PHF2 (PHD finger protein 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5253
• Gene name: PHD finger protein 2
• Gene symbol: PHF2
• Synonyms (NCBI Gene): CENP-35, GRC5, JHDM1E, KDM7C
• Chromosome: 9
• Chromosome location: 9q22.31
• Summary: This gene encodes a protein which contains a zinc finger-like PHD (plant homeodomain) finger, distinct from other classes of zinc finger motifs, and a hydrophobic and highly conserved domain. The PHD finger shows the typical Cys4-His-Cys3 arrangement. PHD

miRNA Show/Hide all (193)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1230900	hsa-miR-1207-5p	CLIP-seq
MIRT1230901	hsa-miR-1253	CLIP-seq
MIRT1230902	hsa-miR-18a	CLIP-seq
MIRT1230903	hsa-miR-18b	CLIP-seq
MIRT1230904	hsa-miR-1909	CLIP-seq
MIRT1230905	hsa-miR-198	CLIP-seq
MIRT1230906	hsa-miR-2053	CLIP-seq
MIRT1230907	hsa-miR-214	CLIP-seq
MIRT1230908	hsa-miR-2964a-5p	CLIP-seq
MIRT1230909	hsa-miR-302a	CLIP-seq
MIRT1230910	hsa-miR-302b	CLIP-seq
MIRT1230911	hsa-miR-302c	CLIP-seq
MIRT1230912	hsa-miR-302d	CLIP-seq
MIRT1230913	hsa-miR-302e	CLIP-seq
MIRT1230914	hsa-miR-3065-5p	CLIP-seq
MIRT1230915	hsa-miR-31	CLIP-seq
MIRT1230916	hsa-miR-3121-3p	CLIP-seq
MIRT1230917	hsa-miR-3124-5p	CLIP-seq
MIRT1230918	hsa-miR-3148	CLIP-seq
MIRT1230919	hsa-miR-3184	CLIP-seq
MIRT1230920	hsa-miR-3185	CLIP-seq
MIRT1230921	hsa-miR-342-5p	CLIP-seq
MIRT1230922	hsa-miR-345	CLIP-seq
MIRT1230923	hsa-miR-3613-3p	CLIP-seq
MIRT1230924	hsa-miR-361-3p	CLIP-seq
MIRT1230925	hsa-miR-3619-5p	CLIP-seq
MIRT1230926	hsa-miR-3713	CLIP-seq
MIRT1230927	hsa-miR-372	CLIP-seq
MIRT1230928	hsa-miR-373	CLIP-seq
MIRT1230929	hsa-miR-378g	CLIP-seq
MIRT1230930	hsa-miR-3925-3p	CLIP-seq
MIRT1230931	hsa-miR-410	CLIP-seq
MIRT1230932	hsa-miR-421	CLIP-seq
MIRT1230933	hsa-miR-423-5p	CLIP-seq
MIRT1230934	hsa-miR-4251	CLIP-seq
MIRT1230935	hsa-miR-4261	CLIP-seq
MIRT1230936	hsa-miR-4283	CLIP-seq
MIRT1230937	hsa-miR-4307	CLIP-seq
MIRT1230938	hsa-miR-4312	CLIP-seq
MIRT1230939	hsa-miR-4422	CLIP-seq
MIRT1230940	hsa-miR-4435	CLIP-seq
MIRT1230941	hsa-miR-4436b-3p	CLIP-seq
MIRT1230942	hsa-miR-4437	CLIP-seq
MIRT1230943	hsa-miR-4457	CLIP-seq
MIRT1230944	hsa-miR-4496	CLIP-seq
MIRT1230945	hsa-miR-4506	CLIP-seq
MIRT1230946	hsa-miR-4508	CLIP-seq
MIRT1230947	hsa-miR-4511	CLIP-seq
MIRT1230948	hsa-miR-4530	CLIP-seq
MIRT1230949	hsa-miR-4664-5p	CLIP-seq
MIRT1230950	hsa-miR-4674	CLIP-seq
MIRT1230951	hsa-miR-4680-5p	CLIP-seq
MIRT1230952	hsa-miR-4696	CLIP-seq
MIRT1230953	hsa-miR-4698	CLIP-seq
MIRT1230954	hsa-miR-4711-3p	CLIP-seq
MIRT1230955	hsa-miR-4711-5p	CLIP-seq
MIRT1230956	hsa-miR-4735-3p	CLIP-seq
MIRT1230957	hsa-miR-4760-5p	CLIP-seq
MIRT1230958	hsa-miR-4761-5p	CLIP-seq
MIRT1230959	hsa-miR-4763-3p	CLIP-seq
MIRT1230960	hsa-miR-4766-5p	CLIP-seq
MIRT1230961	hsa-miR-4787-5p	CLIP-seq
MIRT1230962	hsa-miR-485-3p	CLIP-seq
MIRT1230963	hsa-miR-487a	CLIP-seq
MIRT1230964	hsa-miR-512-5p	CLIP-seq
MIRT1230965	hsa-miR-513b	CLIP-seq
MIRT1230966	hsa-miR-515-5p	CLIP-seq
MIRT1230967	hsa-miR-520a-3p	CLIP-seq
MIRT1230968	hsa-miR-520a-5p	CLIP-seq
MIRT1230969	hsa-miR-520b	CLIP-seq
MIRT1230970	hsa-miR-520c-3p	CLIP-seq
MIRT1230971	hsa-miR-520d-3p	CLIP-seq
MIRT1230972	hsa-miR-520e	CLIP-seq
MIRT1230973	hsa-miR-520f	CLIP-seq
MIRT1230974	hsa-miR-525-5p	CLIP-seq
MIRT1230975	hsa-miR-545	CLIP-seq
MIRT1230976	hsa-miR-548ae	CLIP-seq
MIRT1230977	hsa-miR-548aj	CLIP-seq
MIRT1230978	hsa-miR-548am	CLIP-seq
MIRT1230979	hsa-miR-548p	CLIP-seq
MIRT1230980	hsa-miR-548x	CLIP-seq
MIRT1230981	hsa-miR-569	CLIP-seq
MIRT1230982	hsa-miR-574-5p	CLIP-seq
MIRT1230983	hsa-miR-615-5p	CLIP-seq
MIRT1230984	hsa-miR-618	CLIP-seq
MIRT1230985	hsa-miR-624	CLIP-seq
MIRT1230986	hsa-miR-628-3p	CLIP-seq
MIRT1230987	hsa-miR-644	CLIP-seq
MIRT1230988	hsa-miR-647	CLIP-seq
MIRT1230989	hsa-miR-663b	CLIP-seq
MIRT1230990	hsa-miR-744	CLIP-seq
MIRT1230991	hsa-miR-759	CLIP-seq
MIRT1230992	hsa-miR-761	CLIP-seq
MIRT1230993	hsa-miR-766	CLIP-seq
MIRT1552298	hsa-miR-1261	CLIP-seq
MIRT1552299	hsa-miR-3681	CLIP-seq
MIRT1552300	hsa-miR-4753-5p	CLIP-seq
MIRT2067794	hsa-miR-106a	CLIP-seq
MIRT2067795	hsa-miR-106b	CLIP-seq
MIRT1230900	hsa-miR-1207-5p	CLIP-seq
MIRT2067796	hsa-miR-1343	CLIP-seq
MIRT2067797	hsa-miR-17	CLIP-seq
MIRT1230902	hsa-miR-18a	CLIP-seq
MIRT1230903	hsa-miR-18b	CLIP-seq
MIRT2067798	hsa-miR-1913	CLIP-seq
MIRT2067799	hsa-miR-20a	CLIP-seq
MIRT2067800	hsa-miR-20b	CLIP-seq
MIRT2067801	hsa-miR-22	CLIP-seq
MIRT2067802	hsa-miR-3120-3p	CLIP-seq
MIRT1230917	hsa-miR-3124-5p	CLIP-seq
MIRT2067803	hsa-miR-3181	CLIP-seq
MIRT2067804	hsa-miR-3192	CLIP-seq
MIRT2067805	hsa-miR-324-3p	CLIP-seq
MIRT2067806	hsa-miR-3609	CLIP-seq
MIRT1230924	hsa-miR-361-3p	CLIP-seq
MIRT1230935	hsa-miR-4261	CLIP-seq
MIRT1230936	hsa-miR-4283	CLIP-seq
MIRT1230937	hsa-miR-4307	CLIP-seq
MIRT2067807	hsa-miR-4313	CLIP-seq
MIRT1230941	hsa-miR-4436b-3p	CLIP-seq
MIRT1230943	hsa-miR-4457	CLIP-seq
MIRT1230946	hsa-miR-4508	CLIP-seq
MIRT2067808	hsa-miR-4719	CLIP-seq
MIRT1230956	hsa-miR-4735-3p	CLIP-seq
MIRT1230958	hsa-miR-4761-5p	CLIP-seq
MIRT1230959	hsa-miR-4763-3p	CLIP-seq
MIRT1230961	hsa-miR-4787-5p	CLIP-seq
MIRT2067809	hsa-miR-4796-3p	CLIP-seq
MIRT1230965	hsa-miR-513b	CLIP-seq
MIRT2067810	hsa-miR-519d	CLIP-seq
MIRT1230976	hsa-miR-548ae	CLIP-seq
MIRT2067811	hsa-miR-548ah	CLIP-seq
MIRT1230977	hsa-miR-548aj	CLIP-seq
MIRT1230978	hsa-miR-548am	CLIP-seq
MIRT1230980	hsa-miR-548x	CLIP-seq
MIRT1230983	hsa-miR-615-5p	CLIP-seq
MIRT1230985	hsa-miR-624	CLIP-seq
MIRT1230986	hsa-miR-628-3p	CLIP-seq
MIRT1230990	hsa-miR-744	CLIP-seq
MIRT2067812	hsa-miR-93	CLIP-seq
MIRT2067794	hsa-miR-106a	CLIP-seq
MIRT2067795	hsa-miR-106b	CLIP-seq
MIRT2295248	hsa-miR-1228	CLIP-seq
MIRT2295249	hsa-miR-1291	CLIP-seq
MIRT2067797	hsa-miR-17	CLIP-seq
MIRT2067799	hsa-miR-20a	CLIP-seq
MIRT2067800	hsa-miR-20b	CLIP-seq
MIRT1230907	hsa-miR-214	CLIP-seq
MIRT2295250	hsa-miR-2861	CLIP-seq
MIRT2295251	hsa-miR-3173-5p	CLIP-seq
MIRT1230922	hsa-miR-345	CLIP-seq
MIRT2067806	hsa-miR-3609	CLIP-seq
MIRT1230923	hsa-miR-3613-3p	CLIP-seq
MIRT1230925	hsa-miR-3619-5p	CLIP-seq
MIRT2295252	hsa-miR-4291	CLIP-seq
MIRT1230937	hsa-miR-4307	CLIP-seq
MIRT1230940	hsa-miR-4435	CLIP-seq
MIRT2295253	hsa-miR-4493	CLIP-seq
MIRT2295254	hsa-miR-4667-3p	CLIP-seq
MIRT2295255	hsa-miR-4667-5p	CLIP-seq
MIRT2295256	hsa-miR-4700-5p	CLIP-seq
MIRT2295257	hsa-miR-4705	CLIP-seq
MIRT2067809	hsa-miR-4796-3p	CLIP-seq
MIRT1230964	hsa-miR-512-5p	CLIP-seq
MIRT2067810	hsa-miR-519d	CLIP-seq
MIRT1230975	hsa-miR-545	CLIP-seq
MIRT1230976	hsa-miR-548ae	CLIP-seq
MIRT2067811	hsa-miR-548ah	CLIP-seq
MIRT1230977	hsa-miR-548aj	CLIP-seq
MIRT1230978	hsa-miR-548am	CLIP-seq
MIRT1230979	hsa-miR-548p	CLIP-seq
MIRT1230980	hsa-miR-548x	CLIP-seq
MIRT2295258	hsa-miR-558	CLIP-seq
MIRT2295259	hsa-miR-574-3p	CLIP-seq
MIRT1230989	hsa-miR-663b	CLIP-seq
MIRT1230992	hsa-miR-761	CLIP-seq
MIRT2295260	hsa-miR-922	CLIP-seq
MIRT2067812	hsa-miR-93	CLIP-seq
MIRT2067794	hsa-miR-106a	CLIP-seq
MIRT2067795	hsa-miR-106b	CLIP-seq
MIRT1552298	hsa-miR-1261	CLIP-seq
MIRT2067797	hsa-miR-17	CLIP-seq
MIRT2067799	hsa-miR-20a	CLIP-seq
MIRT2067800	hsa-miR-20b	CLIP-seq
MIRT2295250	hsa-miR-2861	CLIP-seq
MIRT2067806	hsa-miR-3609	CLIP-seq
MIRT1552299	hsa-miR-3681	CLIP-seq
MIRT2295253	hsa-miR-4493	CLIP-seq
MIRT1552300	hsa-miR-4753-5p	CLIP-seq
MIRT2067809	hsa-miR-4796-3p	CLIP-seq
MIRT2067810	hsa-miR-519d	CLIP-seq
MIRT2067811	hsa-miR-548ah	CLIP-seq
MIRT2067812	hsa-miR-93	CLIP-seq

Gene ontology (GO) Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IDA	20813266
GO:0000776	Component	Kinetochore	IEA
GO:0001889	Process	Liver development	TAS	21532585
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	21532585
GO:0005506	Function	Iron ion binding	IDA	21167174
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	21532585, 30021884, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	10051327
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA	20129925
GO:0005730	Component	Nucleolus	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006482	Process	Protein demethylation	IDA	21532585
GO:0008270	Function	Zinc ion binding	IDA	20129925
GO:0008270	Function	Zinc ion binding	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0032452	Function	Histone demethylase activity	IBA
GO:0032454	Function	Histone H3K9 demethylase activity	IDA	21532585
GO:0032454	Function	Histone H3K9 demethylase activity	IEA
GO:0035575	Function	Histone H4K20 demethylase activity	IEA
GO:0035575	Function	Histone H4K20 demethylase activity	ISS
GO:0045815	Process	Transcription initiation-coupled chromatin remodeling	IEA
GO:0045815	Process	Transcription initiation-coupled chromatin remodeling	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:0061188	Process	Negative regulation of rDNA heterochromatin formation	IEA
GO:0061188	Process	Negative regulation of rDNA heterochromatin formation	IMP	20129925
GO:0140002	Function	Histone H3K4me3 reader activity	IDA	20129925, 21167174

Other IDs

• MIM: 604351
• HGNC: 8920
• e!Ensembl: ENSG00000197724

Protein

• UniProt ID: O75151
• Protein name: Lysine-specific demethylase PHF2 (EC 1.14.11.-) (GRC5) (PHD finger protein 2)
• Protein function: Lysine demethylase that demethylates both histones and non-histone proteins (PubMed:20129925, PubMed:21167174, PubMed:21532585). Enzymatically inactive by itself, and becomes active following phosphorylation by PKA: forms a complex with ARID5B a
• PDB: 3KQI , 3PTR , 3PU3 , 3PU8 , 3PUA , 3PUS , 7M10 , 8F8Y , 8F8Z
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00628	PHD	7 → 56	PHD-finger	Domain
  PF02373	JmjC	236 → 336	JmjC domain, hydroxylase	Domain
  PF17811	JHD	340 → 443	Jumonji helical domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed, including in liver (at protein level). {ECO:0000269|PubMed:21532585}.
• Sequence:

  MATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKS
  TLKKKRTWHKHGPGQAPDVKPVQNGSQLFIKELRSRTFPSAEDVVARVPGSQLTLGYMEE
  HGFTEPILVPKKDGLGLAVPAPTFYVSDVENYVGPERSVDVTDVTKQKDCKMKLKEFVDY
  YYSTNRKRVLNVTNLEFSDTRMSSFVEPPDIVKKLSWVENYWPDDALLAKPKVTKYCLIC
  VKDSYTDFHIDSGGASAWYHVLKGEKTFYLIRPASANISLYERWRSASNHSEMFFADQVD
  KCYKCIVKQGQTLFIPSGWIYATLTPVDCLAFAGHFLHSLSVEMQMRAYEVERRLKLGSL
  TQFPNFETACWYMGKHLLEAFKGSHKSGKQLPPHLVQGAKILNGAFRSWTKKQALAEHED
  ELPEHFKPSQLIKDLAKEIRLSENASKAVRPEVNTVASSDEVCDGDREKEEPPSPIEATP
  PQSLLEKVSKKKTPKTVKMPKPSKIPKPPKPPKPPRPPKTLKLKDGGKKKGKKSRESASP
  TIPNLDLLEAHTKEALTKMEPPKKGKATKSVLSVPNKDVVHMQNDVERLEIREQTKSKSE
  AKWKYKNSKPDSLLKMEEEQKLEKSPLAGNKDNKFSFSFSNKKLLGSKALRPPTSPGVFG
  ALQNFKEDKPKPVRDEYEYVSDDGELKIDEFPIRRKKNAPKRDLSFLLDKKAVLPTPVTK
  PKLDSAAYKSDDSSDEGSLHIDTDTKPGRNARVKKESGSSAAGILDLLQASEEVGALEYN
  PSSQPPASPSTQEAIQGMLSMANLQASDSCLQTTWGAGQAKGSSLAAHGARKNGGGSGKS
  AGKRLLKRAAKNSVDLDDYEEEQDHLDACFKDSDYVYPSLESDEDNPIFKSRSKKRKGSD
  DAPYSPTARVGPSVPRQDRPVREGTRVASIETGLAAAAAKLSQQEEQKSKKKKSAKRKLT
  PNTTSPSTSTSISAGTTSTSTTPASTTPASTTPASTSTASSQASQEGSSPEPPPESHSSS
  LADHEYTAAGTFTGAQAGRTSQPMAPGVFLTQRRPSASSPNNNTAAKGKRTKKGMATAKQ
  RLGKILKIHRNGKLLL

• Sequence length: 1096

Pathways

Reactome Pathway:

HDMs demethylate histones

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (27)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	40155373	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism spectrum disorder	Conflicting classifications of pathogenicity; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	33632238	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	30804565, 35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	34741163, 38102678, 39620219, 40155373	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	29942085, 41233554	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	29942085	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	CTD, Disgenet CTD, Disgenet	28191889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	29255261	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PHF2-related disorder	Benign; Uncertain significance; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	38637617	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	33169155, 35396580, 39753749	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance; Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	33479058, 39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (32)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28994305, 30420689		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28994305, 30420689		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	27744626	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	34741163	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18990233		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18990233	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27744626	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31214616, 37828054	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28994305, 30420689		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25043306, 27744626		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27744626	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29416602		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	30718454	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	34741163	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	28994305	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31214616		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36872368	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29942085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	18990233		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25043306		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25043306, 27744626		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	23274892		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	GWASCAT_DG	29942085		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	37352861	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22534467, 23482805, 25043306, 27744626, 29416602		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	9933353		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	CTD_human_DG	28191889		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	23274892		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35729160	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22534467		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23482805		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25043306		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

YLPM1 3 shared diseasesMood disorder, Gastroesophageal reflux disease, Irritable bowel syndrome 3 shared evidence sourcesGWAS catalog (Gastroesophageal reflux disease), GWAS catalog (Irritable bowel syndrome), GWAS catalog (Mood disorder) Related via 3 shared diseases including Mood disorder, Gastroesophageal reflux disease — evidence mostly GWAS catalog. CSE1L 2 shared diseasesMood disorder, Post-traumatic stress disorder 2 shared evidence sourcesGWAS catalog (Mood disorder), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Mood disorder, Post-traumatic stress disorder — evidence mostly GWAS catalog. PCDHA3 2 shared diseasesGastroesophageal reflux disease, Post-traumatic stress disorder 2 shared evidence sourcesGWAS catalog (Gastroesophageal reflux disease), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Gastroesophageal reflux disease, Post-traumatic stress disorder — evidence mostly GWAS catalog. PCDHA4 2 shared diseasesGastroesophageal reflux disease, Post-traumatic stress disorder 2 shared evidence sourcesGWAS catalog (Gastroesophageal reflux disease), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Gastroesophageal reflux disease, Post-traumatic stress disorder — evidence mostly GWAS catalog. SNRK 2 shared diseasesGastroesophageal reflux disease, Post-traumatic stress disorder 2 shared evidence sourcesGWAS catalog (Gastroesophageal reflux disease), GWAS catalog (Post-traumatic stress disorder) Related via 2 shared diseases including Gastroesophageal reflux disease, Post-traumatic stress disorder — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
YLPM1	3	["Mood disorder","Gastroesophageal reflux disease","Irritable bowel syndrome"]	0	[]	3	["GWAS catalog (Gastroesophageal reflux disease)","GWAS catalog (Irritable bowel syndrome)","GWAS catalog (Mood disorder)"]
CSE1L	2	["Mood disorder","Post-traumatic stress disorder"]	0	[]	2	["GWAS catalog (Mood disorder)","GWAS catalog (Post-traumatic stress disorder)"]
PCDHA3	2	["Gastroesophageal reflux disease","Post-traumatic stress disorder"]	0	[]	2	["GWAS catalog (Gastroesophageal reflux disease)","GWAS catalog (Post-traumatic stress disorder)"]
PCDHA4	2	["Gastroesophageal reflux disease","Post-traumatic stress disorder"]	0	[]	2	["GWAS catalog (Gastroesophageal reflux disease)","GWAS catalog (Post-traumatic stress disorder)"]
SNRK	2	["Gastroesophageal reflux disease","Post-traumatic stress disorder"]	0	[]	2	["GWAS catalog (Gastroesophageal reflux disease)","GWAS catalog (Post-traumatic stress disorder)"]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 3 of 5 related genesCSE1L, PCDHA3, PCDHA4 Anxiety disorder Linked via 1 of 5 related genesYLPM1 Attention deficit hyperactivity disorder Linked via 1 of 5 related genesSNRK Bipolar disorder Linked via 1 of 5 related genesSNRK Colorectal cancer Linked via 1 of 5 related genesSNRK

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	3	["CSE1L","PCDHA3","PCDHA4"]
Anxiety disorder	1	["YLPM1"]
Attention deficit hyperactivity disorder	1	["SNRK"]
Bipolar disorder	1	["SNRK"]
Colorectal cancer	1	["SNRK"]