ARPP21 (cAMP regulated phosphoprotein 21)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10777
• Gene name: CAMP regulated phosphoprotein 21
• Gene symbol: ARPP21
• Synonyms (NCBI Gene): ARPP-21, R3HDM3, RCS, TARPP
• Chromosome: 3
• Chromosome location: 3p22.3
• Summary: This gene encodes a cAMP-regulated phosphoprotein. The encoded protein is enriched in the caudate nucleus and cerebellar cortex. A similar protein in mouse may be involved in regulating the effects of dopamine in the basal ganglia. Alternate splicing resu

miRNA Show/Hide all (43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022981	hsa-miR-124-3p	Microarray	18668037
MIRT800480	hsa-miR-1183	CLIP-seq
MIRT800481	hsa-miR-1185	CLIP-seq
MIRT800482	hsa-miR-1260	CLIP-seq
MIRT800483	hsa-miR-1260b	CLIP-seq
MIRT800484	hsa-miR-185	CLIP-seq
MIRT800485	hsa-miR-188-3p	CLIP-seq
MIRT800486	hsa-miR-3148	CLIP-seq
MIRT800487	hsa-miR-3155	CLIP-seq
MIRT800488	hsa-miR-3155b	CLIP-seq
MIRT800489	hsa-miR-3156-3p	CLIP-seq
MIRT800490	hsa-miR-3188	CLIP-seq
MIRT800491	hsa-miR-3646	CLIP-seq
MIRT800492	hsa-miR-3662	CLIP-seq
MIRT800493	hsa-miR-3679-5p	CLIP-seq
MIRT800494	hsa-miR-4306	CLIP-seq
MIRT800495	hsa-miR-4311	CLIP-seq
MIRT800496	hsa-miR-4327	CLIP-seq
MIRT800497	hsa-miR-4428	CLIP-seq
MIRT800498	hsa-miR-4446-5p	CLIP-seq
MIRT800499	hsa-miR-4493	CLIP-seq
MIRT800500	hsa-miR-450b-3p	CLIP-seq
MIRT800501	hsa-miR-4644	CLIP-seq
MIRT800502	hsa-miR-4727-5p	CLIP-seq
MIRT800503	hsa-miR-4769-3p	CLIP-seq
MIRT800504	hsa-miR-4775	CLIP-seq
MIRT800505	hsa-miR-484	CLIP-seq
MIRT800506	hsa-miR-513a-3p	CLIP-seq
MIRT800507	hsa-miR-548p	CLIP-seq
MIRT800508	hsa-miR-590-3p	CLIP-seq
MIRT800509	hsa-miR-769-3p	CLIP-seq
MIRT800510	hsa-miR-875-3p	CLIP-seq
MIRT800511	hsa-miR-890	CLIP-seq
MIRT1936375	hsa-miR-2110	CLIP-seq
MIRT1936376	hsa-miR-3150a-3p	CLIP-seq
MIRT1936377	hsa-miR-3160-3p	CLIP-seq
MIRT1936378	hsa-miR-3175	CLIP-seq
MIRT1936379	hsa-miR-4260	CLIP-seq
MIRT1936380	hsa-miR-4300	CLIP-seq
MIRT1936381	hsa-miR-920	CLIP-seq
MIRT1936382	hsa-miR-939	CLIP-seq
MIRT2479529	hsa-miR-4276	CLIP-seq
MIRT2479530	hsa-miR-4536	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005516	Function	Calmodulin binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA

Other IDs

• MIM: 605488
• HGNC: 16968
• e!Ensembl: ENSG00000172995

Protein

• UniProt ID: Q9UBL0
• Protein name: cAMP-regulated phosphoprotein 21 (ARPP-21) (Thymocyte cAMP-regulated phosphoprotein)
• Protein function: Isoform 2 may act as a competitive inhibitor of calmodulin-dependent enzymes such as calcineurin in neurons.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01424	R3H	165 → 223	R3H domain	Domain
  PF12752	SUZ	245 → 300	SUZ domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform 2 is expressed in brain. Isoform 1 is present in immature thymocytes (at protein level). {ECO:0000269|PubMed:15096520, ECO:0000269|PubMed:8120638}.
• Sequence:

  MSEQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGA
  GKGKLTRSLAVCEESSARPGGESLQDQESIHLQLSSFSSLQEEDKSRKDDSEREKEKDKN
  KDKTSEKPKIRMLSKDCSQEYTDSTGIDLHEFLINTLKNNSRDRMILLKMEQEIIDFIAD
  NNNHYKKFPQMSSYQRMLVHRVAAYFGLDHNVDQTGKSVIINKTSSTRIPEQRFCEHLKD
  EKGEESQKRFILKRDNSSIDKEDNQQNRMHPFRDDRRSKSIEEREEEYQRVRERIFAHDS
  VCSQESLFVENSRLLEDSNICNETYKKRQLFRGNRDGSGRTSGSRQSSSENELKWSDHQR
  AWSSTDSDSSNRNLKPAMTKTASFGGITVLTRGDSTSSTRSTGKLSKAGSESSSSAGSSG
  SLSRTHPPLQSTPLVSGVAAGSPGCVPYPENGIGGQVAPSSTSYILLPLEAATGIPPGSI
  LLNPHTGQPFVNPDGTPAIYNPPTSQQPLRSAMVGQSQQQPPQQQPSPQPQQQVQPPQPQ
  MAGPLVTQRDDVATQFGQMTLSRQSSGETPEPPSGPVYPSSLMPQPAQQPSYVIASTGQQ
  LPTGGFSGSGPPISQQVLQPPPSPQGFVQQPPPAQMPVYYYPSGQYPTSTTQQYRPMAPV
  QYNAQRSQQMPQAAQQAGYQPVLSGQQGFQGLIGVQQPPQSQNVINNQQGTPVQSVMVSY
  PTMSSYQVPMTQGSQGLPQQSYQQPIMLPNQAGQGSLPATGMPVYCNVTPPTPQNNLRLI
  GPHCPSSTVPVMSASCRTNCASMSNAGWQVKF

• Sequence length: 812

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (22)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS	—	ClinGen, Disgenet ClinGen, Disgenet	29581509, 30811981, 31653410, 35525134, 38960585, 39271636, 8120638	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHY, MONOMELIC	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	23829686	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	34446935, 35764056	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	35764056	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	38538606	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	38538606	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	23829686	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	40155373	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	40155373	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	40195560	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	29942085	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Monomelic amyotrophy	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	29942085	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	29255261, 29942085, 30595370, 30643256, 32231276, 36244801	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	34446935	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	32541925, 38374256, 39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (30)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28395118		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28395118		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	25351872		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21116278	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	31653410		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	23019226		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma of lung	Lung carcinoma	BEFREE	22193543		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28395118		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	25351872		★☆☆☆☆ Found in Text Mining only
Combined immunodeficiency	Severe combined immunodeficiency disease	BEFREE	29180244		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29400656		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29400656		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29400656		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29373286		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25351872	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31443203		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	24127197		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29942085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	23019226		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22193543		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	GWASCAT_DG	29942085		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29400656		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30515211		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36297114	Associate	★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	25351872		★☆☆☆☆ Found in Text Mining only
Retinal Dystrophies	Retinal Dystrophy	BEFREE	29659094		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	22408006		★☆☆☆☆ Found in Text Mining only
Roifman-Chitayat Syndrome	Roifman-Chitayat Syndrome	BEFREE	29180244		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	25351872		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	34334530	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

YLPM1 2 shared diseasesMood disorder, Gastroesophageal reflux disease 2 shared evidence sourcesGWAS catalog (Gastroesophageal reflux disease), GWAS catalog (Mood disorder) Related via 2 shared diseases including Mood disorder, Gastroesophageal reflux disease — evidence mostly GWAS catalog. PHF2 2 shared diseasesMood disorder, Gastroesophageal reflux disease 2 shared evidence sourcesGWAS catalog (Gastroesophageal reflux disease), GWAS catalog (Mood disorder) Related via 2 shared diseases including Mood disorder, Gastroesophageal reflux disease — evidence mostly GWAS catalog. MST1R 2 shared diseasesMood disorder, Gastroesophageal reflux disease 2 shared evidence sourcesGWAS catalog (Gastroesophageal reflux disease), GWAS catalog (Mood disorder) Related via 2 shared diseases including Mood disorder, Gastroesophageal reflux disease — evidence mostly GWAS catalog. RABGAP1L 2 shared diseasesMood disorder, Gastroesophageal reflux disease 2 shared evidence sourcesGWAS catalog (Gastroesophageal reflux disease), GWAS catalog (Mood disorder) Related via 2 shared diseases including Mood disorder, Gastroesophageal reflux disease — evidence mostly GWAS catalog. CELF4 2 shared diseasesMood disorder, Gastroesophageal reflux disease 2 shared evidence sourcesGWAS catalog (Gastroesophageal reflux disease), GWAS catalog (Mood disorder) Related via 2 shared diseases including Mood disorder, Gastroesophageal reflux disease — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
YLPM1	2	["Mood disorder","Gastroesophageal reflux disease"]	0	[]	2	["GWAS catalog (Gastroesophageal reflux disease)","GWAS catalog (Mood disorder)"]
PHF2	2	["Mood disorder","Gastroesophageal reflux disease"]	0	[]	2	["GWAS catalog (Gastroesophageal reflux disease)","GWAS catalog (Mood disorder)"]
MST1R	2	["Mood disorder","Gastroesophageal reflux disease"]	0	[]	2	["GWAS catalog (Gastroesophageal reflux disease)","GWAS catalog (Mood disorder)"]
RABGAP1L	2	["Mood disorder","Gastroesophageal reflux disease"]	0	[]	2	["GWAS catalog (Gastroesophageal reflux disease)","GWAS catalog (Mood disorder)"]
CELF4	2	["Mood disorder","Gastroesophageal reflux disease"]	0	[]	2	["GWAS catalog (Gastroesophageal reflux disease)","GWAS catalog (Mood disorder)"]

Diseases Linked via Similar Genes

Schizophrenia Linked via 4 of 5 related genesPHF2, MST1R, RABGAP1L, CELF4 Irritable bowel syndrome Linked via 3 of 5 related genesYLPM1, PHF2, CELF4 Anxiety disorder Linked via 2 of 5 related genesYLPM1, CELF4 Insomnia Linked via 2 of 5 related genesPHF2, MST1R Neurodevelopmental disorder Linked via 2 of 5 related genesPHF2, CELF4

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Schizophrenia	4	["PHF2","MST1R","RABGAP1L","CELF4"]
Irritable bowel syndrome	3	["YLPM1","PHF2","CELF4"]
Anxiety disorder	2	["YLPM1","CELF4"]
Insomnia	2	["PHF2","MST1R"]
Neurodevelopmental disorder	2	["PHF2","CELF4"]