ADH6 (alcohol dehydrogenase 6 (class V))

Gene

• Entrez ID: 130
• Gene name: Alcohol dehydrogenase 6 (class V)
• Gene symbol: ADH6
• Synonyms (NCBI Gene): ADH-5
• Chromosome: 4
• Chromosome location: 4q23
• Summary: This gene encodes class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018289	hsa-miR-335-5p	Microarray	18185580
MIRT768672	hsa-miR-1207-3p	CLIP-seq
MIRT768673	hsa-miR-1252	CLIP-seq
MIRT768674	hsa-miR-1265	CLIP-seq
MIRT768675	hsa-miR-185	CLIP-seq
MIRT768676	hsa-miR-198	CLIP-seq
MIRT768677	hsa-miR-219-1-3p	CLIP-seq
MIRT768678	hsa-miR-2276	CLIP-seq
MIRT768679	hsa-miR-298	CLIP-seq
MIRT768680	hsa-miR-3117-5p	CLIP-seq
MIRT768681	hsa-miR-3135b	CLIP-seq
MIRT768682	hsa-miR-3189-3p	CLIP-seq
MIRT768683	hsa-miR-3545-3p	CLIP-seq
MIRT768684	hsa-miR-362-5p	CLIP-seq
MIRT768685	hsa-miR-3691-3p	CLIP-seq
MIRT768686	hsa-miR-3929	CLIP-seq
MIRT768687	hsa-miR-4267	CLIP-seq
MIRT768688	hsa-miR-4306	CLIP-seq
MIRT768689	hsa-miR-4419b	CLIP-seq
MIRT768690	hsa-miR-4468	CLIP-seq
MIRT768691	hsa-miR-4478	CLIP-seq
MIRT768692	hsa-miR-4491	CLIP-seq
MIRT768693	hsa-miR-4644	CLIP-seq
MIRT768694	hsa-miR-4653-3p	CLIP-seq
MIRT768695	hsa-miR-4657	CLIP-seq
MIRT768696	hsa-miR-4733-5p	CLIP-seq
MIRT768697	hsa-miR-4762-5p	CLIP-seq
MIRT768698	hsa-miR-4764-5p	CLIP-seq
MIRT768699	hsa-miR-4772-3p	CLIP-seq
MIRT768700	hsa-miR-485-5p	CLIP-seq
MIRT768701	hsa-miR-500b	CLIP-seq
MIRT768702	hsa-miR-520a-5p	CLIP-seq
MIRT768703	hsa-miR-525-5p	CLIP-seq
MIRT768704	hsa-miR-548aa	CLIP-seq
MIRT768705	hsa-miR-570	CLIP-seq
MIRT768706	hsa-miR-654-3p	CLIP-seq
MIRT768707	hsa-miR-759	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SP1	Unknown	12004059

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004022	Function	Alcohol dehydrogenase (NAD+) activity	IDA	1755855
GO:0004022	Function	Alcohol dehydrogenase (NAD+) activity	IEA
GO:0004745	Function	All-trans-retinol dehydrogenase (NAD+) activity	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0008270	Function	Zinc ion binding	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	NAS	1593644
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0042572	Process	Retinol metabolic process	IBA
GO:0042573	Process	Retinoic acid metabolic process	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867

Other IDs

• MIM: 103735
• HGNC: 255
• e!Ensembl: ENSG00000172955

Protein

• UniProt ID: P28332
• Protein name: Alcohol dehydrogenase 6 (EC 1.1.1.1)
• Protein function: Alcohol dehydrogenase (PubMed:1755855). Catalyzes the NAD-dependent oxidation of primary alcohols to the corresponding aldehydes (PubMed:1755855). Oxidizes secondary alcohols to the corresponding ketones (By similarity). {ECO:0000250|UniProtKB:P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08240	ADH_N	34 → 161	Alcohol dehydrogenase GroES-like domain	Domain
  PF00107	ADH_zinc_N	203 → 338	Zinc-binding dehydrogenase	Family

• Tissue specificity: TISSUE SPECIFICITY: Stomach and liver. {ECO:0000269|PubMed:1881901}.
• Sequence:

  MSTTGQVIRCKAAILWKPGAPFSIEEVEVAPPKAKEVRIKVVATGLCGTEMKVLGSKHLD
  LLYPTILGHEGAGIVESIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSK
  TQLMSDGTSRFTCKGKSIYHFGNTSTFCEYTVIKEISVAKIDAVAPLEKVCLISCGFSTG
  FGAAINTAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIGVDVNKEKFKKAQELGATE
  CLNPQDLKKPIQEVLFDMTDAGIDFCFEAIGNLDVLAAALASCNESYGVCVVVGVLPASV
  QLKISGQLFFSGRSLKGSVFGGWKSRQHIPKLVADYMAEKLNLDPLITHTLNLDKINEAV
  ELMKTGKW

• Sequence length: 368

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Astrocytoma	Astrocytoma	BEFREE	21276435		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	19077459		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26414287, 33287761, 36199423	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	36199423, 38181271	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36930359	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	26551085	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	26551085	Stimulate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	26880647		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	2169444, 26414287		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	2169444		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19077459		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29552190		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26880647, 31749429		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19077459		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29552190		★☆☆☆☆ Found in Text Mining only