ADORA2B (adenosine A2b receptor)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 136
• Gene name: Adenosine A2b receptor
• Gene symbol: ADORA2B
• Synonyms (NCBI Gene): ADORA2
• Chromosome: 17
• Chromosome location: 17p12
• Summary: This gene encodes an adenosine receptor that is a member of the G protein-coupled receptor superfamily. This integral membrane protein stimulates adenylate cyclase activity in the presence of adenosine. This protein also interacts with netrin-1, which is

miRNA Show/Hide all (229)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004499	hsa-miR-27b-3p	qRT-PCR, Luciferase reporter assay	20388705
MIRT559721	hsa-miR-3681-3p	PAR-CLIP	21572407
MIRT559720	hsa-miR-216a-3p	PAR-CLIP	21572407
MIRT004499	hsa-miR-27b-3p	PAR-CLIP	21572407
MIRT076088	hsa-miR-27a-3p	PAR-CLIP	21572407
MIRT035581	hsa-miR-128-3p	PAR-CLIP	21572407
MIRT076091	hsa-miR-452-5p	PAR-CLIP	21572407
MIRT076119	hsa-miR-4676-3p	PAR-CLIP	21572407
MIRT076127	hsa-miR-892c-3p	PAR-CLIP	21572407
MIRT559719	hsa-miR-216b-3p	PAR-CLIP	21572407
MIRT076103	hsa-miR-1208	PAR-CLIP	21572407
MIRT116052	hsa-miR-545-5p	PAR-CLIP	21572407
MIRT076090	hsa-miR-377-3p	PAR-CLIP	21572407
MIRT076092	hsa-miR-513a-5p	PAR-CLIP	21572407
MIRT559718	hsa-miR-222-5p	PAR-CLIP	21572407
MIRT116049	hsa-miR-30a-3p	PAR-CLIP	21572407
MIRT116050	hsa-miR-30d-3p	PAR-CLIP	21572407
MIRT116051	hsa-miR-30e-3p	PAR-CLIP	21572407
MIRT482422	hsa-miR-944	PAR-CLIP	23592263
MIRT482421	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT482420	hsa-miR-5003-3p	PAR-CLIP	23592263
MIRT482419	hsa-miR-6504-3p	PAR-CLIP	23592263
MIRT482418	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT482417	hsa-miR-6872-3p	PAR-CLIP	23592263
MIRT482416	hsa-miR-6850-3p	PAR-CLIP	23592263
MIRT482415	hsa-miR-5095	PAR-CLIP	23592263
MIRT482414	hsa-miR-7151-3p	PAR-CLIP	23592263
MIRT482413	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT035581	hsa-miR-128-3p	Luciferase reporter assay, qRT-PCR, Western blot	26478435
MIRT035581	hsa-miR-128-3p	Luciferase reporter assay, qRT-PCR, Western blot	26478435
MIRT482418	hsa-miR-3934-5p	PAR-CLIP	26701625
MIRT482418	hsa-miR-3934-5p	PAR-CLIP	26701625
MIRT482420	hsa-miR-5003-3p	PAR-CLIP	26701625
MIRT482420	hsa-miR-5003-3p	PAR-CLIP	26701625
MIRT482415	hsa-miR-5095	PAR-CLIP	26701625
MIRT482415	hsa-miR-5095	PAR-CLIP	26701625
MIRT482421	hsa-miR-552-3p	PAR-CLIP	26701625
MIRT482421	hsa-miR-552-3p	PAR-CLIP	26701625
MIRT482419	hsa-miR-6504-3p	PAR-CLIP	26701625
MIRT482419	hsa-miR-6504-3p	PAR-CLIP	26701625
MIRT482413	hsa-miR-6807-5p	PAR-CLIP	26701625
MIRT482413	hsa-miR-6807-5p	PAR-CLIP	26701625
MIRT482416	hsa-miR-6850-3p	PAR-CLIP	26701625
MIRT482416	hsa-miR-6850-3p	PAR-CLIP	26701625
MIRT482417	hsa-miR-6872-3p	PAR-CLIP	26701625
MIRT482417	hsa-miR-6872-3p	PAR-CLIP	26701625
MIRT482414	hsa-miR-7151-3p	PAR-CLIP	26701625
MIRT482414	hsa-miR-7151-3p	PAR-CLIP	26701625
MIRT482422	hsa-miR-944	PAR-CLIP	26701625
MIRT482422	hsa-miR-944	PAR-CLIP	26701625
MIRT559721	hsa-miR-3681-3p	PAR-CLIP	21572407
MIRT559720	hsa-miR-216a-3p	PAR-CLIP	21572407
MIRT004499	hsa-miR-27b-3p	PAR-CLIP	21572407
MIRT076088	hsa-miR-27a-3p	PAR-CLIP	21572407
MIRT035581	hsa-miR-128-3p	PAR-CLIP	21572407
MIRT076091	hsa-miR-452-5p	PAR-CLIP	21572407
MIRT076119	hsa-miR-4676-3p	PAR-CLIP	21572407
MIRT076127	hsa-miR-892c-3p	PAR-CLIP	21572407
MIRT559719	hsa-miR-216b-3p	PAR-CLIP	21572407
MIRT076103	hsa-miR-1208	PAR-CLIP	21572407
MIRT116052	hsa-miR-545-5p	PAR-CLIP	21572407
MIRT076090	hsa-miR-377-3p	PAR-CLIP	21572407
MIRT076092	hsa-miR-513a-5p	PAR-CLIP	21572407
MIRT559718	hsa-miR-222-5p	PAR-CLIP	21572407
MIRT116049	hsa-miR-30a-3p	PAR-CLIP	21572407
MIRT116050	hsa-miR-30d-3p	PAR-CLIP	21572407
MIRT116051	hsa-miR-30e-3p	PAR-CLIP	21572407
MIRT482422	hsa-miR-944	PAR-CLIP	23592263
MIRT482421	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT482420	hsa-miR-5003-3p	PAR-CLIP	23592263
MIRT482419	hsa-miR-6504-3p	PAR-CLIP	23592263
MIRT482418	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT482417	hsa-miR-6872-3p	PAR-CLIP	23592263
MIRT482416	hsa-miR-6850-3p	PAR-CLIP	23592263
MIRT482415	hsa-miR-5095	PAR-CLIP	23592263
MIRT482414	hsa-miR-7151-3p	PAR-CLIP	23592263
MIRT482413	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT769598	hsa-miR-128	CLIP-seq
MIRT769599	hsa-miR-2052	CLIP-seq
MIRT769600	hsa-miR-27a	CLIP-seq
MIRT769601	hsa-miR-27b	CLIP-seq
MIRT769602	hsa-miR-3189-3p	CLIP-seq
MIRT769603	hsa-miR-33a	CLIP-seq
MIRT769604	hsa-miR-33b	CLIP-seq
MIRT769605	hsa-miR-3545-3p	CLIP-seq
MIRT769606	hsa-miR-362-5p	CLIP-seq
MIRT769607	hsa-miR-369-3p	CLIP-seq
MIRT769608	hsa-miR-374a	CLIP-seq
MIRT769609	hsa-miR-374b	CLIP-seq
MIRT769610	hsa-miR-377	CLIP-seq
MIRT769611	hsa-miR-432	CLIP-seq
MIRT769612	hsa-miR-4454	CLIP-seq
MIRT769613	hsa-miR-452	CLIP-seq
MIRT769614	hsa-miR-4528	CLIP-seq
MIRT769615	hsa-miR-4680-5p	CLIP-seq
MIRT769616	hsa-miR-4763-5p	CLIP-seq
MIRT769617	hsa-miR-4775	CLIP-seq
MIRT769618	hsa-miR-4789-3p	CLIP-seq
MIRT769619	hsa-miR-500a	CLIP-seq
MIRT769620	hsa-miR-500b	CLIP-seq
MIRT769621	hsa-miR-548l	CLIP-seq
MIRT769622	hsa-miR-548n	CLIP-seq
MIRT769623	hsa-miR-590-3p	CLIP-seq
MIRT769624	hsa-miR-633	CLIP-seq
MIRT769625	hsa-miR-642b	CLIP-seq
MIRT1927039	hsa-miR-4536	CLIP-seq
MIRT769616	hsa-miR-4763-5p	CLIP-seq
MIRT769618	hsa-miR-4789-3p	CLIP-seq
MIRT769625	hsa-miR-642b	CLIP-seq
MIRT2167921	hsa-miR-106a	CLIP-seq
MIRT2167922	hsa-miR-106b	CLIP-seq
MIRT2167923	hsa-miR-17	CLIP-seq
MIRT2167924	hsa-miR-20a	CLIP-seq
MIRT2167925	hsa-miR-20b	CLIP-seq
MIRT2167926	hsa-miR-302a	CLIP-seq
MIRT2167927	hsa-miR-302b	CLIP-seq
MIRT2167928	hsa-miR-302c	CLIP-seq
MIRT2167929	hsa-miR-302d	CLIP-seq
MIRT2167930	hsa-miR-302e	CLIP-seq
MIRT2167931	hsa-miR-372	CLIP-seq
MIRT2167932	hsa-miR-373	CLIP-seq
MIRT2167933	hsa-miR-512-3p	CLIP-seq
MIRT2167934	hsa-miR-519d	CLIP-seq
MIRT2167935	hsa-miR-520a-3p	CLIP-seq
MIRT2167936	hsa-miR-520b	CLIP-seq
MIRT2167937	hsa-miR-520c-3p	CLIP-seq
MIRT2167938	hsa-miR-520d-3p	CLIP-seq
MIRT2167939	hsa-miR-520e	CLIP-seq
MIRT2167940	hsa-miR-520g	CLIP-seq
MIRT2167941	hsa-miR-520h	CLIP-seq
MIRT2167942	hsa-miR-93	CLIP-seq
MIRT2383956	hsa-miR-1827	CLIP-seq
MIRT2383957	hsa-miR-2682	CLIP-seq
MIRT2167926	hsa-miR-302a	CLIP-seq
MIRT2167927	hsa-miR-302b	CLIP-seq
MIRT2167928	hsa-miR-302c	CLIP-seq
MIRT2167929	hsa-miR-302d	CLIP-seq
MIRT2167930	hsa-miR-302e	CLIP-seq
MIRT2383958	hsa-miR-335	CLIP-seq
MIRT2167931	hsa-miR-372	CLIP-seq
MIRT2167932	hsa-miR-373	CLIP-seq
MIRT2383959	hsa-miR-449c	CLIP-seq
MIRT1927039	hsa-miR-4536	CLIP-seq
MIRT2383960	hsa-miR-455-3p	CLIP-seq
MIRT2383961	hsa-miR-4685-5p	CLIP-seq
MIRT769618	hsa-miR-4789-3p	CLIP-seq
MIRT2167935	hsa-miR-520a-3p	CLIP-seq
MIRT2167936	hsa-miR-520b	CLIP-seq
MIRT2167937	hsa-miR-520c-3p	CLIP-seq
MIRT2167938	hsa-miR-520d-3p	CLIP-seq
MIRT2167939	hsa-miR-520e	CLIP-seq
MIRT769625	hsa-miR-642b	CLIP-seq
MIRT2443276	hsa-miR-1976	CLIP-seq
MIRT2443277	hsa-miR-3690	CLIP-seq
MIRT2443278	hsa-miR-4254	CLIP-seq
MIRT2443279	hsa-miR-4279	CLIP-seq
MIRT2443280	hsa-miR-7	CLIP-seq
MIRT2167921	hsa-miR-106a	CLIP-seq
MIRT2167922	hsa-miR-106b	CLIP-seq
MIRT2470436	hsa-miR-1287	CLIP-seq
MIRT2470437	hsa-miR-1294	CLIP-seq
MIRT2470438	hsa-miR-150	CLIP-seq
MIRT2167923	hsa-miR-17	CLIP-seq
MIRT2383956	hsa-miR-1827	CLIP-seq
MIRT2167924	hsa-miR-20a	CLIP-seq
MIRT2167925	hsa-miR-20b	CLIP-seq
MIRT2383957	hsa-miR-2682	CLIP-seq
MIRT2167926	hsa-miR-302a	CLIP-seq
MIRT2167927	hsa-miR-302b	CLIP-seq
MIRT2167928	hsa-miR-302c	CLIP-seq
MIRT2167929	hsa-miR-302d	CLIP-seq
MIRT2167930	hsa-miR-302e	CLIP-seq
MIRT2470439	hsa-miR-3135b	CLIP-seq
MIRT2383958	hsa-miR-335	CLIP-seq
MIRT2167931	hsa-miR-372	CLIP-seq
MIRT2167932	hsa-miR-373	CLIP-seq
MIRT2470440	hsa-miR-3909	CLIP-seq
MIRT2470441	hsa-miR-4312	CLIP-seq
MIRT2470442	hsa-miR-4316	CLIP-seq
MIRT2383959	hsa-miR-449c	CLIP-seq
MIRT1927039	hsa-miR-4536	CLIP-seq
MIRT2383960	hsa-miR-455-3p	CLIP-seq
MIRT2383961	hsa-miR-4685-5p	CLIP-seq
MIRT2470443	hsa-miR-4757-5p	CLIP-seq
MIRT769618	hsa-miR-4789-3p	CLIP-seq
MIRT2470444	hsa-miR-502-5p	CLIP-seq
MIRT2167933	hsa-miR-512-3p	CLIP-seq
MIRT2470445	hsa-miR-513b	CLIP-seq
MIRT2167934	hsa-miR-519d	CLIP-seq
MIRT2167935	hsa-miR-520a-3p	CLIP-seq
MIRT2167936	hsa-miR-520b	CLIP-seq
MIRT2167937	hsa-miR-520c-3p	CLIP-seq
MIRT2167938	hsa-miR-520d-3p	CLIP-seq
MIRT2167939	hsa-miR-520e	CLIP-seq
MIRT2167940	hsa-miR-520g	CLIP-seq
MIRT2167941	hsa-miR-520h	CLIP-seq
MIRT2470446	hsa-miR-548aa	CLIP-seq
MIRT2470447	hsa-miR-552	CLIP-seq
MIRT2470448	hsa-miR-570	CLIP-seq
MIRT769625	hsa-miR-642b	CLIP-seq
MIRT2167942	hsa-miR-93	CLIP-seq
MIRT2470437	hsa-miR-1294	CLIP-seq
MIRT2383956	hsa-miR-1827	CLIP-seq
MIRT2383957	hsa-miR-2682	CLIP-seq
MIRT2167926	hsa-miR-302a	CLIP-seq
MIRT2167927	hsa-miR-302b	CLIP-seq
MIRT2167928	hsa-miR-302c	CLIP-seq
MIRT2167929	hsa-miR-302d	CLIP-seq
MIRT2167930	hsa-miR-302e	CLIP-seq
MIRT2383958	hsa-miR-335	CLIP-seq
MIRT2167931	hsa-miR-372	CLIP-seq
MIRT2167932	hsa-miR-373	CLIP-seq
MIRT2470440	hsa-miR-3909	CLIP-seq
MIRT2470442	hsa-miR-4316	CLIP-seq
MIRT2383959	hsa-miR-449c	CLIP-seq
MIRT1927039	hsa-miR-4536	CLIP-seq
MIRT2383960	hsa-miR-455-3p	CLIP-seq
MIRT2383961	hsa-miR-4685-5p	CLIP-seq
MIRT769618	hsa-miR-4789-3p	CLIP-seq
MIRT2470444	hsa-miR-502-5p	CLIP-seq
MIRT2470445	hsa-miR-513b	CLIP-seq
MIRT2167935	hsa-miR-520a-3p	CLIP-seq
MIRT2167936	hsa-miR-520b	CLIP-seq
MIRT2167937	hsa-miR-520c-3p	CLIP-seq
MIRT2167938	hsa-miR-520d-3p	CLIP-seq
MIRT2167939	hsa-miR-520e	CLIP-seq
MIRT2470446	hsa-miR-548aa	CLIP-seq
MIRT2470448	hsa-miR-570	CLIP-seq
MIRT769625	hsa-miR-642b	CLIP-seq

Gene ontology (GO) Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001609	Function	G protein-coupled adenosine receptor activity	IBA
GO:0001609	Function	G protein-coupled adenosine receptor activity	IEA
GO:0001973	Process	G protein-coupled adenosine receptor signaling pathway	IEA
GO:0002882	Process	Positive regulation of chronic inflammatory response to non-antigenic stimulus	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	29568380
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7558011
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	7558011
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007190	Process	Activation of adenylate cyclase activity	TAS	8022409
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IEA
GO:0010753	Process	Positive regulation of cGMP-mediated signaling	IEA
GO:0016020	Component	Membrane	IEA
GO:0019934	Process	CGMP-mediated signaling	IEA
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0042311	Process	Vasodilation	IBA
GO:0043303	Process	Mast cell degranulation	IEA
GO:0043306	Process	Positive regulation of mast cell degranulation	IEA
GO:0045202	Component	Synapse	IEA
GO:0060087	Process	Relaxation of vascular associated smooth muscle	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA

Other IDs

• MIM: 600446
• HGNC: 264
• e!Ensembl: ENSG00000170425

Protein

• UniProt ID: P29275
• Protein name: Adenosine receptor A2b
• Protein function: Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
• PDB: 7XY6 , 7XY7 , 8HDO , 8HDP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	24 → 290	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
  IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
  RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
  YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
  GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
  FHKIISRYLLCQADVKSGNGQAGVQPALGVGL

• Sequence length: 332

Pathways

KEGG Pathway	Reactome Pathway
Rap1 signaling pathway	Adenosine P1 receptors
Calcium signaling pathway	G alpha (s) signalling events
Neuroactive ligand-receptor interaction	Surfactant metabolism
Vascular smooth muscle contraction	ADORA2B mediated anti-inflammatory cytokines production
Alcoholism

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Cervical cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	40195560	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	37040585	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	27757725	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (64)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	20619442		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	20619442		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	22679008	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	22679008		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	26232643	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23483055		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28971320, 35401817	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28830843		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	25629231		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	23584256		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	29910735		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	23855769		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20619442		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	25629231, 31263105		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23540714		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21270276, 23956030		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21270276, 23956030		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23956030		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	32075205	Associate	★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	29935799		★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Thyroid cancer	Pubtator	35203352	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	25629231	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	31263105		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington Disease	BEFREE	29651271		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	23956030, 30664911		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	16103269		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23584256, 23855769, 25318478, 29910735		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26228921	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28701304		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	29910735		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19253308	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	22038827	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	22038827, 23638125		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	22038827		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	26228921		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31802389		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	31036697		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31678144	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36786018	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23483055		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31772626		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	26228921		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26228921		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20619442		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18351132		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25087184, 27479139		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26228921	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31263105		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	23540714		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23483055, 30349649, 31846065		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23956030		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	31457100		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35562985, 37278400	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	39639217	Associate	★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	29891411		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	33658578	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	25318478, 28701304		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	CTD_human_DG	27757725		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26228921	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	40221657	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31846065		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36786018	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	28548944		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30349649		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

ADORA2A 1 shared diseaseSepsis 8 shared pathwaysRap1 signaling pathway, Calcium signaling pathway, Vascular smooth muscle contraction, Alcoholism, G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production, Surfactant metabolism, Adenosine P1 receptors 2 shared evidence sourcesCTD (Sepsis), Disgenet (Sepsis) Related via 8 shared pathways including Rap1 signaling pathway, Calcium signaling pathway — evidence mostly CTD. TEX51 1 shared diseasePelvic organ prolapse 2 shared evidence sourcesGWAS catalog (Heart failure), GWAS catalog (Pelvic organ prolapse) Related via 1 shared disease including Pelvic organ prolapse — evidence mostly GWAS catalog. ADM 1 shared diseaseSepsis 3 shared pathwaysVascular smooth muscle contraction, G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production 2 shared evidence sourcesCTD (Sepsis), Disgenet (Sepsis) Related via 3 shared pathways including Vascular smooth muscle contraction, G alpha (s) signalling events — evidence mostly CTD. RPL4 1 shared diseaseSepsis 2 shared evidence sourcesCTD (Sepsis), Disgenet (Sepsis) Related via 1 shared disease including Sepsis — evidence mostly CTD. RPL9 1 shared diseaseSepsis 2 shared evidence sourcesCTD (Sepsis), Disgenet (Sepsis) Related via 1 shared disease including Sepsis — evidence mostly CTD.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ADORA2A	1	["Sepsis"]	8	["Rap1 signaling pathway","Calcium signaling pathway","Vascular smooth muscle contraction","Alcoholism","G alpha (s) signalling events","ADORA2B mediated anti-inflammatory cytokines production","Surfactant metabolism","Adenosine P1 receptors"]	2	["CTD (Sepsis)","Disgenet (Sepsis)"]
TEX51	1	["Pelvic organ prolapse"]	0	[]	2	["GWAS catalog (Heart failure)","GWAS catalog (Pelvic organ prolapse)"]
ADM	1	["Sepsis"]	3	["Vascular smooth muscle contraction","G alpha (s) signalling events","ADORA2B mediated anti-inflammatory cytokines production"]	2	["CTD (Sepsis)","Disgenet (Sepsis)"]
RPL4	1	["Sepsis"]	0	[]	2	["CTD (Sepsis)","Disgenet (Sepsis)"]
RPL9	1	["Sepsis"]	0	[]	2	["CTD (Sepsis)","Disgenet (Sepsis)"]

Diseases Linked via Similar Genes

Schizophrenia Linked via 2 of 5 related genesADORA2A, ADM Amphetamine or sympathomimetic abuse Linked via 1 of 5 related genesADORA2A Anxiety disorder Linked via 1 of 5 related genesADORA2A Rheumatoid arthritis Linked via 1 of 5 related genesADORA2A Asthma Linked via 1 of 5 related genesADORA2A

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Schizophrenia	2	["ADORA2A","ADM"]
Amphetamine or sympathomimetic abuse	1	["ADORA2A"]
Anxiety disorder	1	["ADORA2A"]
Rheumatoid arthritis	1	["ADORA2A"]
Asthma	1	["ADORA2A"]