20811683, 21336967, 21656028, 21748764, 21771706, 21829603, 21916504, 22037880, 22262416, 22275372, 22292626, 22382024, 22472110, 22575016, 23015317, 23613111, 23862748, 24065086, 24571452, 24976294, 24985939, 25173640, 25333670, 25492486, 25557723, 25915649, 26201988, 26348206, 26416455, 26575170, 26707143, 26884845, 27634758, 27699664, 27873035, 28032603, 28333141, 28445151, 28472789, 28481473, 28565839, 28611265, 28731137, 28876084, 28941178, 28983625, 29208281, 29286113, 29287727, 29299170, 29576713, 29682179, 29693750, 29719405, 29749500, 29854577, 29898413, 30008820, 30146257, 30255547, 30316787, 30445021, 30539696, 30539830, 30753820, 30782845, 30810974, 30887612, 30925457, 30930224, 30931701, 30977498, 31129132, 31211520, 31409969, 31605713, 31804459, 9934751		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12439925, 15633216		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	20627094, 9934751		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	11457875	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	CTD_human_DG	23274713		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases	Liver disease	Pubtator	16423888	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	28876364	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	8564847		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10449034, 10453946, 10617275, 11212255, 12244568, 16210911, 16926629, 17574594, 20811683, 21656028, 21771706, 22275372, 22293115, 22414765, 22472110, 25077527, 27873035, 28497394, 29576713, 29854577, 30578377, 30977498		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	8129031	Associate	★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	BEFREE	10651227		★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	26497387	Associate	★☆☆☆☆ Found in Text Mining only
Low Grade Lymphoma (neoplasm)	Low Grade Lymphoma	BEFREE	11014890, 2196779, 2249841, 7515650, 7706514		★☆☆☆☆ Found in Text Mining only
Low Grade Lymphoma (neoplasm)	Low Grade Lymphoma	CTD_human_DG	26239085, 3287162		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	12833466, 30941978	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	25895534		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	30843876, 9039233	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	30843876		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10063313, 10896673, 11054026, 12421819, 15210690, 15753661, 17091766, 18483303, 19878573, 22316209, 22665367, 23792636, 23894143, 23977251, 24289612, 25066397, 25301444, 26134408, 26491047, 26647102, 27356570, 29459573, 30078010, 31150457, 34967707, 36677964, 37984526, 38242344, 7599047, 8393963, 8774138, 9671482	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	10937049, 19712747, 22904681		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15489891, 15965276, 16982461, 17091766		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	11979072, 25516752, 27159593		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17034587, 19423430, 26617807, 34044633, 39366755	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17162369, 9822266	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18507053, 9251841	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Cutaneous	Lupus Erythematosus	BEFREE	9650694		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	25516752, 27159593		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10643707, 10652595, 11196685, 1523845, 18275831, 1924327, 19596183, 25516752, 27159593, 28254841, 28691866, 29333561, 30458319, 30536399, 31541431, 7840854, 7945466, 8893377, 9010506, 9041943, 9550468, 9822266, 9856487, 9884094		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	12133494		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	17034587, 37102641	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	27159593, 29568865, 8587248		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	8587248	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	25516752, 27159593		★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	BEFREE	31181104		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	14669273, 15274378, 16080576, 16101192, 17477770, 19385591, 20691103, 22038216, 23955799, 24228120, 24741635, 25066397, 25840688, 28106544, 36374147	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21861179	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21936874, 34257544	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28672935		★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	11014890		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	12931228, 15380515, 21486225, 8220113		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10193514, 10193956, 10219790, 10233417, 10319386, 10350331, 10414499, 10505771, 10634643, 10781680, 10782887, 10941341, 11050805, 11106080, 11207828, 11389033, 11431360, 11471486, 11747333, 12136520, 12138400, 12142393, 12169673, 12217802, 12353944, 12529680, 12692620, 12826880, 12953811, 1339299, 1373316, 1391959, 1419624, 1493447, 15083809, 15143340, 15354733, 15566355, 15634664, 15676141, 15713621, 15716988, 15761769, 15770300, 1581586, 15880597, 15986398, 16186795, 16373664, 1638027, 16670080, 16680749, 17043638, 1713514, 17182178, 1742726, 17525724, 1757070, 17601964, 17632527, 18089500, 1824261, 18316580, 18375822, 18538438, 18556402, 18633450, 1868240, 18695675, 1884022, 18945749, 1900270, 1909295, 1916688, 19363496, 19372563, 1940802, 1951637, 1951841, 19597184, 19838161, 19922301, 1992441, 20032416, 20232134, 2039999, 20691570, 20845810, 21119107, 21366462, 21491965, 21502424, 21560251, 21606958, 2185367, 2189291, 21988644, 22002575, 2201196, 22035756, 2207314, 2208029, 22155272, 22194861, 22484426, 2252103, 2263590, 22929980, 23330001, 23363648, 23892979, 24179151, 24232982, 24786774, 2503246, 2506953, 2509518, 25103070, 25199984, 25303368, 2543982, 25452615, 25529575, 25549806, 25625359, 25827211, 25828389, 25908172, 26158410, 26182827, 26239085, 26366712, 2651903, 26545844, 26616222, 26657288, 26717387, 26892631, 26962682, 27043233, 27055871, 27134111, 27391453, 27406984, 27543313, 27717585, 27913503, 2834197, 28449207, 28566329, 28578655, 28614202, 28627620, 28844114, 28855351, 28868942, 29115462, 29310838, 29335468, 29339775, 29629947, 29722657, 29732004, 29765528, 29785017, 29899382, 29902576, 30043475, 30205047, 30458319, 30496802, 30523053, 30601084, 30679328, 30682070, 30734478, 30779087, 31039827, 31103719, 31189479, 31205561, 31288832, 31688198, 31785002, 3287162, 3500184, 3657890, 7474920, 7539660, 7565870, 7605982, 7675775, 7694006, 7698223, 7704322, 7706514, 7727781, 7730485, 7734714, 7819053, 8045522, 8084613, 8104532, 8106752, 8111048, 8208268, 8214264, 8220113, 8244494, 8252486, 8270971, 8371594, 8381174, 8422456, 8426481, 8449825, 8555494, 8558921, 8622046, 8624457, 8647513, 8695812, 8703825, 8729986, 8798441, 8842514, 8850247, 8852399, 8867581, 8951602, 8958800, 8972474, 9029764, 9031112, 9113013, 9169090, 9184180, 9209398, 9235968, 9242549, 9260592, 9276187, 9349233, 9378470, 9408956, 9573034, 9573674, 9626207, 9631583, 9680371, 9685703, 9705131, 9713967, 9787151, 9949180		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	11167744, 11600428, 11747333, 12406872, 1376556, 1419624, 14726400, 1498325, 15143340, 15543568, 15713621, 16373664, 1638027, 1638028, 18575824, 18633450, 18645192, 1868240, 18695675, 1884022, 18945749, 19106104, 19223368, 1940802, 1951637, 19535347, 19597184, 20032416, 20118770, 20563668, 21103627, 21123968, 21224472, 21560251, 21560252, 21628860, 21772052, 22041376, 22929980, 23171647, 23341189, 23600716, 23995111, 24179151, 24625454, 24943107, 2506953, 25076300, 2509518, 25103070, 25446254, 25452615, 25549806, 25590803, 25612555, 25817328, 25908172, 26158410, 26430964, 26565895, 26717387, 26834242, 27419806, 27523007, 27739436, 28061782, 2834197, 28771100, 28776574, 28855351, 29793519, 30181564, 30348671, 30523053, 30523719, 30707764, 30918199, 31127909, 31171907, 31189479, 31288832, 31315646, 31752970, 31805190, 32216817, 32273477, 32311849, 32334477, 32362635, 32497402, 32664092, 33245769, 33530253, 33551436, 33560380, 33569544, 33591648, 33768318, 33786907, 34105893, 34304248, 34608246, 34632715, 34707037, 3500184, 35482553, 36167829, 36934096, 37147953, 37198234, 37475138, 37566004, 38049665, 38280422, 38460675, 38468555, 39843653, 39905397, 40651974, 7579411, 7605982, 7681257, 7682708, 7684624, 7706514, 7727781, 7730485, 7819053, 8111048, 8297731, 8449825, 8555494, 8878455, 9037360, 9109380, 9184180, 9235968, 9368670, 9680371, 9754175, 9787151	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	11804283, 12032828, 12217802, 12970736, 14724650, 15716988, 17652637, 18073527, 18228020, 18538438		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	11929754, 29785017	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	10193514, 10216105, 10233841, 10362812, 10452515, 10498595, 10555759, 10583231, 10828038, 10961899, 11435322, 11756183, 11781262, 11964306, 12036852, 12139744, 12169673, 12169675, 12433696, 12529293, 12580956, 12701113, 12930384, 12962724, 12967475, 1374590, 1375120, 1376556, 1402658, 14614322, 14681948, 14717779, 14767488, 1485535, 1497088, 15300917, 15507680, 15543568, 15578884, 15623489, 15669024, 16056251, 1638027, 16487175, 16680749, 16799206, 16835385, 16939500, 17138820, 17157165, 17200714, 1730093, 17387393, 17408460, 17510532, 17652637, 18344536, 18500267, 18622426, 18633450, 18636259, 1868240, 18682601, 18830125, 1884022, 18945749, 19120369, 19471018, 19537891, 19549844, 19597184, 19838161, 19965626, 20032416, 20880994, 21103627, 21224472, 21227398, 21240256, 21375524, 21497287, 21956856, 21960592, 2201196, 22381682, 2242428, 2263642, 22686190, 22855608, 23263985, 23359021, 24048795, 24232867, 24677543, 24767771, 2480713, 2511176, 25194535, 25279986, 25303368, 25362242, 25400800, 25452615, 25549806, 25713363, 26437030, 2644990, 2672827, 2682663, 26965583, 2704746, 2713505, 27513891, 27730341, 27748813, 28038709, 28247997, 28419517, 28765546, 29162844, 2965608, 29793519, 30012920, 30322385, 3140914, 31776129, 31844144, 32713346, 33233721, 33742718, 33768318, 33786907, 34788985, 3547408, 35622324, 35661922, 35816682, 36575003, 36939219, 36994552, 37193683, 37439703, 37563306, 38460675, 39843653, 7655018, 7797601, 7856728, 8063612, 8111048, 8203460, 8417783, 8417785, 8422456, 8434638, 8541563, 8633098, 8878455, 8916960, 9160682, 9218729, 9257881, 9414291, 9432035, 9531330, 9531606, 9665466, 9763572	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	27283896	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma, Diffuse	Lymphoma	BEFREE	1632463, 1868240, 8494725		★☆☆☆☆ Found in Text Mining only
Lymphoma, Diffuse	Lymphoma	CTD_human_DG	26239085, 3287162		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	10102615, 10193514, 10193956, 10214868, 10216105, 10233841, 10362812, 10414499, 10555759, 10564590, 10583231, 10629043, 10653868, 10707796, 10766396, 10781680, 10800988, 10825742, 10828038, 10941341, 10961899, 10995001, 11050805, 11106080, 11120335, 11144922, 11172955, 11208834, 11318606, 11385316, 11431360, 11435322, 11567225, 11571709, 11753646, 11781262, 11877266, 11911399, 11948143, 11949845, 11950920, 11964306, 12036852, 12139744, 12169673, 12169675, 12200703, 12217802, 12399977, 12405909, 12406872, 12409722, 12411590, 12430874, 12529293, 12580956, 12613529, 12665842, 12691144, 12742158, 12826880, 1286168, 12953811, 12959349, 12962724, 1312610, 1342952, 1342969, 1373320, 1375120, 1402658, 14508797, 14583460, 14681948, 14717779, 14732921, 14736281, 14738153, 14757440, 14767488, 1497088, 15032666, 15041219, 15101720, 15166666, 15277222, 15470494, 15474153, 15500654, 15507680, 15540893, 15561778, 15623489, 1562738, 15637137, 15676141, 15682435, 15700138, 15714059, 15770300, 15815725, 15875184, 15880597, 15894921, 1591003, 15948125, 15988007, 16019487, 16056251, 16150641, 16155020, 16191511, 16194898, 16228048, 16297448, 1638027, 16519699, 16530831, 16625101, 16647949, 16704964, 16793349, 16847683, 16918969, 17039231, 17074584, 17134735, 17138820, 17149654, 17200714, 17295647, 1730093, 1733447, 17438702, 17519619, 17601964, 17652637, 1766674, 17699855, 17964648, 1797086, 17981218, 18055344, 18089500, 18203018, 18272816, 18500267, 18622426, 18628087, 18633450, 18636259, 18656237, 18665753, 1868240, 18684042, 18687756, 18755498, 18830125, 18945749, 1899478, 1906343, 19065102, 1909295, 19120369, 19194277, 1923524, 19351371, 19369624, 19412639, 19471018, 19537891, 19549844, 19597184, 19679882, 19838161, 19858392, 19965626, 20032416, 20231612, 20331331, 20350212, 20368567, 20498406, 2072740, 20736747, 20880994, 20952062, 2106002, 21083019, 21103627, 21184290, 21227398, 21366462, 21497287, 21502424, 21606958, 21658611, 21658612, 21659362, 21771030, 2181381, 2185367, 21855110, 21875318, 21960592, 21997689, 2201196, 22052344, 2208029, 22189900, 22194861, 2223650, 22381682, 22406486, 2242428, 22431543, 22480571, 2263642, 22686190, 22827759, 22855608, 22968395, 23023713, 23263985, 23359021, 23509938, 23631722, 23642737, 23916290, 2394439, 24048795, 24071012, 24095849, 24496723, 24634383, 24677543, 24778012, 24913233, 2511176, 25279986, 25303368, 25384217, 2538824, 25452615, 25549806, 25696794, 25827952, 25862812, 25953460, 26049761, 26115875, 26239087, 26307535, 26437030, 2644990, 2648153, 26621338, 26641257, 26658664, 26725534, 2682663, 27134111, 2713505, 27203548, 27297871, 27513891, 27544800, 27661108, 27730341, 27748813, 27995457, 28038709, 28095352, 28247997, 28419517, 28594133, 28640838, 28653191, 28765546, 28824170, 28855351, 28873356, 28984304, 29217426, 29246583, 29310838, 29636326, 2965608, 29666116, 29720207, 29793519, 29963140, 29974035, 30037885, 30213394, 30255584, 30322385, 3034807, 30360879, 30456840, 30523716, 30609603, 30693983, 30874346, 30931307, 31092372, 31385309, 3140914, 31631728, 31789408, 31791624, 31844144, 3186743, 3287162, 3325884, 3547408, 3874430, 7612233, 7666311, 7675775, 7682098, 7691932, 7694006, 7695015, 7698223, 7734714, 7774892, 7777475, 7795171, 7835896, 7856728, 8019967, 8063612, 8111048, 8118601, 8209865, 8252486, 8274734, 8274737, 8278571, 8280621, 8383256, 8414508, 8417783, 8417785, 8426481, 8449825, 8461469, 8528964, 8535216, 8541563, 8552577, 8616030, 8619747, 8621189, 8667654, 8700536, 8729985, 8826892, 8826897, 8838329, 8847894, 8856092, 8916960, 8943893, 8971381, 9098644, 9156576, 9160682, 9209654, 9218729, 9223330, 9276187, 9349233, 9414291, 9531606, 9551917, 9573674, 9643573, 9713967, 9763572, 9785006, 9815675, 9827925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, Follicular	Lymphoma	LHGDN	11877266, 12036852, 15561778, 16194898, 16215945, 18055344, 18622426		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, Follicular	Lymphoma	CTD_human_DG	12855623, 3287162		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, Follicular	Lymphoma	ORPHANET_DG	22684552, 23953419		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, Follicular, Grade 1	Lymphoma	CTD_human_DG	12855623, 3287162		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular, Grade 1	Lymphoma	BEFREE	1643614, 7981893		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular, Grade 2	Lymphoma	CTD_human_DG	12855623, 3287162		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular, Grade 2	Lymphoma	BEFREE	21855110		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular, Grade 3	Lymphoma	CTD_human_DG	12855623, 3287162		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular, Grade 3	Lymphoma	BEFREE	18925696, 23916290		★☆☆☆☆ Found in Text Mining only
Lymphoma, Intermediate-Grade	Intermediate Grade Lymphoma	CTD_human_DG	26239085, 3287162		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	10784396, 17408400, 18665753, 18925696, 19537891, 23916290, 25807917, 30693983, 8449825, 8555066, 9020305, 9209369, 9276187, 9408956		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	CTD_human_DG	12855623, 3287162		★☆☆☆☆ Found in Text Mining only
Lymphoma, Mixed-Cell	Lymphoma	CTD_human_DG	26239085, 3287162		★☆☆☆☆ Found in Text Mining only
Lymphoma, Mixed-Cell	Lymphoma	BEFREE	2648153		★☆☆☆☆ Found in Text Mining only
Lymphoma, Mixed-Cell, Follicular	Lymphoma	CTD_human_DG	12855623, 3287162		★☆☆☆☆ Found in Text Mining only
Lymphoma, Mixed-Cell, Follicular	Lymphoma	BEFREE	21855110		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	10074891, 10631864, 10700860, 10784621, 10794603, 10873104, 11679800, 14757440, 15077178, 15611930, 15651174, 15770300, 15784299, 15939340, 1638028, 1643614, 16796775, 17408400, 17438702, 1747446, 1757070, 18929412, 19537891, 20232134, 20352431, 20855536, 2189291, 2249898, 23932423, 24024471, 24267052, 2509518, 25590803, 25656914, 25807917, 26239085, 27049262, 28095146, 2840989, 29067124, 2965608, 29666304, 30693983, 30850381, 3287162, 7632955, 7723399, 7954347, 7981893, 8270971, 8297731, 8528964, 8547651, 8555066, 8558921, 8574164, 8667654, 8703825, 8704213, 9020305, 9113013, 9207459, 9209369, 9209377, 9260592, 9276187, 9331562, 9349233, 9373196, 9408956, 9414302, 9443038, 9454770, 9655306		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	11855781		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	CTD_human_DG	26239085, 3287162		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	10074891, 10784621, 10873104, 14757440, 15611930, 15651174, 15784299, 16796775, 17408400, 17438702, 1747446, 1757070, 18929412, 19537891, 20352431, 2249898, 23932423, 24024471, 2509518, 25656914, 25807917, 27049262, 2965608, 29666304, 30693983, 3287162, 7632955, 7723399, 7954347, 8270971, 8297731, 8528964, 8555066, 8558921, 8574164, 8704213, 9020305, 9113013, 9209369, 9260592, 9276187, 9331562, 9349233, 9408956, 9443038		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	CTD_human_DG	26239085, 3287162		★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Cleaved-Cell, Follicular	Lymphoma	CTD_human_DG	12855623, 3287162		★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Cleaved-Cell, Follicular	Lymphoma	BEFREE	1643614, 7981893		★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Noncleaved-Cell	Lymphoma	BEFREE	1311213		★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Noncleaved-Cell	Lymphoma	CTD_human_DG	26239085, 3287162		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	11675351, 12754746, 15377339, 16088151, 18496567, 19074726, 20127862, 28972015, 30018745, 31167801, 8106752		★☆☆☆☆ Found in Text Mining only
Lymphoma, Undifferentiated	Lymphoma	CTD_human_DG	26239085, 3287162		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	28973148		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	10655273, 11034070, 12720128, 12738752, 15242877, 15784299, 2201196, 2263590, 24496723, 25429725, 27813533, 8050191, 8111048, 8401180, 8555494		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	11877309, 15846077, 16803564, 22868923, 36375119, 8089211, 8111048, 8555494	Associate	★☆☆☆☆ Found in Text Mining only
Lysinuric Protein Intolerance	Lysinuric Protein Intolerance	BEFREE	22403019		★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	19107326		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	10826666		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	24321200, 29633502, 31160908		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	16302851	Associate	★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Malformation of cortical development	LHGDN	18594472		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10764042, 10825522, 13130506, 15048678, 15332326, 17924059, 20587533, 21846680, 26109525, 7539458, 9562325, 9872414		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	10567901, 10628333, 10766395, 11751518, 19724896, 21110823, 23479508, 23734725, 25604244, 9891541		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	CTD_human_DG	18566236		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma - lymphocytic, intermediate differentiation	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	1643614, 2263590, 8172819		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	10452515, 11781220, 1643614, 18375822, 19965626, 2263590, 25797245, 26517511, 27157620, 28950661, 29590547, 29912596, 31004002, 31085176, 8172819, 8852399		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	18375822		★☆☆☆☆ Found in Text Mining only
Malignant melanoma of choroid	Choroidal melanoma	BEFREE	15577317		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	11135160, 19815709, 31119375		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	16850164		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of adrenal cortex	Adrenocortical carcinoma	BEFREE	12490850		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	26467103		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10426394, 10472781, 10480445, 10481938, 10492630, 10496350, 10504548, 10519395, 10542244, 10567899, 10597263, 10604474, 10732789, 10733592, 10738245, 10744622, 10754491, 10800077, 10926327, 11029800, 11044356, 11051254, 11078910, 11108890, 11110054, 11110059, 11275791, 11289122, 11440404, 11469882, 11496308, 11712792, 11747334, 11803466, 11855753, 11994759, 12115876, 12138400, 12140755, 12145573, 12172977, 12174951, 12186376, 12209955, 12452453, 12460791, 12462383, 12543781, 12553494, 12607598, 12631622, 12632082, 12676065, 12680147, 12835724, 12929741, 14607338, 14613035, 14647416, 14666386, 14981916, 15026618, 15152946, 15168338, 15177426, 15578079, 15770521, 16228292, 16280040, 16331604, 16556548, 16636671, 16647810, 16818519, 16874058, 17203189, 17288732, 17352236, 17372162, 17430582, 17447168, 17612393, 17629615, 17666167, 17678531, 17786319, 17908970, 18381443, 18424910, 18428028, 18454859, 18510726, 18661356, 18849663, 19031258, 19035283, 19148464, 19390941, 19440893, 19605509, 19711341, 19800779, 19863221, 19881545, 20023705, 20062536, 20068093, 20119576, 20514538, 20564196, 20679739, 20691103, 20841355, 21204604, 21258408, 21383694, 21399894, 21457555, 21622563, 21680733, 21710341, 21861179, 21899728, 21953021, 22037783, 22109882, 22320961, 22362301, 22418857, 22467215, 22553917, 22623155, 22703841, 22961366, 23054396, 23138847, 23174100, 23315866, 23317270, 23358890, 23395885, 23415863, 23441615, 23621182, 23631820, 23705845, 23760062, 23861345, 23991978, 24075827, 24155182, 24190517, 24272202, 24272208, 24276280, 24335172, 24909179, 24971890, 25078617, 25179840, 25292288, 25374001, 25409124, 25416050, 25616695, 25648135, 25682076, 25784482, 26082034, 26099171, 26191195, 26257067, 26339338, 26359357, 26472348, 26530780, 26662799, 26812869, 26812885, 26921175, 27390258, 27517917, 27596816, 27613092, 27771839, 27998789, 28025102, 28039357, 28123543, 28230534, 28301598, 28373418, 28378131, 28382095, 28413418, 28430743, 28475922, 28479725, 28482576, 28655658, 28701032, 28713975, 28739740, 28801774, 28939105, 28959140, 28993998, 29202620, 29254147, 29312798, 29339815, 29343814, 29423411, 29496539, 29501042, 29844816, 29855616, 29876007, 29899841, 30021371, 30069746, 30246261, 30315250, 30374681, 30570350, 30625226, 30631150, 30635657, 30728358, 30776589, 30824486, 30962322, 31109399, 31155753, 31236965, 31289309, 31404252, 31448050, 31454538, 31494078, 31583572, 31595181, 31603120, 31605603, 31649548, 31673827, 31698596, 31777591, 31825969, 7640218, 7833141, 7896458, 7915536, 8133533, 8174112, 8286195, 8520001, 8621251, 8622078, 8647960, 8690514, 8729986, 8777167, 8822113, 8895551, 9150188, 9253035, 9306577, 9413034, 9514059, 9605757, 9695733, 9815631, 9815973, 9816145, 9886853, 9891509		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	12517783, 16954440, 23621182		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	11420706, 12217750, 12469199, 15721399, 16012738, 19160418, 21618512, 22343305, 23637776, 30168854, 30537101		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	10778992, 11299823, 17561354, 20378992, 20676910, 22187149, 22502669, 24606472, 25816175, 28441715, 28760343, 30197671, 30213293, 31452796, 31789385, 8797876		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	21472143		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	CTD_human_DG	16904648		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	24329682, 24756644, 28256505, 28766687		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	15961081, 29724653		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	15357873, 19539330, 25833690, 26406868		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	15036664, 17557568, 27129795, 29085504		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	10567879, 11382922, 17589894, 21829603, 25173640, 26783238, 27942213, 28731137, 30675310, 31289468		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10063313, 10873111, 11123426, 12414660, 12768189, 12838300, 15210690, 15217967, 15342407, 15527763, 15753661, 16231322, 16311913, 18172305, 18852117, 18927282, 19097992, 19372563, 19654003, 21258880, 23108890, 23276293, 23339680, 23358890, 23496232, 23588221, 23719266, 23867991, 23894143, 23959540, 23977251, 24521149, 24675361, 25066397, 25424357, 25857361, 26325180, 27083050, 27088439, 27268917, 27744185, 27896589, 28270083, 28432456, 28454469, 28514759, 28606806, 29045843, 29118061, 29459573, 29788725, 29899843, 30195756, 30249026, 30378152, 30725416, 31083279, 31150457, 31221478, 31485626, 31572459, 7763030, 8620509, 8630278, 8679221, 9508209		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	12632080, 16254104, 19009587, 20658736, 22873792, 23060540, 26403071, 31744202		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	16299246, 17020977		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	20233885, 25380690		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10480447, 10646901, 11094305, 11295035, 11720475, 15156398, 15505422, 16166319, 16785787, 18056200, 18334006, 19148468, 20082279, 22294191, 23579097, 23962558, 25672608, 25862909, 27277143, 27748803, 28188387, 29062236, 29952351, 30548372, 30718431, 7478541, 8616869, 8972757		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11668508, 12065845, 12189556, 16099798, 16357180, 17378914, 17960583, 18528859, 18829553, 19318573, 19908231, 19966835, 20224296, 20579221, 20646298, 21376256, 21605072, 22939115, 23245210, 24534203, 25751501, 25880226, 26077929, 26506422, 26676634, 30155839, 30192158, 30267303, 30359541, 30545600, 31467029, 31602160, 9863489		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10190792, 10325496, 10446452, 10533903, 10884916, 10945499, 11019784, 11085527, 11275990, 11571575, 11704864, 11745446, 11751483, 11776759, 11920957, 12019181, 12170775, 12170776, 12188882, 12242728, 12496485, 12629413, 12644474, 12664070, 12821128, 12907654, 14719096, 14765130, 14965337, 15124003, 15174974, 15202013, 15256454, 16015611, 16331261, 16520381, 16686729, 16733517, 16984224, 17062688, 17085199, 17237270, 17503439, 17545625, 17575222, 17678531, 18475287, 18842418, 19050681, 19117992, 19153211, 19237173, 19495772, 19576799, 19593445, 19737977, 20146885, 20464497, 20519142, 20577262, 21207420, 21555367, 21681193, 21785821, 22024950, 22278289, 22766626, 23073173, 23160675, 23612742, 23726840, 24040105, 24220327, 24349321, 24666255, 24980820, 25053345, 25177836, 25333266, 26189652, 26934861, 27082738, 27519795, 28109198, 28376214, 28396899, 28816549, 28868037, 29022918, 29200739, 29316844, 29362360, 29392925, 29526801, 29949147, 30197674, 30297390, 30453074, 30637800, 31494078, 8204007, 8532388, 8996359, 9090501, 9232607, 9413164, 9514052, 9598502, 9609635, 9836559, 9842970, 9852630, 9989812		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	16733517		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	19035317, 25436837, 26599548, 30599074, 9158413		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10333765, 11535962, 11692156, 12508351, 12811476, 18063429, 18167184, 18709484, 18751407, 19160045, 20664977, 21072904, 22277792, 22328012, 23152059, 23201009, 23317885, 24515389, 24815437, 25322930, 26172537, 26292288, 27792037, 28662697, 29344114, 30242876, 30479464, 30747219, 30792218, 30866865, 31036603, 31205469, 31333785, 31364281, 7478596, 7676688, 8063611, 8729986, 9891543		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	9524567		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	17848408, 31786883		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11391617, 11490306, 12081782, 16009487, 16484005, 18342927, 18751404, 20620593, 22797576, 23083854, 23621258, 23790536, 24595931, 26427661, 26653553, 26743236, 30806186, 31118765, 8608975, 9484785, 9507882, 9625842, 9817315		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10342667, 10361261, 10362119, 10419903, 10456279, 10567901, 10597263, 10628370, 10652595, 10666369, 10741751, 10766395, 10782407, 10785478, 10825522, 10850359, 10873111, 10873619, 11034070, 11128612, 11259472, 11299811, 11299823, 11389033, 11396172, 11487260, 11547047, 11571630, 11571724, 11751483, 12168836, 12168872, 12244568, 12375054, 12428798, 12527909, 12529680, 12628337, 12662143, 12663733, 12720156, 12783122, 12787138, 12953781, 13130506, 14510186, 14624621, 14654538, 14726817, 14767546, 14981916, 15083809, 15217956, 15377339, 15380515, 15503311, 15520176, 15540893, 15583826, 15585172, 15634664, 15744499, 15784299, 15799240, 15826766, 15832769, 15841044, 15842635, 15958612, 15979837, 15988007, 15994927, 1602814, 16054293, 16080514, 16150641, 16210911, 16243795, 16304385, 16322756, 1638028, 16409295, 16450387, 16531274, 16540632, 16647810, 16686729, 16916556, 16923617, 16990509, 17018621, 17041564, 17145812, 17172711, 17182178, 17200714, 17283155, 17325632, 17381350, 17426248, 17545625, 17561354, 1757070, 17653717, 17848408, 17942898, 18160396, 18163880, 18199533, 18289046, 18342927, 18357521, 18381408, 18431543, 18442057, 18458532, 18638457, 18807035, 18842418, 18844453, 19043450, 19056433, 19156528, 19196738, 19298593, 19383915, 19401626, 19459857, 19576799, 19631957, 19676053, 19729336, 19730103, 19818735, 19824041, 19834492, 19922301, 19940548, 20112357, 2011401, 20145039, 20146885, 20224296, 20349264, 20394737, 20514538, 20658736, 20691103, 20699221, 20800695, 21076048, 21103627, 21152697, 21159778, 21186059, 21192992, 21207420, 21304176, 21315822, 21364647, 21415859, 21427708, 21444803, 21556123, 21618512, 21638208, 21659544, 21704150, 21751259, 21772052, 21887682, 21981718, 21997189, 22002102, 22024950, 22075983, 22078414, 22173547, 22174613, 22275115, 22293115, 22311987, 22340335, 22366560, 22430213, 22446832, 22562364, 22609401, 22629368, 22649144, 22664385, 22688594, 22830613, 22939115, 23023732, 23108890, 23135004, 23139748, 23173842, 23201009, 23317270, 23341456, 23392177, 23415863, 23478333, 23681227, 23719266, 23723123, 23734725, 23788110, 23792648, 23826359, 23848203, 23966347, 23977251, 24083449, 24095849, 24236538, 24268771, 24469836, 24521149, 24561528, 24603326, 24607549, 24660968, 24739390, 24768714, 24780492, 24786774, 24870742, 24994123, 25090024, 25192188, 25257838, 25301449, 25333301, 25409302, 25416050, 25426641, 25430556, 25437815, 25471003, 25486070, 25590803, 25598309, 25645920, 25648135, 25650136, 25741600, 25758528, 25769455, 25784482, 25801037, 25826088, 25860620, 25893290, 25895919, 25912824, 25947358, 25970424, 26008974, 26132559, 26134786, 26179996, 26205817, 26235741, 26257067, 26307351, 26311051, 26320497, 26324021, 26403071, 26416353, 2642578, 26474854, 26513239, 26556865, 26585505, 26662799, 26691328, 26694352, 26795575, 26797417, 26822577, 26823739, 26939706, 26945444, 27069256, 27159560, 27277143, 27343252, 27499136, 27535975, 27543313, 27557932, 27613092, 27749061, 27757735, 27771839, 27773673, 27805565, 27806433, 27810438, 27998789, 28026162, 28056525, 28079887, 28094768, 28102286, 28112863, 28166401, 28187375, 28209992, 28212732, 28233676, 28331288, 28368610, 28382095, 28396899, 28445963, 28449207, 28455421, 28504908, 28510570, 28516063, 28522750, 28586716, 28647470, 28662697, 28670929, 28676391, 28698145, 28701032, 28714374, 28714472, 28735187, 28739740, 28741496, 28768804, 28784769, 28801774, 28823845, 28851813, 28866374, 28902204, 28943305, 28943900, 28945232, 28984869, 29027832, 29061914, 29063678, 29099483, 29146569, 29156646, 29188305, 29197725, 29207009, 29218851, 29232547, 29254309, 29259008, 29332353, 29332355, 29405977, 29439531, 29463109, 29498802, 29499131, 29520705, 29559471, 29570632, 29596889, 2965608, 29674644, 29690766, 29698587, 29732004, 29747654, 29765528, 29769323, 29770817, 29797573, 29805590, 29846950, 29856104, 29899841, 29927992, 29935090, 29958837, 30003455, 30016386, 30037885, 30047840, 30053503, 30138565, 30158527, 30170927, 30185825, 30194150, 30207247, 30214012, 30308410, 30347215, 30382596, 30469054, 30481055, 30510014, 30537511, 30538285, 30544835, 30578377, 30613863, 30618284, 30635584, 30659540, 30666297, 30668936, 30681073, 30706824, 30731458, 30747218, 30753820, 30790641, 30792387, 30842155, 30860026, 30986908, 31019203, 31028992, 31052354, 31057406, 31110129, 31129454, 31143550, 31154862, 31200834, 31205561, 31209350, 31252679, 31292507, 31303271, 31313099, 3131717, 31450709, 31456420, 31490001, 31491872, 31494078, 31501195, 31543463, 31579427, 31581912, 31614111, 31662966, 31670197, 31676306, 31729219, 31754664, 31766723, 31772331, 31825969, 31827241, 7478600, 7490615, 7539458, 7565870, 7632062, 7632955, 7669664, 7727781, 7734290, 7743552, 7768985, 7772249, 7777475, 7825961, 7954347, 8025271, 8025526, 8084613, 8207614, 8324219, 8380056, 8546897, 8547403, 8548734, 8555494, 8597045, 8613014, 8617450, 8647960, 8729986, 8752171, 8825412, 8867581, 8917716, 9148853, 9185911, 9187226, 9253035, 9338618, 9341939, 9378470, 9395285, 9408956, 9522213, 9531611, 9592841, 9613987, 9652797, 9829760, 9863489		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	26146864, 30478285		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	9891541		★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	9524567		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	10999751, 11198267, 15361203, 15832769, 17098279, 19940548, 20213048, 20213509, 21704150, 22160209, 23588620, 24634186, 24782650, 26474854, 26681053, 27177038, 27261616, 27677077, 28246354, 28615991, 29318915, 29336659, 30509141, 30552693, 30599894, 31093891, 31579427, 9162297		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	10223192, 17404573, 19147571		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10612539, 10824932, 11052631, 11355956, 11920608, 12149448, 12269390, 12423325, 15314290, 15955446, 17278191, 17426704, 17534896, 19027288, 20409521, 22570942, 25385144, 25548100, 26697569, 27845068, 28782841, 29394130, 29416778, 29656061, 29669301, 30535479, 30806395, 31011292, 31497237, 9349233		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	21818634	Associate	★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	12517783, 16954440, 23621182		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10567899, 11051254, 12576925, 14613035, 16030101, 16484003, 17452420, 17629615, 18928543, 18953692, 19605509, 19711341, 21174060, 24098377, 24971890, 25416050, 26559373, 27693049, 29280311, 29343814, 29499219, 29986606, 30521787, 30962322, 9514059		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12112824, 12140755, 12197771, 12209955, 12400004, 12835724, 14647416, 15545228, 16638854, 17252199, 17372162, 17666167, 17908970, 18006836, 18158619, 18430249, 18510726, 18998362		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	12517783, 16954440, 23621182		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	12517783, 16954440, 23621182		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	10319386, 10361135, 10452515, 11468180, 11781220, 12472567, 1643614, 18375822, 18524848, 19821820, 19965626, 20490333, 2263590, 23580240, 24071012, 24457957, 25797245, 26517511, 27157620, 28035065, 28295185, 28296749, 28950661, 29034364, 29296874, 29590547, 29666304, 29912596, 30791947, 31004002, 31085176, 31425695, 8172819, 8852399, 9359515		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	11298531, 12560219, 12826880, 1643614, 21502424, 30213394		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	12937123		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	LHGDN	12937123		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	12937123	Stimulate	★☆☆☆☆ Found in Text Mining only
Mastocytosis Cutaneous	Mastocytosis	Pubtator	12937123	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	12937123, 19850739		★☆☆☆☆ Found in Text Mining only
Mature B-Cell Neoplasm	B-Cell Neoplasm	BEFREE	31791624		★☆☆☆☆ Found in Text Mining only
Meckel syndrome type 1	Meckel-gruber syndrome	Pubtator	10793071	Stimulate	★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	1713514, 31728727		★☆☆☆☆ Found in Text Mining only
Mediastinal lymphadenopathy	Mediastinal lymphadenopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	8546897		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	11037345		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	10983696, 1742726, 17545597, 21161674, 21181094, 21880625, 22766741, 25885794, 26394044, 29016820, 31465840, 8638218		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	24887326, 26394044, 9060818	Associate	★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	10575157, 12449722, 23065465, 7632063, 7695015, 8599446		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10361224, 11511312, 11676832, 11874491, 11959101, 12177306, 12669250, 14660675, 14757835, 15140231, 15205682, 15314285, 15858118, 15987743, 16528364, 16702969, 17086378, 17384650, 18079751, 18323781, 18458532, 18987671, 19372583, 19383853, 19684859, 20668552, 21108607, 21233846, 21564512, 22160615, 22292048, 23341182, 23447565, 23527236, 23837445, 24367627, 24608435, 25350317, 26035829, 26134947, 27185926, 27468725, 28358423, 28940390, 29348439, 29858490, 31019203, 31485613, 31635389, 33259900, 33741716, 35260073, 36241419, 36902392, 7887447	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10504052, 10575157, 11095261, 11196180, 11874491, 11948488, 11959101, 12086670, 12205045, 12449722, 12787138, 14598887, 14627985, 14654935, 14660675, 15742811, 15756025, 15860445, 16033830, 16195754, 16526947, 16702969, 16914583, 16983347, 1742726, 17547520, 18246127, 18978796, 19200201, 19372583, 19684859, 19724688, 20055834, 20232120, 20337986, 20668552, 21233846, 21364647, 21798045, 22173547, 22233801, 22292048, 23059386, 23151846, 23152056, 23402819, 23447565, 23527236, 23837445, 24118207, 24461648, 25947358, 26035829, 26599548, 27086916, 27185926, 27829238, 28050764, 28289382, 28738256, 28884131, 29383100, 29434952, 29858490, 30185782, 30454024, 30588012, 30599074, 31019203, 31083589, 31103719, 31516599, 31535400, 7632062, 7777475, 8599446, 8639055, 8721444, 8783649, 9461199		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	11959101, 12086670, 15577328, 17384650, 18079751, 18363112		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	38166464	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	7534042	Inhibit	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	18570663, 21108607, 7534042	Associate	★☆☆☆☆ Found in Text Mining only
Melnick-Needles Syndrome	Melnick-Needles Syndrome	CTD_human_DG	17954590		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	17967740		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	BEFREE	11108890, 24612434, 26514459, 9879458		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	26240495, 28340489	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28293733, 28716632, 31160908		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	22814318, 22976527, 8721444, 8806961		★☆☆☆☆ Found in Text Mining only
Mesenchymal Chondrosarcoma	Mesenchymal Chondrosarcoma	CTD_human_DG	12817616		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	11135160, 11485930, 12800189, 22622048, 31670317, 31786278		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	11485930, 17224645, 21697949	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19815709, 29094504	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	31295022		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	24607549		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	33398046	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	27864821, 30071531		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	20482488		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	15291805		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	18077176, 19429011		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	17597205		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	11461904, 15802021, 29516570, 29745075, 31995555, 9621051	Inhibit	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	11568006, 12170773, 12644018, 15138206, 15175350, 15494423, 16098144, 16702969, 16749867, 16778220, 16980304, 17323348, 17942397, 18670645, 18829556, 19010820, 19270531, 19331169, 20223826, 21113147, 22761775, 24602180, 24920239, 25446991, 25864810, 25879420, 26493374, 28103869, 28714472, 29424907, 31541852, 31815138, 32690085, 33399099, 33809701, 33929971, 34895315, 37919369, 38183352	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Myopathies	Mitochondrial myopathy	BEFREE	17551003		★☆☆☆☆ Found in Text Mining only
Mitochondrial Myopathies	Mitochondrial myopathy	Pubtator	17551003	Associate	★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	28459375		★☆☆☆☆ Found in Text Mining only
Monoclonal B-Cell Lymphocytosis	B-Cell Lymphocytosis	BEFREE	22686190		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	8050191		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	23341540		★☆☆☆☆ Found in Text Mining only
Morphea	Morphea	BEFREE	10651227		★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	10414973, 9228005		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	7472523, 9228005		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	12172574, 15236993, 16019350, 24127964, 34762658, 7730485	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	12937123	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	12172574, 17764575, 20430729, 23119114, 29332355	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	8972757		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	11703382	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	37506144	Inhibit	★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	24256941		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	11298531, 11535962, 12560219, 12826880, 15257946, 16484127, 17601964, 18445693, 18538438, 1951637, 21502424, 2249841, 2250191, 24232982, 2672827, 30213394, 31631728, 7706514, 8426481, 9395180, 9655306, 9885983		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	LHGDN	18538438		★☆☆☆☆ Found in Text Mining only
Multicystic Dysplastic Kidney	Multicystic renal dysplasia	BEFREE	11390716		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia	Multiple Endocrine Neoplasia	BEFREE	8604810		★☆☆☆☆ Found in Text Mining only
Multiple Epiphyseal Dysplasia	Multiple Epiphyseal Dysplasia	CTD_human_DG	17954590		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10216101, 10557057, 10812183, 11146157, 11175262, 11495702, 12366710, 12479855, 12521996, 12529680, 12707028, 12720156, 1415486, 14695177, 15085157, 15784299, 16454747, 16461302, 1730093, 17384201, 17588340, 18205859, 18354037, 19656156, 21835956, 22054286, 22128141, 22147262, 23142241, 23480852, 23708869, 24095849, 24120758, 24236538, 25231749, 25542900, 26939706, 27465916, 28151428, 28356941, 28476134, 28506771, 28847998, 28905994, 29018077, 29257139, 29761903, 30076373, 30170425, 30409700, 30419344, 30428277, 30524962, 30535471, 30594434, 31015208, 31320555, 31818702, 7743552, 8467229, 8781438, 9163609, 9454907, 9664139, 9735415		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	10216101, 10583232, 11146157, 11175262, 11495702, 11886382, 12391322, 12521996, 12707028, 1415486, 15070697, 15741217, 17200714, 1730093, 17332241, 17384201, 20930946, 21659544, 21826062, 21834602, 21835956, 21871133, 22147262, 22177381, 24236538, 25120804, 25231749, 26617773, 26640142, 26707935, 27465916, 27494845, 28151428, 28847998, 28918747, 30170425, 30846494, 31564190, 32173687, 33368455, 33649772, 33658484, 33806619, 34288263, 34639102, 34670358, 34792571, 34861096, 36262053, 36752202, 37499483, 37729611, 38511268, 7540069, 8781438, 9163609, 9419346	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	11985351	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	CTD_human_DG	12429644		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10498820, 12507784, 15124764, 15755681, 17898009, 20112030, 29022246, 31698073		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	16295526	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	36725329	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	22463747, 27055778		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	20476668	Inhibit	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	15757977		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Oculopharyngeal	Oculopharyngeal Muscular Dystrophy	BEFREE	21199860		★☆☆☆☆ Found in Text Mining only
Mutilating keratoderma	Mutilating Keratoderma	BEFREE	10940652		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	17354625	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	24036458		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	31648231	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10692673, 11699413, 17597205, 21340723, 22855610, 22964015, 23153525, 23845443, 23906301, 29707107, 29982865, 31156799, 7723410, 8943864		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	11940482		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	12111784, 14594556, 22964015, 26398525, 27665715, 34548471, 8943864, 9716007, 9744502, 9886323	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	11929790, 12890867, 1536952, 19577445, 8856092, 9645350		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	12890867		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10839193, 14656881, 14689061, 1536952, 15626746, 16166298, 16230407, 17545631, 18534064, 1868240, 19141860, 25389112, 25721555, 26494558, 30017934, 31145521, 8244494, 8647442, 9279359, 9570362		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	18534064		★☆☆☆☆ Found in Text Mining only
Myelokathexis	Myelokathexis	BEFREE	12963840		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	10674872		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	19027736		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	23978105, 28249249, 28392989, 28479248, 29184499, 29725368, 29975120, 30642049, 30896796, 31486508, 31725080		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	18701048, 20307495, 28123342, 29412156		★☆☆☆☆ Found in Text Mining only
Myocardial necrosis	Myocardial necrosis	BEFREE	28249249		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	17007104	Stimulate	★☆☆☆☆ Found in Text Mining only
Myoclonic dystonia	Myoclonic dystonia	Pubtator	34288263	Associate	★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	11982494, 15757977, 24607549		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	11982494		★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	11570908	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	23135964, 23406595		★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	BEFREE	28382141		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	10231418, 11053650, 11505451, 11713720, 12099337, 12893071, 15189500, 16299246, 16647958, 17020977, 18442057, 19698176, 20514538, 20718717, 21936689, 22322844, 23142283, 23708661, 23777485, 24157866, 25031780, 25227792, 25405832, 28696828, 29844823, 29914005, 30017199, 30063067, 8380056, 8732340, 9046038, 9635525, 9783682		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	20514538, 21114920, 21388911, 23777485, 24157866, 24961145, 25031780, 25227792, 25337187, 26795575, 29256858, 29991129, 31634779, 34064109, 34224316, 38009194, 38149563	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal Neoplasms	BEFREE	20514538		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	20514538, 36225172	Associate	★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	CTD_human_DG	18566236		★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	21976712		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	11414470, 11600428, 12036455, 14748742, 17094488, 20062536, 23907460, 25197664, 29854577, 40542009	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrosis	Necrosis	Pubtator	9514059	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	16002567		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10022131, 10029807, 10063240, 10096572, 10190792, 10193519, 10193956, 10209447, 10211311, 10219790, 10325496, 10333765, 10339668, 10362119, 10362145, 10370035, 10383168, 10398083, 10398140, 10452254, 10463280, 10463770, 10480445, 10481119, 10487853, 10494513, 10500792, 10500813, 10504548, 10533903, 10534678, 10537358, 10564391, 10567896, 10567899, 10567901, 10574596, 10593857, 10597257, 10604264, 10604265, 10606183, 10607921, 10618414, 10628333, 10631864, 10637446, 10646876, 10646898, 10667479, 10668897, 10682669, 10693703, 10732789, 10741743, 10744622, 10750777, 10754491, 10755598, 10764042, 10794603, 10797481, 10818595, 10825522, 10862921, 10879732, 10930045, 10942533, 10945495, 10963129, 10964337, 10968362, 11025483, 11029800, 11041112, 11044356, 11051254, 11053991, 11063058, 11094305, 11095261, 11129289, 11140704, 11150376, 11155917, 11156254, 11158189, 11166457, 11172690, 11197119, 11207824, 11212255, 11241246, 11259472, 11275791, 11275990, 11280784, 11286472, 11289122, 11295035, 11306504, 11325830, 11328414, 11371029, 11391617, 11420706, 11464113, 11469882, 11471486, 11482579, 11487260, 11508812, 11519857, 11547047, 11572760, 11574780, 11579389, 11687726, 11692156, 11745446, 11781220, 11805418, 11813905, 11820594, 11820596, 11820644, 11865380, 11867201, 11874491, 11877266, 11896617, 11917941, 11949845, 11994759, 12081782, 12085233, 12150137, 12168836, 12168872, 12170763, 12174951, 12197230, 12207179, 12209955, 12240548, 12352189, 12359206, 12370749, 12391322, 12404288, 12414660, 12429812, 12454767, 12507894, 12558990, 12569609, 12581249, 12607598, 12610162, 12631622, 12637941, 12680147, 12695689, 12720157, 12740649, 12777377, 12787138, 12810203, 12811476, 12825859, 12871207, 12883724, 12907654, 12929741, 12941126, 12960812, 12962724, 13130506, 1339299, 14499691, 14519627, 14559989, 14624621, 14627349, 14627985, 14647426, 14656881, 14663636, 14690153, 14695149, 14695177, 14697505, 14708047, 14717779, 14719075, 14767530, 1497088, 14976524, 14994125, 15017587, 15033827, 15033904, 15073856, 15075668, 15095259, 15152946, 15168338, 15210690, 15215171, 15277222, 15287041, 15288687, 15297406, 15336653, 15337798, 15357873, 15380175, 15390206, 15448811, 15464084, 15484295, 15500654, 15507680, 15540893, 15542778, 15569975, 15570006, 15627842, 15682435, 15709167, 15753400, 15756025, 15770521, 15826766, 15842731, 15985079, 16006802, 16010555, 16019487, 16112004, 16166262, 16170666, 16193090, 16210911, 16230407, 16243795, 16299246, 16328036, 16331261, 16353209, 16518826, 16520894, 16540632, 16551851, 16563550, 16616063, 16643620, 16647810, 16675913, 16681723, 16733203, 16763616, 16784742, 16799551, 16830272, 16875495, 16914583, 16916556, 1692620, 16966263, 16985183, 17085199, 17096333, 17097561, 17145638, 17145812, 17182178, 17197928, 17200714, 17237270, 17325632, 17332927, 17352236, 17360176, 17363184, 17378914, 17404013, 17426704, 1742726, 17429338, 17483435, 1750500, 17508927, 17545597, 17561354, 17574594, 17577773, 17589894, 17607378, 17654511, 17908970, 17942898, 17951202, 17972023, 17989874, 18063429, 18089500, 18163880, 18167184, 18203018, 1824261, 18248353, 18264131, 18268409, 18334006, 18336194, 18338171, 18381443, 18442057, 18505919, 18510726, 18528859, 18538438, 18550246, 18599488, 18644998, 18676844, 18701415, 18705409, 18714167, 18803879, 18829556, 18929412, 18949393, 19009587, 19018252, 19027288, 19035283, 19035317, 1906343, 19122679, 19156528, 19196738, 19272801, 19289568, 19291371, 19348791, 19380190, 19473291, 19484147, 19495772, 1951637, 19540190, 19556859, 19576799, 19605509, 19631957, 19666413, 19676053, 19724860, 19810096, 19824041, 19863221, 19955217, 20004133, 20023705, 20025478, 20064672, 20068093, 20071661, 20082279, 20082858, 20099064, 20185581, 20187794, 20233885, 20434805, 20495544, 20499068, 20570889, 20653974, 20658730, 20664359, 20679739, 20800695, 20927315, 20939431, 20975993, 20976632, 21033669, 21088903, 21114920, 21171016, 21258408, 21282543, 21364627, 21401960, 21421338, 21423208, 21486225, 21491965, 21566062, 21656028, 21680733, 21702037, 21710341, 21734077, 21798045, 21861179, 21988644, 22002575, 22006676, 22011203, 22024950, 22037783, 22057347, 22069448, 22081075, 22187149, 22233801, 22248086, 22293115, 22309646, 22313995, 22343305, 22366560, 22393311, 22426337, 22446832, 22472110, 22484303, 22538851, 22540890, 22619347, 22743622, 22824797, 22910913, 22976527, 22979990, 23064047, 23076250, 23076380, 23122182, 23134201, 23144318, 23202800, 23235461, 23250731, 23297126, 23331007, 23348742, 23358890, 23375952, 23382965, 23441611, 23445492, 23479509, 23543150, 23579274, 23612742, 23613234, 23621182, 23631722, 23673926, 23674504, 23700323, 23705792, 23716551, 23760062, 23784204, 23836782, 23861345, 23939148, 23955799, 23957733, 23990456, 23991978, 24024471, 24065086, 24157866, 24203629, 24206208, 24222112, 24232982, 24267052, 24268771, 24469707, 24595931, 24602166, 24614362, 24670873, 24679006, 24694877, 24750000, 24778012, 24788728, 24832086, 24859880, 24901320, 24930892, 24983357, 25031780, 2503246, 25036876, 25064172, 25090026, 2509518, 25108507, 25111376, 25209181, 25230790, 25282590, 25323586, 25326586, 25395275, 25412610, 25425972, 25429725, 25436837, 2543982, 25443654, 25452615, 25468484, 25471003, 25495168, 25499851, 25524579, 25549806, 25571952, 25682076, 25738398, 25751501, 25756510, 25773652, 25805589, 25826088, 25840688, 25851703, 25866434, 25885284, 25910231, 25915848, 25979325, 26008974, 26013319, 26074259, 26239085, 26301506, 26325180, 26406409, 26406868, 26416455, 26448193, 26472348, 26482433, 26509633, 26530780, 26540186, 26541272, 26546525, 26580599, 26641257, 26662799, 26707143, 26945444, 26993600, 27002765, 27034925, 27083050, 27084450, 27126996, 27134111, 27221871, 27257180, 27311873, 27322712, 27335087, 27371094, 27422937, 27486855, 27558109, 27649657, 27701048, 27739436, 27748813, 27773559, 27776427, 27835895, 27864689, 27873035, 27896589, 27959448, 27965982, 28004108, 28032603, 28054210, 28056055, 28095352, 28123591, 28162277, 28187375, 28237487, 28282916, 28294427, 28358412, 28359197, 28382141, 28415735, 28440479, 28459375, 28468776, 28476852, 28481473, 28497394, 28497509, 28514759, 28522750, 28605593, 28617558, 28656213, 28663269, 28710745, 28739686, 28740380, 28750564, 28770967, 28777433, 28794048, 28795410, 28820908, 28843487, 28851813, 28856937, 28862228, 28885267, 28890201, 28895407, 28903386, 28920615, 28945232, 29017059, 29035831, 29076273, 29085447, 29088292, 29118061, 29135311, 29146569, 29217266, 29218546, 29254147, 29269870, 29289560, 29323792, 29335437, 29336659, 29372687, 29405977, 29472583, 29475959, 29494356, 29501042, 29524699, 29578179, 29653556, 29682179, 29686263, 29693134, 29747654, 29757198, 29769286, 29769323, 29844818, 29850390, 29855616, 29858685, 29902576, 29914005, 29927999, 29928488, 29935090, 29947213, 29997504, 30042493, 30069746, 30076862, 30103745, 30139926, 30144515, 30150436, 30183767, 30197337, 30205794, 30210681, 30228112, 30235866, 30242253, 30250574, 30277098, 30306430, 30316787, 30372871, 30374681, 30395230, 30406027, 30425572, 30448904, 30466620, 30467386, 30518159, 30523716, 30526410, 30530525, 30539520, 30555597, 30609603, 30613837, 30617443, 30620563, 30687320, 30753820, 30779087, 30801855, 30931307, 30941978, 30958641, 30962322, 30965082, 31030314, 31083279, 31119602, 31128995, 31171817, 31177019, 31205067, 31205561, 31215421, 31242894, 31244419, 31250159, 31253168, 31288582, 31289309, 31312385, 31410122, 31524253, 31548293, 31556592, 31652963, 31679311, 31682281, 31686915, 31748959, 31751608, 31766723, 31806643, 31835085, 3287162, 3657890, 3923362, 6093263, 7478596, 7490615, 7490679, 7494604, 7539660, 7612493, 7632062, 7640218, 7664626, 7699118, 7712429, 7734290, 7767905, 7777475, 7814152, 7833141, 7846129, 7850719, 7856728, 7896458, 7915536, 7936663, 8025526, 8118038, 8133533, 8164025, 8203469, 8205548, 8249891, 8274737, 8278571, 8286195, 8297731, 8543306, 8552577, 8597045, 8604810, 8616855, 8616869, 8617450, 8617478, 8620509, 8625322, 8635035, 8667646, 8667654, 8675602, 8683126, 8683378, 8705824, 8707954, 8729985, 8797876, 8821955, 8825123, 8917421, 8917716, 8972757, 8996359, 9002964, 9029764, 9031112, 9049970, 9057657, 9068103, 9099968, 9108465, 9113013, 9137104, 9177412, 9196162, 9199601, 9221853, 9250813, 9250826, 9256286, 9256917, 9258073, 9292129, 9306964, 9328150, 9341939, 9362445, 9378470, 9379422, 9390036, 9392332, 9398988, 9413034, 9421349, 9427771, 9428493, 9465813, 9490092, 9507882, 9508209, 9514059, 9538152, 9546285, 9583721, 9600110, 9614375, 9621132, 9625842, 9637556, 9651943, 9654593, 9669683, 9669816, 9672345, 9695733, 9765446, 9815569, 9815973, 9816145, 9816161, 9829760, 9836559, 9852630, 9863489, 9891509, 9891543, 9891547, 9891551, 9989812		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	19473291, 31824157		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	28378099		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	10370035, 11371029, 11986946, 20651072, 22244202, 29040381, 29589053, 31213844, 7585606, 9180296		★☆☆☆☆ Found in Text Mining only
Nephronophthisis	Nephronophthisis	BEFREE	10528654, 17061121		★☆☆☆☆ Found in Text Mining only
Nephronophthisis 1	Nephronophthisis	BEFREE	10528654		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	30074185		★☆☆☆☆ Found in Text Mining only
Neural crest tumor	Neural Crest Tumor	BEFREE	1742726		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10329457, 10521406, 10889510, 10956420, 10972966, 11027660, 11406564, 11571630, 11896617, 11948412, 12085233, 12632373, 15504352, 15703493, 15803370, 1742726, 17894887, 17912039, 18059320, 18193081, 18338171, 18836721, 19556859, 20821386, 21143953, 21148565, 21159604, 22006676, 22040216, 22366560, 22802690, 23376416, 23816987, 23872733, 24009722, 24556687, 24891300, 25756510, 26859456, 26996667, 27389777, 27816613, 28702620, 28856835, 28915653, 29259008, 29279995, 29716528, 29769286, 29959561, 30179292, 30867124, 30949973, 31484706, 31664947, 7553653, 7666311, 7767905, 7777475, 7903532, 8195931, 8205548, 8244494, 8256847, 8441470, 8638218, 8651343, 8666983, 8938353, 9099968, 9460707, 9733629		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	17702766, 18036348, 18325115, 18836721, 19556859, 19813266, 21159604, 21290341, 22040216, 23317647, 23341456, 25292042, 25756510, 26859456, 27866306, 28204825, 32203216, 38282862, 7767905, 8256847, 9006328, 9414036	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	36983059	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	22065207, 25311206, 7472523, 9202314		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	8638218		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	10468958, 10963129, 12838300, 22251937, 26434631, 9614375		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	LHGDN	14631373		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	29066822, 29179212		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	17429338		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	24346802	Associate	★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	15757977		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	28174515		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	12963840		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	LHGDN	14764541		★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	14764541	Associate	★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	23065465		★☆☆☆☆ Found in Text Mining only
Nevus comedonicus	Nevus comedonicus	BEFREE	27485415		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	11505451		★☆☆☆☆ Found in Text Mining only
Nodular Goiter	Nodular Goiter	BEFREE	29250672		★☆☆☆☆ Found in Text Mining only
Nodular Sclerosis Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	1899539		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24938610, 28216552, 31839747		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	24549219		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10048471, 10070896, 10217615, 10487853, 10734319, 10945495, 11316541, 11401061, 11804688, 11820594, 12838300, 15217967, 15364135, 17133272, 17535549, 17581297, 18620728, 18705409, 19360319, 19560836, 20064672, 20127174, 20206622, 20530713, 21748337, 21971866, 21981718, 22438908, 22446832, 22614533, 22710790, 22863759, 23216071, 23355004, 23364242, 23588221, 23719266, 23977251, 24264312, 25036876, 25084400, 25257838, 25301444, 25342427, 25424357, 25524579, 25719249, 25758528, 26095308, 26325180, 26464649, 26656462, 26782967, 26996126, 27072269, 27431492, 27816990, 27939888, 28102575, 28248928, 28419994, 28487996, 28518145, 28870896, 29207200, 29422965, 29496539, 29568392, 29587281, 29725421, 29725453, 30031063, 30122943, 30218747, 30254092, 30271203, 30280775, 30590312, 30651886, 30747218, 30861415, 30900377, 31150457, 31190896, 31440159, 7590697, 7734290, 8630278, 8854645, 9196162, 9421349, 9445135, 9508209, 9635525		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	10652623, 10767354, 11678802, 12037031, 15722788, 21865136, 9815631		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23193206	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26709918, 29855282, 30442352		★☆☆☆☆ Found in Text Mining only
Odontogenic Tumors	Odontogenic Tumor	BEFREE	20004133, 22684875		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	17252199, 18928543, 19148464, 21953021, 22462654, 26257067, 30518523		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	10547558, 15332326, 21171016		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	BEFREE	10619458		★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	27837193		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	22124045	Associate	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	20233885, 25380690		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	22009819, 25380690	Associate	★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	14595764		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31405216, 33540799, 36879307	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	33540799	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	29399094, 29687871		★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasia	CTD_human_DG	17954590		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteochondroma	Osteochondroma	Pubtator	11140704	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	28257830		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	31251836	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	35609324, 36372373	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	BEFREE	9215625		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29434715		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Age-Related	Osteoporosis	BEFREE	16007339		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10930045, 11241246, 19818735, 20357441, 20376536, 20580954, 21717192, 21890444, 23568006, 24750000, 24797937, 25326586, 25381586, 25677904, 26002578, 26035796, 26381132, 26416351, 26744308, 26781995, 26823739, 27133034, 27813492, 28403890, 28618955, 28635396, 28770967, 28837148, 28849162, 29115549, 29207112, 29363721, 29434958, 29441873, 29484432, 29488603, 29509239, 29654165, 29750154, 29769415, 30015899, 30248086, 30280767, 30667081, 30747353, 30988774, 31074088, 31116090, 31264066, 31433581, 31695327, 31799646, 8603467		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	15112275, 17632732, 23568006, 24570183, 24961347, 25677904, 26569226, 26707422, 26744308, 26823739, 27735939, 27813492, 28618955, 28837148, 29509239, 29750154, 30015899, 30403180, 30747353, 31176732, 31433581, 32922188, 33097010, 33378012, 33797312, 33828027, 35758024	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	17632732		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	10646901, 15505422, 16785787, 18334006, 8616869		★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	26030369		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	10666369, 25510701	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	29851197, 30683144		★☆☆☆☆ Found in Text Mining only
Ovarian Germ Cell Tumor	Ovarian Tumor	BEFREE	17603707		★☆☆☆☆ Found in Text Mining only
Ovarian Granulosa Cell Tumor	Ovarian Tumor	BEFREE	23235765		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10480447, 10666369, 11094305, 11295035, 11720475, 15156398, 15505422, 16166319, 18056200, 19148468, 20082279, 22294191, 22688594, 23235765, 23579097, 23962558, 24190693, 25672608, 25862909, 27277143, 27748803, 28188387, 29062236, 29952351, 30548372, 30718431, 7478541, 8616869		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15156398, 17893875, 19060592		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10646901, 10679744, 10780525, 12036450, 12644821, 16138714, 19028702, 19517469, 19755862, 20082279, 22052903, 22843880, 22995373, 23277286, 23333498, 23345014, 24249678, 25672608, 25823945, 26030369, 26514477, 27080533, 27136097, 27462919, 27486855, 28326515, 28440479, 28504421, 28537902, 29760419, 30178833, 31462500, 32187278, 32752091, 33273524, 34181334, 34296546, 36122664, 36757936, 36770806, 36849137, 38003498, 7577491, 9233527, 9654593	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17575110, 27462919	Inhibit	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	16015611, 24666255, 28259690, 31302853		★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	14595764		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10340887, 10362119, 10813710, 11571724, 11668508, 12065845, 12189556, 15257106, 16099798, 16357180, 17005319, 17378914, 17960583, 18528859, 18829553, 19318573, 19908231, 19966835, 20143389, 20579221, 20646298, 21376256, 21605072, 22939115, 23245210, 24534203, 25751501, 25880226, 26217086, 26676634, 30155839, 30192158, 30267303, 30359541, 30545600, 31602160, 9863489		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic diseases	Pubtator	21963730	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	22024503, 23440261, 28693250, 29344231		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12189556, 17616686, 17960583		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	23475955, 29344231		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10362119, 11226429, 11953819, 12865934, 15309737, 15884114, 16109447, 17201167, 17378914, 19966835, 21714853, 21720559, 21909380, 22246103, 23954445, 23975374, 24603988, 25880226, 26247574, 27721241, 29486633, 30046371, 31230062, 31412018, 31799654, 31856624, 33099937, 9863489	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20646298	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	11889077, 15622002	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	29344231		★☆☆☆☆ Found in Text Mining only
Papillary adenoma	Papillary Adenoma	CTD_human_DG	10223192, 10426811		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	22120515, 25471003, 25868389, 25908172, 28187375, 28259821, 29520684, 29856242, 30869573, 31842912		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	10862921, 11325830, 19035317, 20233885, 21704150, 9484776		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	11197119		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	12067490	Associate	★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic syndrome	Pubtator	25120759	Associate	★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	12605367		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	LHGDN	15800682		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	18492387, 22198862	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10097166, 10972966, 15033812, 17982884, 23523055, 27192974, 27848260, 28494419, 29414391, 29433359, 30048421, 30221494, 30400738, 30526176, 30877973, 31706839, 31707034		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24256571, 30221494, 34204164	Associate	★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	28693250		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	30442352, 31622249		★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	2540855, 36196757	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	21674599, 24614958		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	21674599	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	16388717	Stimulate	★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	25138901		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical periodontitis	Pubtator	35804353	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	39337647	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	16787530, 30593206	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30593206, 31032945		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	29760303		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	29760303		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	22189900, 29217426		★☆☆☆☆ Found in Text Mining only
Perisylvian syndrome	Perisylvian Syndrome	BEFREE	31443270		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	10793072	Associate	★☆☆☆☆ Found in Text Mining only
Persistent Polyclonal B-Cell Lymphocytosis	Persistent Polyclonal B-Cell Lymphocytosis	BEFREE	11380461, 9922047		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	11752215, 28979675, 30656694, 9177412		★☆☆☆☆ Found in Text Mining only
Pilomatrixoma	Pilomatrixoma	BEFREE	9185911		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	10079254	Inhibit	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	10780524, 18273074, 23334699, 29556628, 8943742	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	14971737		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	16620920, 28973148		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	14505758, 22789864, 25495168, 29762821, 9856409		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21062263		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	26868993, 33287836, 34784951, 35288480, 35393909	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycythemia Vera	Polycythemia Vera	BEFREE	19060244, 23702031, 29068570		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	19060244	Associate	★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	8563932		★☆☆☆☆ Found in Text Mining only
Porphyria Cutanea Tarda	Porphyria Cutanea Tarda	BEFREE	14695177		★☆☆☆☆ Found in Text Mining only
Porphyria Variegate	Variegate porphyria	Pubtator	20331452	Inhibit	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28210980		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	23511489		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	1638028, 1728422, 18163880, 1992441, 21072044, 2250704, 23511489, 2406517, 26962682, 29312798, 7475272, 8555066		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	18089500, 23511489, 8417786, 8847894		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	11999565, 16840204		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	12375054, 12931228, 14508797, 15380515, 18024393, 18046449, 18056841, 18575824, 20038611, 2123067, 22591684, 2284100, 23494176, 24083449, 24280866, 26172269, 27867103, 29233926, 29680307, 30141309, 30631148, 30862722, 30985716, 31358732, 7632955, 9592841		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	10233841, 10848789, 11520803, 11781368, 11792421, 16916556, 17252014, 20103721, 21608150, 23471820, 24994123, 25301704, 25644173, 26172269, 28074072, 28122742, 28852199, 29854301, 29930300, 30224339, 30232463, 30320607, 31687977, 9989821		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	23471820		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	29849149		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	17124644, 22198673, 29414391		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	18077176		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	26429926, 30253330, 9141420, 9855077		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	10697273, 11804283, 23030256, 30306208, 9680371, 9754175		★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	30548903		★☆☆☆☆ Found in Text Mining only
Primary Cutaneous Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	15377339		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	22300941		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	31659122		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	25991504		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	30183767	Associate	★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	CTD_human_DG	29892016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, HEREDITARY, 1	Prostate Cancer, Hereditary	CTD_human_DG	29892016		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10190792, 10325496, 10446452, 10533903, 10884916, 10945499, 11085527, 11158189, 11275990, 11482579, 11571575, 11704864, 11745446, 11751483, 11776759, 11920957, 12019181, 12170775, 12170776, 12188882, 12242728, 12496485, 12629413, 12644474, 12664070, 12694817, 12821128, 12894226, 12907654, 14719096, 14765130, 14965337, 15124003, 15174974, 15202013, 15256454, 16015611, 16331261, 16520381, 16686729, 16733517, 16827116, 17062688, 17085199, 17237270, 17503439, 17545625, 17575222, 17653717, 17678531, 18475287, 18842418, 19050681, 19117992, 19153211, 19211554, 19237173, 19495772, 19576799, 19593445, 19737977, 20146885, 20464497, 20519142, 20577262, 21207420, 21555367, 21681193, 21785821, 22024950, 22278289, 22766626, 23073173, 23160675, 23612742, 23726840, 24040105, 24220327, 24666255, 24980820, 25053345, 25177836, 25333266, 26189652, 26934861, 27082738, 27519795, 28109198, 28376214, 28396899, 28816549, 28868037, 29022918, 29200739, 29316844, 29362360, 29392925, 29526801, 29949147, 30197674, 30297390, 30453074, 30637800, 30741252, 31494078, 8204007, 8532388, 8996359, 9090501, 9232607, 9260915, 9366376, 9413164, 9514052, 9598502, 9609635, 9836559, 9842970, 9852630		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	GWASCAT_DG	29892016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Cancer, Castration-Resistant	Prostatic Cancer, Castration-Resistant	BEFREE	8700802		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	9207953		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic disease	Pubtator	9865831	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	LHGDN	15314639		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	16309180, 16827116, 30295140, 37378942, 9186362	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	10619965		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	10537358, 10604265, 10617870, 10952781, 11275990, 11439339, 14676836, 16015611, 17404601, 17917084, 19495772, 29357840, 9989812		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10884916, 11061345, 11495901, 11500787, 11692148, 12086875, 12170775, 12170776, 12496485, 12644474, 14692814, 15655565, 15790403, 16015611, 16080576, 16814949, 16820098, 16880611, 17575222, 17674353, 18668529, 19117992, 19275204, 19414838, 20168333, 21694441, 22038225, 22080570, 22484941, 22504871, 23936432, 23982738, 24267199, 25803782, 26604689, 26934861, 27049720, 27187384, 27268646, 27519795, 28109198, 28396899, 28737827, 29188305, 29211704, 29268752, 29316844, 29351194, 29949147, 30577600, 30741252, 31196962, 31332950, 31389609, 32258129, 32341393, 32630281, 32831047, 32894540, 34170852, 34399719, 34791506, 36615305, 37814239, 38087324, 8623924, 8623925, 8689504, 9514052	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	11776759, 11839683, 12086875, 12629413, 16733517, 18573594, 19107861		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	16733517		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19050681, 37378942	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteinuria	Proteinuria	Pubtator	8587248	Associate	★☆☆☆☆ Found in Text Mining only
Protoplasmic astrocytoma	Protoplasmic Astrocytoma	BEFREE	15017587		★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	27262945		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	12941088		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	18410632		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	27864821		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	10655200, 21738398		★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	BEFREE	21674599		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	10704078, 20423464, 28494757, 32158203, 35431545	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27351886		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	33601175, 9327733	Associate	★☆☆☆☆ Found in Text Mining only
Rasmussen Syndrome	Rasmussen`s Syndrome	BEFREE	31353670		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	10216477, 15154650, 16400510, 17360176, 23030583		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	LHGDN	15033827		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	15300917		★☆☆☆☆ Found in Text Mining only
Refractory anaemia with excess blasts	Myelodysplastic syndrome	BEFREE	1536952		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	21159604		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	15357873, 19539330, 25833690, 26406868, 27573448, 27834342		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10101681, 11351249, 12017273, 12025227, 12796377, 12810203, 12941126, 14519627, 14710230, 15188008, 15756350, 15826766, 15985079, 16643620, 17541305, 19380190, 19539330, 20037166, 20208132, 22398398, 22591748, 23469687, 27483435, 27554585, 27573448, 27779645, 27834342, 28449664, 28464919, 29731840, 31031856, 8621251, 9042262		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	12025227, 14519627		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28078995, 28714020		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	19107326, 8587248		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	17998875		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	29456694		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	22977664	Associate	★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	20736747, 2200538, 2648153, 8150454, 8449825		★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	CTD_human_DG	26239085, 3287162		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	25991504	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	37811624	Associate	★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	29372592		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10454440, 10721149, 10741751, 10757447, 12365913, 12823982, 13130078, 14676836, 15354733, 17273570, 1742726, 19860642, 2009372, 23974512, 25132102, 27049262, 27322712, 29181307, 29288563, 30546451, 30694025, 31231312, 8118038, 8244494		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	30694025, 32329827, 36284668	Associate	★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	7770130		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	15015604, 29858601, 8834522		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	17896786, 28617441	Associate	★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	25991504, 28877516		★☆☆☆☆ Found in Text Mining only
Rhegmatogenous Retinal Detachment Autosomal Dominant	Rhegmatogenous retinal detachment	Pubtator	25991504	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	33073840	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10623863, 10799883, 12165497, 17009247, 17328050, 19709444, 21159604, 26834210, 26905515, 27493089, 28975975, 28987940, 29115552, 29669300, 29755657, 31217874, 31239367, 7945466, 8670592, 8774162, 9022077, 9856487		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12165497		★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	11877266, 15361203, 8547651	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Adenoma Pleomorphic	Salivary gland disease	Pubtator	24740354, 33737504	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	21196881, 22313995	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	22313995, 8917716		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	11641969		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	11641969	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	17219718	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	11571738, 12168836, 15217956, 15933471, 16450387, 1742726, 8834522		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	17536310		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	17643097	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Endometrial Stromal	Endometrial stromal sarcoma	Pubtator	15309019	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	21844121, 33719644	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	10079372, 11165927, 11836434, 26456186, 31252633, 37032379, 8644847, 9740222	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	10879732, 11487273, 12218218, 16450387, 19936258, 20082858, 27401493	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	BEFREE	30078226		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19632297, 24365867		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19632297, 24365867		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	37376599	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	CTD_human_DG	17954590		★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome, Type 1	Chondrodystrophic myotonia	CTD_human_DG	17954590		★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21062263		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	9650694		★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	33070565	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	31337422	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sebaceous Adenocarcinoma	Sebaceous Adenocarcinoma	BEFREE	27311873		★☆☆☆☆ Found in Text Mining only
SEBASTIAN SYNDROME	SEBASTIAN SYNDROME	BEFREE	21986618		★☆☆☆☆ Found in Text Mining only
Seborrheic keratosis	Seborrheic keratosis	LHGDN	15811121		★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	28588271, 30725494		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	9849490		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	22365585	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	LHGDN	12583439		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	9669816		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	16622015, 18197142, 18925930, 19052286, 19158156, 19346586, 21711552, 21734077, 23590253, 27631877, 28013315, 28404559, 28505020, 29424793, 29802336, 31115021, 31626040		★☆☆☆☆ Found in Text Mining only
Sertoli-Leydig cell tumor of ovary	Sertoli-Leydig Cell Tumor	BEFREE	14734221		★☆☆☆☆ Found in Text Mining only
Severe autosomal recessive muscular dystrophy of childhood - North African type (disorder)	Muscular dystrophy	BEFREE	22367371		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	10504052, 15566355		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	18496567, 30391273		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	18430249, 7710955	Associate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome 1 Autosomal Recessive	Sick sinus syndrome	Pubtator	16043935	Associate	★☆☆☆☆ Found in Text Mining only
Simple Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	9781657		★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	30191661		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	12472667, 1940802, 35359935	Associate	★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	10193941, 19035317, 27655119		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	32247860	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	12937123, 16164710, 16309502, 25696794		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	11325830, 19035317, 27539478, 9158413, 9328439, 9484776		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	10935471	Inhibit	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	10200459, 11807782, 12838300, 15542778, 15705582, 16022909, 16250931, 17283153, 17426248, 17508927, 18377849, 20004564, 20179162, 20206622, 21036697, 21107291, 23172887, 24036132, 25232677, 25758528, 26008974, 26311051, 27907860, 28468776, 28714472, 28987383, 29118061, 29156797, 29367594, 30268472, 30425570, 30614795, 30896891, 31445197, 31782890, 7490679, 7763030, 7977636, 8630278, 9230884, 9614375, 9792147		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	LHGDN	15026553, 16479062		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	10491014, 12421819, 16479062, 17426248, 18785266, 20922271, 21063403, 21107291, 21282543, 21984896, 23651505, 25758528, 26008974, 26311051, 26722503, 28714472, 30896891, 32152266, 34088900, 35263037, 37289191, 7977636, 8630278, 8774138, 8952529, 9230884, 9792147	Associate	★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	BEFREE	18163880, 1868035, 22686190, 22711886, 7680220		★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	GWASCAT_DG	23770605, 26956414		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	CTD_human_DG	16450387		★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	11306891, 17455098, 24708790		★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 11 autosomal recessive	Spastic paraplegia	Pubtator	8707954	Associate	★☆☆☆☆ Found in Text Mining only
Spermatic Cord Torsion	Spermatic Cord Torsion	BEFREE	29770471		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	10773822, 11128612, 12722834, 12879360, 27331400, 9389483		★☆☆☆☆ Found in Text Mining only
Splenic Neoplasms	Splenic neoplasms	Pubtator	16799206	Associate	★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	17364991	Stimulate	★☆☆☆☆ Found in Text Mining only
Spondyloepiphyseal Dysplasia	Spondyloepiphyseal dysplasia	CTD_human_DG	17954590		★☆☆☆☆ Found in Text Mining only
Spondyloepiphyseal Dysplasia Tarda, X-Linked	Spondyloenchondrodysplasia	CTD_human_DG	17954590		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	16551851, 9392332		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10193941, 10211311, 10223575, 10226528, 10446454, 10514383, 10646898, 10718401, 10755598, 10999751, 11028856, 11813905, 12167422, 12720100, 12883724, 12893071, 15243561, 16675913, 17404013, 17557568, 19035317, 19124208, 19243595, 20145039, 20658736, 21976712, 22852863, 23274910, 23734725, 24203629, 25084400, 26022894, 26653553, 26923693, 27780132, 28233171, 28294427, 29281558, 30222011, 30405796, 30599074, 31759362, 7632062, 7699118, 8797876, 8854645, 9158413, 9196162, 9398988, 9445135, 9591537, 9829760, 9891541		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	11949842, 12270344, 12720100, 14529662, 15329319, 15830715, 17310847, 17693666		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	10514383, 11579389, 12478659, 17912028, 23955799, 24577086, 26132559, 26349965, 26892033, 28123574, 28488526, 29379302, 30049286, 30481793, 30551528, 30609930		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	12454767, 15842252, 15917659, 16254104, 16413463, 16413471, 16551875, 16675913, 17971900, 18566236, 19196738, 19240170, 20448381, 21936874, 22124045, 22896703, 23119114, 23176396, 23451060, 23719266, 23734725, 24278362, 26472042, 26960459, 27509922, 29281558, 31276572, 31759362, 31894587, 34878161, 35078428, 35717615, 36734243, 39519400, 9313825	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19484147	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33840043	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lip	Carcinoma of Lip	BEFREE	29935090		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29725421, 7977636		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	19196738, 19240170, 20233885		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	25210795, 26398820, 29727714, 31676831		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10037186, 10567901, 11791242, 12454767, 15390206, 16302195, 16551875, 17693666, 19240170, 19484147, 21110823, 22554915, 22747515, 22896703, 23719266, 25777981, 31766723, 31801952, 9199601, 9313825, 9921989		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	27573302, 31766723		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	10211311, 23451060, 25962755, 28900281, 31766723		★☆☆☆☆ Found in Text Mining only
Squamous Cell Neoplasms	Neoplasm	LHGDN	17464868		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28983622, 30116338, 30877518, 30983975		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	15122751		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	12168836, 28386289		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11207824, 11535962, 11692156, 12508351, 12579337, 12692839, 12811476, 15476281, 18063429, 18167184, 18709484, 18751407, 19160045, 19418588, 20664977, 21072904, 22277792, 22328012, 23152059, 23201009, 23317885, 24515389, 24815437, 25322930, 26172537, 26292288, 26513239, 27792037, 28439064, 28662697, 29344114, 30242876, 30479464, 30747219, 30792218, 30866865, 31036603, 31205469, 31333785, 31364281, 7478596, 7676688, 8729986, 9891543		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	15786529, 20065505, 34585958, 8063611	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10816444, 11714446, 12679905, 14606069, 14695762, 14716828, 14769213, 15188515, 15754411, 15793875, 15976908, 16340247, 16582585, 17477770, 18158559, 18240345, 18803879, 19331225, 19440006, 19742123, 20403207, 20929525, 21072904, 21777278, 22090785, 22160140, 22216342, 22238053, 22320960, 23289017, 23317885, 23564482, 23613399, 23792648, 23969976, 23991993, 24228120, 24377536, 24555747, 24741635, 24805829, 24988056, 25492481, 25561801, 26172537, 26261629, 26320497, 26513239, 26638529, 26645893, 28347236, 28429358, 28982309, 29771410, 29960296, 30106448, 30468468, 30479464, 30719998, 30866865, 31036603, 31072916, 31280208, 31940247, 32582989, 33079995, 33402109, 33623790, 34452557, 38028855, 7797601, 9020481, 9610615	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16648655, 16714000		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	8063611	Stimulate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28236213, 29258835, 29399092, 29497296, 29872034, 30339347, 30717037, 31203572		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	18496567, 30391273		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	10879732, 11487273, 11867201, 12409719, 12458341, 15838395, 16450387, 18496567, 19602458, 21425056, 22797074, 25912315, 28056055, 28851813, 30391273		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	CTD_human_DG	16450387		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	25857445, 25876876, 27637490, 9650694		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	11550093, 1391959, 1868240, 28134252, 30498064, 7478600, 7704322, 8025526, 9546285		★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	28972014, 29483097		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	11464113, 19020723, 26653553, 8707954, 9891547		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	9524567		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	10050882, 9389577, 9635829		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	17643097, 9041117	Associate	★☆☆☆☆ Found in Text Mining only
Thanatophoric Dysplasia	Thanatophoric Dysplasia	BEFREE	12929929, 9582336		★☆☆☆☆ Found in Text Mining only
Thanatophoric Dysplasia	Thanatophoric dysplasia	Pubtator	12929929, 9582336	Inhibit	★☆☆☆☆ Found in Text Mining only
THANATOPHORIC DYSPLASIA, TYPE I (disorder)	Thanatophoric Dysplasia	BEFREE	12929929, 9582336		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	22300941	Inhibit	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	22418850	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	22300941, 22418850, 29068570		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	29068570	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	8522289		★☆☆☆☆ Found in Text Mining only
Thymus Neoplasms	Thymus Neoplasms	BEFREE	28718205		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	10915219, 9588496		★☆☆☆☆ Found in Text Mining only
Thyroid cancer Hurthle cell	Hurthle cell thyroid cancer	Pubtator	11786411	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	9626044	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	24081676, 25868389, 25908172, 26429174, 30872410, 31378899, 31842912, 9052406	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	10606183, 11740051, 12736725, 17848408, 31786883, 8546897, 8675602, 9029764, 9052406		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	21571321	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	10098499, 31417030		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	17381350, 29250672		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	10362145, 11005209, 17848408, 25471003, 31786883, 8546897, 9029764, 9522214		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	16438077, 17188136		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	11005209, 18021179, 19878585, 23250731, 24718460, 26422859, 30272326, 31786883, 35388548, 35968508, 8546897	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	19008632	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	16219172, 24048795, 29250672, 7605982	Associate	★☆☆☆☆ Found in Text Mining only
TOE SYNDACTYLY, TELECANTHUS, AND ANOGENITAL AND RENAL MALFORMATIONS	Toe Syndactyly, Telecanthus, And Anogenital And Renal Malformations	BEFREE	19946756		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	28983595	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	10687971, 11464113, 11490306, 28417194, 8627878, 8707954, 9891547		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	15929186		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	17976237, 23621182, 23908177, 25179840, 25616695, 26045046, 27217294, 27472710, 28777433, 31742868, 31870109, 33990623, 34970732, 35056723, 36510982, 36939902, 37400144, 37681672, 37863936, 39183056	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21252285, 23621182, 23908177, 25179840, 25374001, 25616695, 26045046, 26472348, 26494004, 27217294, 27367565, 27865619, 28231544, 28624192, 28777433, 28801774, 29317253, 29352235, 29760958, 29855616, 29876007, 30402442, 30555597, 31680955		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24965402	Stimulate	★☆☆☆☆ Found in Text Mining only
Trisomy	Trisomy	Pubtator	35705274	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	28638431		★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	10674872		★☆☆☆☆ Found in Text Mining only
Tumor Lysis Syndrome	Tumor Lysis Syndrome	BEFREE	8847894		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10896914, 11865380, 25437815, 29884701, 30217509, 30228896, 30515402, 8552577, 8888274		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	10231418, 10362145, 8207614, 8546897		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	10426811		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	24321200, 31160908		★☆☆☆☆ Found in Text Mining only
Unverricht-Lundborg Syndrome	Myoclonic Epilepsy	BEFREE	31103823		★☆☆☆☆ Found in Text Mining only
Upper Aerodigestive Tract Neoplasms	Upper Aerodigestive Tract Neoplasms	CTD_human_DG	18566236		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	15517890, 16984978, 18751404, 19122685, 19682434, 22797576, 23495258, 23613234, 23621258, 23656495, 23725146, 24595931, 25566965, 26198047, 26427661, 26743236, 26966728, 27002765, 27367032, 30443191, 30806186, 33786632, 34220332, 36800968, 9208811	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24870742	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Incontinence Stress	Stress urinary incontinence	Pubtator	30426803	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	19272801, 20025478, 23510351		★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	BEFREE	10375606		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	12759237, 15563666, 15684608, 16123814, 19940548	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	LHGDN	15033825		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	10037278, 15361203, 15517869, 15889622, 16619552, 19940548, 21556123, 21704150, 23803076, 24634186, 24782650, 25142231, 26474854, 26482612, 26681053, 27677077, 28128400, 28682441, 28893346, 29989647, 31180057, 31889428, 31935210, 32107047, 32718121, 33392721, 33652577, 34830185, 35057825, 35166172, 36412398, 36508388, 36629320, 37606138, 38112461, 39707317, 9059353, 9683295, 9808425	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	15497492, 21804459, 40256590	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	11867266, 12364438, 17785366, 25851703, 29075126, 29381777, 8834522		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	10209447, 12365913, 22843987, 29982263		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	10209447, 22848417, 24014050, 7573354	Associate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	26136352		★☆☆☆☆ Found in Text Mining only
Van Buchem disease	Van Buchem Disease	CTD_human_DG	17954590		★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	29512749		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	25168538, 28849201, 29978951, 31377879		★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	15531194, 28818228	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	27460740	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	LHGDN	11877309		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	11877309	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	30516302		★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	23689597		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	26931436	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	18514490		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	18514490		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	25991504	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	10444255, 25893290, 26002963, 28548645, 28771100, 33356554, 34793256, 36282673	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	12720128, 12720156, 12720157, 14695177, 24236538, 25382610, 25893290, 27813533, 28548645, 28771100, 31591468		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	10547558, 15332326, 21171016		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	11720445	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	19719835, 22387547		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	30409962		★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group A	Xeroderma Pigmentosum	BEFREE	20811663, 9535131		★☆☆☆☆ Found in Text Mining only