ACTR8 (actin related protein 8)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 93973
• Gene name: Actin related protein 8
• Gene symbol: ACTR8
• Synonyms (NCBI Gene): ARP8, INO80N, hArp8
• Chromosome: 3
• Chromosome location: 3p21.1

miRNA Show/Hide all (184)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002578	hsa-miR-124-3p	Microarray	15685193
MIRT002578	hsa-miR-124-3p	Microarray;Other	15685193
MIRT029896	hsa-miR-26b-5p	Microarray	19088304
MIRT441268	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441268	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT764766	hsa-miR-105	CLIP-seq
MIRT764767	hsa-miR-1226	CLIP-seq
MIRT764768	hsa-miR-1236	CLIP-seq
MIRT764769	hsa-miR-1254	CLIP-seq
MIRT764770	hsa-miR-125a-5p	CLIP-seq
MIRT764771	hsa-miR-125b	CLIP-seq
MIRT764772	hsa-miR-1343	CLIP-seq
MIRT764773	hsa-miR-146a	CLIP-seq
MIRT764774	hsa-miR-146b-3p	CLIP-seq
MIRT764775	hsa-miR-146b-5p	CLIP-seq
MIRT764776	hsa-miR-155	CLIP-seq
MIRT764777	hsa-miR-197	CLIP-seq
MIRT764778	hsa-miR-200b	CLIP-seq
MIRT764779	hsa-miR-200c	CLIP-seq
MIRT764780	hsa-miR-24	CLIP-seq
MIRT764781	hsa-miR-2467-5p	CLIP-seq
MIRT764782	hsa-miR-3116	CLIP-seq
MIRT764783	hsa-miR-3150a-3p	CLIP-seq
MIRT764784	hsa-miR-3158-3p	CLIP-seq
MIRT764785	hsa-miR-3165	CLIP-seq
MIRT764786	hsa-miR-3173-5p	CLIP-seq
MIRT764787	hsa-miR-3175	CLIP-seq
MIRT764788	hsa-miR-3185	CLIP-seq
MIRT764789	hsa-miR-3188	CLIP-seq
MIRT764790	hsa-miR-338-5p	CLIP-seq
MIRT764791	hsa-miR-3616-3p	CLIP-seq
MIRT764792	hsa-miR-3619-3p	CLIP-seq
MIRT764793	hsa-miR-365	CLIP-seq
MIRT764794	hsa-miR-3690	CLIP-seq
MIRT764795	hsa-miR-370	CLIP-seq
MIRT764796	hsa-miR-371-5p	CLIP-seq
MIRT764797	hsa-miR-371b-5p	CLIP-seq
MIRT764798	hsa-miR-378g	CLIP-seq
MIRT764799	hsa-miR-3975	CLIP-seq
MIRT764800	hsa-miR-412	CLIP-seq
MIRT764801	hsa-miR-4257	CLIP-seq
MIRT764802	hsa-miR-4263	CLIP-seq
MIRT764803	hsa-miR-429	CLIP-seq
MIRT764804	hsa-miR-4319	CLIP-seq
MIRT764805	hsa-miR-4324	CLIP-seq
MIRT764806	hsa-miR-4437	CLIP-seq
MIRT764807	hsa-miR-4456	CLIP-seq
MIRT764808	hsa-miR-4468	CLIP-seq
MIRT764809	hsa-miR-4502	CLIP-seq
MIRT764810	hsa-miR-4503	CLIP-seq
MIRT764811	hsa-miR-4511	CLIP-seq
MIRT764812	hsa-miR-452	CLIP-seq
MIRT764813	hsa-miR-4643	CLIP-seq
MIRT764814	hsa-miR-4659a-3p	CLIP-seq
MIRT764815	hsa-miR-4659b-3p	CLIP-seq
MIRT764816	hsa-miR-466	CLIP-seq
MIRT764817	hsa-miR-4667-5p	CLIP-seq
MIRT764818	hsa-miR-4674	CLIP-seq
MIRT764819	hsa-miR-4676-3p	CLIP-seq
MIRT764820	hsa-miR-4691-5p	CLIP-seq
MIRT764821	hsa-miR-4698	CLIP-seq
MIRT764822	hsa-miR-4700-5p	CLIP-seq
MIRT764823	hsa-miR-4712-3p	CLIP-seq
MIRT764824	hsa-miR-4721	CLIP-seq
MIRT764825	hsa-miR-4725-5p	CLIP-seq
MIRT764826	hsa-miR-4732-3p	CLIP-seq
MIRT764827	hsa-miR-4733-3p	CLIP-seq
MIRT764828	hsa-miR-4753-3p	CLIP-seq
MIRT764829	hsa-miR-4763-5p	CLIP-seq
MIRT764830	hsa-miR-4768-5p	CLIP-seq
MIRT764831	hsa-miR-4776-5p	CLIP-seq
MIRT764832	hsa-miR-4778-5p	CLIP-seq
MIRT764833	hsa-miR-4786-5p	CLIP-seq
MIRT764834	hsa-miR-4789-3p	CLIP-seq
MIRT764835	hsa-miR-4797-5p	CLIP-seq
MIRT764836	hsa-miR-485-5p	CLIP-seq
MIRT764837	hsa-miR-495	CLIP-seq
MIRT764838	hsa-miR-499-3p	CLIP-seq
MIRT764839	hsa-miR-499a-3p	CLIP-seq
MIRT764840	hsa-miR-504	CLIP-seq
MIRT764841	hsa-miR-513c	CLIP-seq
MIRT764842	hsa-miR-514b-5p	CLIP-seq
MIRT764843	hsa-miR-548g	CLIP-seq
MIRT764844	hsa-miR-576-5p	CLIP-seq
MIRT764845	hsa-miR-589	CLIP-seq
MIRT764846	hsa-miR-767-3p	CLIP-seq
MIRT764847	hsa-miR-769-5p	CLIP-seq
MIRT764848	hsa-miR-874	CLIP-seq
MIRT764849	hsa-miR-935	CLIP-seq
MIRT764850	hsa-miR-939	CLIP-seq
MIRT1925322	hsa-miR-128	CLIP-seq
MIRT1925323	hsa-miR-15a	CLIP-seq
MIRT1925324	hsa-miR-15b	CLIP-seq
MIRT1925325	hsa-miR-16	CLIP-seq
MIRT1925326	hsa-miR-195	CLIP-seq
MIRT1925327	hsa-miR-214	CLIP-seq
MIRT1925328	hsa-miR-27a	CLIP-seq
MIRT1925329	hsa-miR-27b	CLIP-seq
MIRT1925330	hsa-miR-3117-5p	CLIP-seq
MIRT1925331	hsa-miR-3619-5p	CLIP-seq
MIRT1925332	hsa-miR-383	CLIP-seq
MIRT1925333	hsa-miR-424	CLIP-seq
MIRT1925334	hsa-miR-425	CLIP-seq
MIRT1925335	hsa-miR-4328	CLIP-seq
MIRT1925336	hsa-miR-433	CLIP-seq
MIRT764810	hsa-miR-4503	CLIP-seq
MIRT1925337	hsa-miR-4693-5p	CLIP-seq
MIRT1925338	hsa-miR-4772-5p	CLIP-seq
MIRT1925339	hsa-miR-497	CLIP-seq
MIRT1925340	hsa-miR-5096	CLIP-seq
MIRT1925341	hsa-miR-513a-5p	CLIP-seq
MIRT1925342	hsa-miR-520f	CLIP-seq
MIRT1925343	hsa-miR-636	CLIP-seq
MIRT1925344	hsa-miR-761	CLIP-seq
MIRT2166822	hsa-miR-124	CLIP-seq
MIRT764770	hsa-miR-125a-5p	CLIP-seq
MIRT764771	hsa-miR-125b	CLIP-seq
MIRT1925322	hsa-miR-128	CLIP-seq
MIRT764772	hsa-miR-1343	CLIP-seq
MIRT764777	hsa-miR-197	CLIP-seq
MIRT764780	hsa-miR-24	CLIP-seq
MIRT1925328	hsa-miR-27a	CLIP-seq
MIRT1925329	hsa-miR-27b	CLIP-seq
MIRT2166823	hsa-miR-302a	CLIP-seq
MIRT2166824	hsa-miR-302b	CLIP-seq
MIRT2166825	hsa-miR-302c	CLIP-seq
MIRT2166826	hsa-miR-302d	CLIP-seq
MIRT2166827	hsa-miR-302e	CLIP-seq
MIRT2166828	hsa-miR-31	CLIP-seq
MIRT1925330	hsa-miR-3117-5p	CLIP-seq
MIRT764784	hsa-miR-3158-3p	CLIP-seq
MIRT764790	hsa-miR-338-5p	CLIP-seq
MIRT764791	hsa-miR-3616-3p	CLIP-seq
MIRT2166829	hsa-miR-3620	CLIP-seq
MIRT2166830	hsa-miR-3671	CLIP-seq
MIRT2166831	hsa-miR-372	CLIP-seq
MIRT2166832	hsa-miR-373	CLIP-seq
MIRT764798	hsa-miR-378g	CLIP-seq
MIRT764800	hsa-miR-412	CLIP-seq
MIRT1925334	hsa-miR-425	CLIP-seq
MIRT764801	hsa-miR-4257	CLIP-seq
MIRT764804	hsa-miR-4319	CLIP-seq
MIRT764805	hsa-miR-4324	CLIP-seq
MIRT1925335	hsa-miR-4328	CLIP-seq
MIRT764806	hsa-miR-4437	CLIP-seq
MIRT2166833	hsa-miR-4493	CLIP-seq
MIRT764810	hsa-miR-4503	CLIP-seq
MIRT764813	hsa-miR-4643	CLIP-seq
MIRT764814	hsa-miR-4659a-3p	CLIP-seq
MIRT764815	hsa-miR-4659b-3p	CLIP-seq
MIRT764816	hsa-miR-466	CLIP-seq
MIRT764818	hsa-miR-4674	CLIP-seq
MIRT764825	hsa-miR-4725-5p	CLIP-seq
MIRT764833	hsa-miR-4786-5p	CLIP-seq
MIRT764834	hsa-miR-4789-3p	CLIP-seq
MIRT764838	hsa-miR-499-3p	CLIP-seq
MIRT764839	hsa-miR-499a-3p	CLIP-seq
MIRT764840	hsa-miR-504	CLIP-seq
MIRT2166834	hsa-miR-506	CLIP-seq
MIRT1925340	hsa-miR-5096	CLIP-seq
MIRT2166835	hsa-miR-512-3p	CLIP-seq
MIRT1925341	hsa-miR-513a-5p	CLIP-seq
MIRT2166836	hsa-miR-519a	CLIP-seq
MIRT2166837	hsa-miR-519b-3p	CLIP-seq
MIRT2166838	hsa-miR-519c-3p	CLIP-seq
MIRT2166839	hsa-miR-520a-3p	CLIP-seq
MIRT2166840	hsa-miR-520b	CLIP-seq
MIRT2166841	hsa-miR-520c-3p	CLIP-seq
MIRT2166842	hsa-miR-520d-3p	CLIP-seq
MIRT2166843	hsa-miR-520e	CLIP-seq
MIRT1925342	hsa-miR-520f	CLIP-seq
MIRT2166844	hsa-miR-607	CLIP-seq
MIRT1925343	hsa-miR-636	CLIP-seq
MIRT764847	hsa-miR-769-5p	CLIP-seq
MIRT1925330	hsa-miR-3117-5p	CLIP-seq
MIRT764790	hsa-miR-338-5p	CLIP-seq
MIRT2469308	hsa-miR-3646	CLIP-seq
MIRT2469309	hsa-miR-3662	CLIP-seq
MIRT764810	hsa-miR-4503	CLIP-seq
MIRT764813	hsa-miR-4643	CLIP-seq
MIRT764816	hsa-miR-466	CLIP-seq
MIRT764834	hsa-miR-4789-3p	CLIP-seq
MIRT1925330	hsa-miR-3117-5p	CLIP-seq
MIRT764810	hsa-miR-4503	CLIP-seq

Gene ontology (GO) Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000723	Process	Telomere maintenance	IEA
GO:0000723	Process	Telomere maintenance	ISO
GO:0005515	Function	Protein binding	IPI	16230350, 18163988, 18922472, 26496610, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	18026119
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005813	Component	Centrosome	IDA
GO:0006275	Process	Regulation of DNA replication	IMP	25016522
GO:0006281	Process	DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	ISO
GO:0006302	Process	Double-strand break repair	IBA
GO:0006310	Process	DNA recombination	IEA
GO:0006338	Process	Chromatin remodeling	IDA	21303910
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006974	Process	DNA damage response	IEA
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0031011	Component	Ino80 complex	IBA
GO:0031011	Component	Ino80 complex	IDA	18026119, 21303910
GO:0033044	Process	Regulation of chromosome organization	IEA
GO:0033044	Process	Regulation of chromosome organization	IMP	26340092
GO:0045739	Process	Positive regulation of DNA repair	IEA
GO:0045739	Process	Positive regulation of DNA repair	ISO
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	27641337
GO:0045935	Process	Positive regulation of nucleobase-containing compound metabolic process	IEA
GO:0045995	Process	Regulation of embryonic development	IEA
GO:0045995	Process	Regulation of embryonic development	ISO
GO:0051052	Process	Regulation of DNA metabolic process	IEA
GO:0051301	Process	Cell division	IEA
GO:0051726	Process	Regulation of cell cycle	IMP	26340092
GO:0060382	Process	Regulation of DNA strand elongation	IMP	25016522
GO:1904507	Process	Positive regulation of telomere maintenance in response to DNA damage	IEA
GO:1904507	Process	Positive regulation of telomere maintenance in response to DNA damage	ISO

Other IDs

• MIM: 619716
• HGNC: 14672
• e!Ensembl: ENSG00000113812

Protein

• UniProt ID: Q9H981
• Protein name: Actin-related protein 8 (hArp8) (INO80 complex subunit N)
• Protein function: Plays an important role in the functional organization of mitotic chromosomes. Exhibits low basal ATPase activity, and unable to polymerize.; Proposed core component of the chromatin remodeling INO80 complex which is involved in transc
• PDB: 4FO0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00022	Actin	43 → 621	Actin	Family

• Sequence:

  MTQAEKGDTENGKEKGGEKEKEQRGVKRPIVPALVPESLQEQIQSNFIIVIHPGSTTLRI
  GRATDTLPASIPHVIARRHKQQGQPLYKDSWLLREGLNKPESNEQRQNGLKMVDQAIWSK
  KMSNGTRRIPVSPEQARSYNKQMRPAILDHCSGNKWTNTSHHPEYLVGEEALYVNPLDCY
  NIHWPIRRGQLNIHPGPGGSLTAVLADIEVIWSHAIQKYLEIPLKDLKYYRCILLIPDIY
  NKQHVKELVNMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVEDGVSH
  RNTRLCLAYGGSDVSRCFYWLMQRAGFPYRECQLTNKMDCLLLQHLKETFCHLDQDISGL
  QDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQKMTTLQHRSQGDPEDPH
  DEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLGSAQGDG
  LMAGNDSEEALTALMSRKTAISLFEGKALGLDKAILHSIDCCSSDDTKKKMYSSILVVGG
  GLMFHKAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLIAWKGGAVLACLDTTQE
  LWIYQREWQRFGVRMLRERAAFVW

• Sequence length: 624

Pathways

KEGG Pathway	Reactome Pathway
ATP-dependent chromatin remodeling	UCH proteinases
	DNA Damage Recognition in GG-NER

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Familial pancreatic carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

INO80C 3 shared pathwaysATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER, UCH proteinases Related via 3 shared pathways including ATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER. INO80E 3 shared pathwaysATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER, UCH proteinases Related via 3 shared pathways including ATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER. TFPT 3 shared pathwaysATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER, UCH proteinases Related via 3 shared pathways including ATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER. NFRKB 3 shared pathwaysATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER, UCH proteinases Related via 3 shared pathways including ATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER. INO80 3 shared pathwaysATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER, UCH proteinases Related via 3 shared pathways including ATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
INO80C	0	[]	3	["ATP-dependent chromatin remodeling","DNA Damage Recognition in GG-NER","UCH proteinases"]	0	[]
INO80E	0	[]	3	["ATP-dependent chromatin remodeling","DNA Damage Recognition in GG-NER","UCH proteinases"]	0	[]
TFPT	0	[]	3	["ATP-dependent chromatin remodeling","DNA Damage Recognition in GG-NER","UCH proteinases"]	0	[]
NFRKB	0	[]	3	["ATP-dependent chromatin remodeling","DNA Damage Recognition in GG-NER","UCH proteinases"]	0	[]
INO80	0	[]	3	["ATP-dependent chromatin remodeling","DNA Damage Recognition in GG-NER","UCH proteinases"]	0	[]

Diseases Linked via Similar Genes

Color vision deficiency Linked via 1 of 5 related genesINO80C Eosinophilia Linked via 1 of 5 related genesINO80C Obesity Linked via 1 of 5 related genesTFPT Retinitis pigmentosa Linked via 1 of 5 related genesTFPT Combined immunodeficiency with granulomatosis Linked via 1 of 5 related genesINO80

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Color vision deficiency	1	["INO80C"]
Eosinophilia	1	["INO80C"]
Obesity	1	["TFPT"]
Retinitis pigmentosa	1	["TFPT"]
Combined immunodeficiency with granulomatosis	1	["INO80"]