ADRM1 (ADRM1 26S proteasome ubiquitin receptor)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 11047
• Gene name: ADRM1 26S proteasome ubiquitin receptor
• Gene symbol: ADRM1
• Synonyms (NCBI Gene): ARM-1, ARM1, GP110, PSMD16
• Chromosome: 20
• Chromosome location: 20q13.33
• Summary: This gene encodes a member of the adhesion regulating molecule 1 protein family. The encoded protein is a component of the proteasome where it acts as a ubiquitin receptor and recruits the deubiquitinating enzyme, ubiquitin carboxyl-terminal hydrolase L5.

miRNA Show/Hide all (83)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030392	hsa-miR-24-3p	Microarray	19748357
MIRT031130	hsa-miR-19b-3p	Sequencing	20371350
MIRT052025	hsa-let-7b-5p	CLASH	23622248
MIRT049521	hsa-miR-92a-3p	CLASH	23622248
MIRT045933	hsa-miR-125b-5p	CLASH	23622248
MIRT042363	hsa-miR-484	CLASH	23622248
MIRT039100	hsa-miR-769-3p	CLASH	23622248
MIRT038868	hsa-miR-93-3p	CLASH	23622248
MIRT037740	hsa-miR-744-5p	CLASH	23622248
MIRT253721	hsa-miR-521	PAR-CLIP	23446348
MIRT253722	hsa-miR-584-3p	PAR-CLIP	23446348
MIRT253720	hsa-miR-106b-3p	PAR-CLIP	23446348
MIRT253723	hsa-miR-2276-3p	PAR-CLIP	23446348
MIRT296638	hsa-miR-6804-5p	PAR-CLIP	23446348
MIRT513483	hsa-miR-891a-5p	PAR-CLIP	23446348
MIRT253724	hsa-miR-4455	PAR-CLIP	23446348
MIRT296630	hsa-miR-4710	PAR-CLIP	23446348
MIRT513482	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT031130	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT513481	hsa-miR-4326	PAR-CLIP	23446348
MIRT513480	hsa-miR-1238-3p	PAR-CLIP	23446348
MIRT253720	hsa-miR-106b-3p	PAR-CLIP	26701625
MIRT253720	hsa-miR-106b-3p	PAR-CLIP	26701625
MIRT253720	hsa-miR-106b-3p	PAR-CLIP	26701625
MIRT513482	hsa-miR-19a-3p	PAR-CLIP	26701625
MIRT513482	hsa-miR-19a-3p	PAR-CLIP	26701625
MIRT513482	hsa-miR-19a-3p	PAR-CLIP	26701625
MIRT513482	hsa-miR-19a-3p	PAR-CLIP	26701625
MIRT513482	hsa-miR-19a-3p	PAR-CLIP	26701625
MIRT031130	hsa-miR-19b-3p	PAR-CLIP	26701625
MIRT031130	hsa-miR-19b-3p	PAR-CLIP	26701625
MIRT031130	hsa-miR-19b-3p	PAR-CLIP	26701625
MIRT031130	hsa-miR-19b-3p	PAR-CLIP	26701625
MIRT031130	hsa-miR-19b-3p	PAR-CLIP	26701625
MIRT253723	hsa-miR-2276-3p	PAR-CLIP	26701625
MIRT253723	hsa-miR-2276-3p	PAR-CLIP	26701625
MIRT253723	hsa-miR-2276-3p	PAR-CLIP	26701625
MIRT253724	hsa-miR-4455	PAR-CLIP	26701625
MIRT253724	hsa-miR-4455	PAR-CLIP	26701625
MIRT253724	hsa-miR-4455	PAR-CLIP	26701625
MIRT253724	hsa-miR-4455	PAR-CLIP	26701625
MIRT253724	hsa-miR-4455	PAR-CLIP	26701625
MIRT296630	hsa-miR-4710	PAR-CLIP	26701625
MIRT296630	hsa-miR-4710	PAR-CLIP	26701625
MIRT296630	hsa-miR-4710	PAR-CLIP	26701625
MIRT296630	hsa-miR-4710	PAR-CLIP	26701625
MIRT296630	hsa-miR-4710	PAR-CLIP	26701625
MIRT253721	hsa-miR-521	PAR-CLIP	26701625
MIRT253721	hsa-miR-521	PAR-CLIP	26701625
MIRT253721	hsa-miR-521	PAR-CLIP	26701625
MIRT296638	hsa-miR-6804-5p	PAR-CLIP	26701625
MIRT296638	hsa-miR-6804-5p	PAR-CLIP	26701625
MIRT296638	hsa-miR-6804-5p	PAR-CLIP	26701625
MIRT296638	hsa-miR-6804-5p	PAR-CLIP	26701625
MIRT296638	hsa-miR-6804-5p	PAR-CLIP	26701625
MIRT513483	hsa-miR-891a-5p	PAR-CLIP	26701625
MIRT513483	hsa-miR-891a-5p	PAR-CLIP	26701625
MIRT513483	hsa-miR-891a-5p	PAR-CLIP	26701625
MIRT513483	hsa-miR-891a-5p	PAR-CLIP	26701625
MIRT513483	hsa-miR-891a-5p	PAR-CLIP	26701625
MIRT253721	hsa-miR-521	PAR-CLIP	23446348
MIRT253722	hsa-miR-584-3p	PAR-CLIP	23446348
MIRT253720	hsa-miR-106b-3p	PAR-CLIP	23446348
MIRT253723	hsa-miR-2276-3p	PAR-CLIP	23446348
MIRT296638	hsa-miR-6804-5p	PAR-CLIP	23446348
MIRT513483	hsa-miR-891a-5p	PAR-CLIP	23446348
MIRT253724	hsa-miR-4455	PAR-CLIP	23446348
MIRT296630	hsa-miR-4710	PAR-CLIP	23446348
MIRT513482	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT031130	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT513481	hsa-miR-4326	PAR-CLIP	23446348
MIRT513480	hsa-miR-1238-3p	PAR-CLIP	23446348
MIRT770321	hsa-miR-1207-5p	CLIP-seq
MIRT770322	hsa-miR-4477a	CLIP-seq
MIRT770323	hsa-miR-4736	CLIP-seq
MIRT770324	hsa-miR-4763-3p	CLIP-seq
MIRT770325	hsa-miR-548u	CLIP-seq
MIRT770326	hsa-miR-19a	CLIP-seq
MIRT770327	hsa-miR-19b	CLIP-seq
MIRT770328	hsa-miR-2276	CLIP-seq
MIRT770322	hsa-miR-4477a	CLIP-seq
MIRT770325	hsa-miR-548u	CLIP-seq
MIRT770329	hsa-miR-891a	CLIP-seq

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	16990800, 17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0002020	Function	Protease binding	IPI	18922472
GO:0005515	Function	Protein binding	IPI	16713569, 16990800, 17139257, 18497817, 18922472, 19490896, 19615732, 20059542, 21516116, 24811749, 25416956, 27107012, 28514442, 31064842, 31515488, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006368	Process	Transcription elongation by RNA polymerase II	IMP
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0043248	Process	Proteasome assembly	IDA	16990800
GO:0061133	Function	Endopeptidase activator activity	IBA
GO:0061133	Function	Endopeptidase activator activity	IDA	16990800
GO:0070628	Function	Proteasome binding	IBA
GO:0070628	Function	Proteasome binding	IDA	18162577
GO:0140678	Function	Molecular function inhibitor activity	EXP	20471946

Other IDs

• MIM: 610650
• HGNC: 15759
• e!Ensembl: ENSG00000130706

Protein

• UniProt ID: Q16186
• Protein name: Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion-regulating molecule 1) (ARM-1) (Proteasome regulatory particle non-ATPase 13) (hRpn13) (Rpn13 homolog)
• Protein function: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins (PubMed:16815440, PubMed:16906146, PubMed:16990800, PubMed:17139257, PubMed:18497817, PubMed:24752541, PubMed:25702870, P
• PDB: 2KQZ , 2KR0 , 2L5V , 2MKZ , 2NBV , 4UEL , 4UEM , 4WLQ , 4WLR , 5IRS , 5V1Y , 5V1Z , 5YMY , 6CO4 , 6OI4 , 6UYI , 6UYJ , 7KXI , 8FTQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04683	Proteasom_Rpn13	29 → 111	Proteasome complex subunit Rpn13 ubiquitin receptor	Domain
  PF16550	RPN13_C	268 → 381	UCH-binding domain	Domain

• Sequence:

  MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFC
  WKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEH
  CRKVNEYLNNPPMPGALGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGL
  GGLGALTGPGLASLLGSSGPPGSSSSSSSRSQSAAVTPSSTTSSTRATPAPSAPAAASAT
  SPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNVPAGPAGGQQVDLASVLTPEIMAPI
  LANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFG
  LPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD

• Sequence length: 407

Pathways

KEGG Pathway	Reactome Pathway
Proteasome	UCH proteinases
Alzheimer disease	Ub-specific processing proteases
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Spinocerebellar ataxia
Prion disease
Pathways of neurodegeneration - multiple diseases
Epstein-Barr virus infection

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Prostate cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (38)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	25896055		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	31640153		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10873963	Inhibit	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	2183624	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10919708, 27336726, 31669266		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30637779, 37815873	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32916039	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18615678, 24789859, 28784174		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29913454	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	27896858		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19148532		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24789859		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31292802		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31292802		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	37815873	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29913454		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	25896055		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22576803, 30637779		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	27896858		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10919708, 27336726, 31669266		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	18615678, 21432940, 28784174		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31772654		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24968865		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24789859		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	30962236		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	9987758		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18615678, 21432940, 31669266		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	31669266		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18615678, 28784174		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18615678		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28784174	Associate	★☆☆☆☆ Found in Text Mining only
Petechiae	Petechiae	BEFREE	30870098		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31772654		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15288002, 17625943, 2472638		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	37552420	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	12409611		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35393513	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	37684377	Stimulate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

UCHL1 2 shared pathwaysParkinson disease, UCH proteinases Related via 2 shared pathways including Parkinson disease, UCH proteinases. MCU 3 shared pathwaysParkinson disease, Spinocerebellar ataxia, Prion disease Related via 3 shared pathways including Parkinson disease, Spinocerebellar ataxia. PPIF 3 shared pathwaysParkinson disease, Spinocerebellar ataxia, Prion disease Related via 3 shared pathways including Parkinson disease, Spinocerebellar ataxia. VDAC2 4 shared pathwaysParkinson disease, Spinocerebellar ataxia, Prion disease, Ub-specific processing proteases Related via 4 shared pathways including Parkinson disease, Spinocerebellar ataxia. VDAC3 4 shared pathwaysParkinson disease, Spinocerebellar ataxia, Prion disease, Ub-specific processing proteases Related via 4 shared pathways including Parkinson disease, Spinocerebellar ataxia.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
UCHL1	0	[]	2	["Parkinson disease","UCH proteinases"]	0	[]
MCU	0	[]	3	["Parkinson disease","Spinocerebellar ataxia","Prion disease"]	0	[]
PPIF	0	[]	3	["Parkinson disease","Spinocerebellar ataxia","Prion disease"]	0	[]
VDAC2	0	[]	4	["Parkinson disease","Spinocerebellar ataxia","Prion disease","Ub-specific processing proteases"]	0	[]
VDAC3	0	[]	4	["Parkinson disease","Spinocerebellar ataxia","Prion disease","Ub-specific processing proteases"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 1 of 5 related genesUCHL1 Breast neoplasms Linked via 1 of 5 related genesUCHL1 Hepatocellular carcinoma Linked via 1 of 5 related genesUCHL1 Non-small-cell lung carcinoma Linked via 1 of 5 related genesUCHL1 Early-onset progressive neurodegeneration-blindness-ataxia-spasticity syndrome Linked via 1 of 5 related genesUCHL1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	1	["UCHL1"]
Breast neoplasms	1	["UCHL1"]
Hepatocellular carcinoma	1	["UCHL1"]
Non-small-cell lung carcinoma	1	["UCHL1"]
Early-onset progressive neurodegeneration-blindness-ataxia-spasticity syndrome	1	["UCHL1"]